HHsearch results for GI: peg_33 and protein with PDBid: 3mtj_A

>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans}
Probab=97.44  E-value=0.00022  Score=42.89  Aligned_cols=73  Identities=16%  Similarity=0.190  Sum_probs=47.6

Q ss_pred             CEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEE-ECCCCCCEEEEEEEECCCCC----HHHHHHHHCCCCEEE-EEEEEE
Q ss_conf             399999828786688999899736996322774-21478981899999478899----899999864988299-999997
Q 537021.9.peg.3   24 LMICIVNADILGIVVFVGNILGEYGINIAHFHL-GRSQSTEHAISFLCIDGSIL----NSVLEKLSVNVTIRF-VKQFEF   97 (100)
Q Consensus        24 ~~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l-~r~~~g~~A~~ii~vD~~i~----~~vl~~i~~~~~v~~-vr~i~~   97 (100)
                      +-|-+.-.|+||++++|+++|++++|+|+++.- .+....+.+-.++-+ .+.+    ++++++|++++.+.. ...+++
T Consensus       360 yYlRl~v~D~pGVLa~It~ifa~~~ISIesv~Q~~~~~~~~~~~iVIiT-h~~~e~~l~~al~~L~~l~~V~~~~~~iRI  438 (444)
T 3mtj_A          360 YYLRLRAFDRPGVLADITRILADSSISIDAMVQKEPAEGEEQVDIILLT-HVTLEKNVNAAIAKIEALDAVAGKVMRIRL  438 (444)
T ss_dssp             EEEEEEEC-CCHHHHHHHHHHHHTTCCEEEEEECC------CEEEEEEE-CSEEHHHHHHHHHHHTTSTTBCSCCEEEEE
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCEEEEEC-CCCCHHHHHHHHHHHHCCCCCCCCCEEEEE
T ss_conf             6999991776277999999998759863333435777788703499993-849899999999998658864678519980