HHsearch results for GI: peg_33 and protein with PDBid: 3p96_A

>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium}
Probab=96.01  E-value=0.0092  Score=34.30  Aligned_cols=59  Identities=10%  Similarity=0.193  Sum_probs=39.0

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEE-EEEC--CCCCHHHHHHHH
Q ss_conf             99999828786688999899736996322774214789818999-9947--889989999986
Q 537021.9.peg.3   25 MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISF-LCID--GSILNSVLEKLS   84 (100)
Q Consensus        25 ~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~i-i~vD--~~i~~~vl~~i~   84 (100)
                      .+.+.-.|+||+++.++.+|++++.||..++..+-. |..++++ +.+.  ..-.+.+.+.+.
T Consensus        14 lit~~G~DrpGiv~~l~~~l~~~~~ni~d~~~~~l~-g~f~l~ilv~~~~~~~~~~~l~~~L~   75 (415)
T 3p96_A           14 LITVTGVDQPGVTATLFEVLSRHGVELLNVEQVVIR-HRLTLGVLVCCPADVADGPALRHDVE   75 (415)
T ss_dssp             EEEEEEECCTTHHHHHHHHHTTTTCEEEEEEEEEET-TEEEEEEEEEECHHHHTSHHHHHHHH
T ss_pred             EEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEEEEC-CEEEEEEEEEECCCCCCHHHHHHHHH
T ss_conf             999981898709999999999779988985538997-88889999981487444999999999