HHSEARCH alignment of GI: peg_33 and SCOP domain: d1ygya3

Alignment
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=99.90  E-value=1.4e-23  Score=142.80  Aligned_cols=77  Identities=19%  Similarity=0.273  Sum_probs=75.3

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCEEEEEEEECCCCCHHHHHHHHCCCCEEEEEEEEE
Q ss_conf             79839999982878668899989973699632277421478981899999478899899999864988299999997
Q 537021.9.peg.3   21 IGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF   97 (100)
Q Consensus        21 ~~~~~L~i~~~D~PG~I~~v~~~L~~~~INIa~m~l~r~~~g~~A~~ii~vD~~i~~~vl~~i~~~~~v~~vr~i~~   97 (100)
                      .+||+|++.|+|+||+||+|+++|++++|||++|+++|+++++.|+|++++|++++++++++|+++|+|.+||.+++
T Consensus         1 AeG~~L~i~~~D~PGvi~~I~~~l~~~~iNI~~m~~~~~~~g~~a~~vi~vD~~~~~~vl~~I~~~~~V~~v~~i~l   77 (78)
T d1ygya3           1 AQGINLIIHYVDRPGALGKIGTLLGTAGVNIQAAQLSEDAEGPGATILLRLDQDVPDDVRTAIAAAVDAYKLEVVDL   77 (78)
T ss_dssp             SCSEEEEEEESCCTTHHHHHHHHHHHTTCCEEEEEEEECSSSSCEEEEEEESSCCCHHHHHHHHHHHTEEEEEEEEC
T ss_pred             CCCEEEEEEECCCCCHHHHHHHHHHHCCCCHHHHEEEECCCCCEEEEEEECCCCCCHHHHHHHHCCCCEEEEEEEEC
T ss_conf             98169999967969979999999986496932413300578976899999377766999999972779079999966


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: ACT-like
family: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain
domain: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain
species: Mycobacterium tuberculosis [TaxId: 1773]