HHsearch results for GI: peg_33 and protein with PDBid: 3luy_A

>3luy_A Probable chorismate mutase; structural genomics, APC38059, 3- phenylpyruvate, PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis}
Probab=96.41  E-value=0.016  Score=33.08  Aligned_cols=64  Identities=13%  Similarity=0.183  Sum_probs=47.9

Q ss_pred             CEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCC--EEEEEEEECCCCCH----HHHHHHHCCCC
Q ss_conf             3999998287866889998997369963227742147898--18999994788998----99999864988
Q 537021.9.peg.3   24 LMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE--HAISFLCIDGSILN----SVLEKLSVNVT   88 (100)
Q Consensus        24 ~~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~--~A~~ii~vD~~i~~----~vl~~i~~~~~   88 (100)
                      .++++...|+||.+.++-+.|++++||.....- |-.+++  .=+-.+++++...+    ++|++|++.-.
T Consensus       209 ~~~~~~~~d~pGaL~~iL~~Fa~~~INLtkIeS-RP~~~~~~~Y~FfiD~eG~~~d~~v~~aL~~L~~~~~  278 (329)
T 3luy_A          209 VLTLIPLVTGPGVLANLLDVFRDAGLNMTSFIS-RPIKGRTGTYSFIVTLDAAPWEERFRDALVEIAEHGD  278 (329)
T ss_dssp             EEEEECSCCSTTHHHHHHHHHHHTTCCEEEEEE-EEETTEEEEEEEEEEESSCTTSHHHHHHHHHHHHTTC
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCEEEEEC-CCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHCC
T ss_conf             999998688861599999999987967688872-0078999608999998388798999999999998579