HHsearch results for GI: peg_33 and protein with PDBid: 3p96_A

>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium}
Probab=94.87  E-value=0.1  Score=28.77  Aligned_cols=76  Identities=9%  Similarity=0.003  Sum_probs=42.5

Q ss_pred             EEEEEECCEEEEEECCCCEEEEEECC-CCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEE--CCCCCHHHHHHH
Q ss_conf             78999799899765798399999828-786688999899736996322774214789818999994--788998999998
Q 537021.9.peg.3    7 PRFIKIQEINFDVDIGRLMICIVNAD-ILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCI--DGSILNSVLEKL   83 (100)
Q Consensus         7 ~riv~i~g~~v~~~~~~~~L~i~~~D-~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~v--D~~i~~~vl~~i   83 (100)
                      +.+...+.......+..+.+.+...| +||.+..++..|+++++||..++-  .+........+.+  ...-++.+...|
T Consensus        85 v~~~~~~~~~~~~~~~~~~v~v~g~~~~pgiv~~vt~~la~~~~ni~~i~r--~~~~~~~~ve~~~s~~~~~~~~l~~al  162 (415)
T 3p96_A           85 VSIERSDDVPIIREPSTHTIFVLGRPITAAAFGAVAREVAALGVNIDLIRG--VSDYPVIGLELRVSVPPGADEALRTAL  162 (415)
T ss_dssp             EEEEECSSSCSSCCCCSEEEEEEESSCCHHHHHHHHHHHHHTTCEEEEEEE--EESSSSEEEEEEEECCTTCHHHHHHHH
T ss_pred             EEEEECCCCHHCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCC--CCCCCCCEEEEEECCCCCCHHHHHHHH
T ss_conf             799844642210467607999975889869999999999965975323324--567865149998348878989999999


Q ss_pred             H
Q ss_conf             6
Q 537021.9.peg.3   84 S   84 (100)
Q Consensus        84 ~   84 (100)
                      .
T Consensus       163 ~  163 (415)
T 3p96_A          163 N  163 (415)
T ss_dssp             H
T ss_pred             H
T ss_conf             9