HHsearch results for GI: peg_33 and protein with PDBid: 2fgc_A

>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima MSB8} SCOP: d.58.18.6 d.58.18.6
Probab=98.19  E-value=1e-05  Score=49.93  Aligned_cols=76  Identities=16%  Similarity=0.283  Sum_probs=63.6

Q ss_pred             ECCCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEE--CCCCCHHHHHHHHCCCCEEEEEEE
Q ss_conf             5798399999828786688999899736996322774214789818999994--788998999998649882999999
Q 537021.9.peg.3   20 DIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCI--DGSILNSVLEKLSVNVTIRFVKQF   95 (100)
Q Consensus        20 ~~~~~~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~v--D~~i~~~vl~~i~~~~~v~~vr~i   95 (100)
                      ....|+|.+.=+|+||++++|+.+|+..|+||.++.++.....+..=|.+.+  |...-+.+...+.++-+|..|..+
T Consensus        26 ~~~~~~isvlVeN~pGvL~RV~glFsrRg~NIeSLsv~~te~~~iSRmTIv~~~~~~~i~qi~kQl~KLIdVi~V~dl  103 (193)
T 2fgc_A           26 QIREHLVSMLVHNKPGVMRKVANLFARRGFNISSITVGESETPGLSRLVIMVKGDDKTIEQIEKQAYKLVEVVKVTPI  103 (193)
T ss_dssp             -CEEEEEEEEEECCTTHHHHHHHHHHTTTCEEEEEEEEECSSTTEEEEEEEEEECTTHHHHHHHHHTTSTTEEEEEEC
T ss_pred             CCEEEEEEEEEECCCCHHHHHHHHHHCCCCCEEEEEEECCCCCCEEEEEEEEECCHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             210899999997878889999999864896854678502588884899999648989999999998637776899873