HHsearch results for GI: peg_33 and protein with PDBid: 2f06_A

>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein structure initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron vpi-5482} SCOP: d.58.18.11 d.58.18.11
Probab=96.82  E-value=0.0055  Score=35.49  Aligned_cols=57  Identities=16%  Similarity=0.139  Sum_probs=43.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEECCCCCHHHHHHHHC
Q ss_conf             9999982878668899989973699632277421478981899999478899899999864
Q 537021.9.peg.3   25 MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSV   85 (100)
Q Consensus        25 ~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~vD~~i~~~vl~~i~~   85 (100)
                      .+...-+|+||+++++...|++++|||..++.+..  +..+..++..+.  ++.+++.|++
T Consensus        74 vvg~~m~~~~G~~a~i~~~L~~~~INI~~i~~~~s--~~~~~~vi~~~D--~~~a~~~L~~  130 (144)
T 2f06_A           74 VVGISCPNVPGALAKVLGFLSAEGVFIEYMYSFAN--NNVANVVIRPSN--MDKCIEVLKE  130 (144)
T ss_dssp             EEEEEEESSTTHHHHHHHHHHHTTCCEEEEEEEEE--TTEEEEEEEESC--HHHHHHHHHH
T ss_pred             EEECCCCCCCHHHHHHHHHHHHCCCCEEEEEEECC--CCCEEEEEECCC--HHHHHHHHHH
T ss_conf             77247667850899999999868998798752337--783699997365--9999999998