BLAST/PSIBLAST alignment of GI: peg_33 and GI: 190893267 at iteration 1
>gi|190893267|ref|YP_001979809.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT 652] Length = 531
>gi|190698546|gb|ACE92631.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT 652] Length = 531
 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 50/100 (50%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FNVD
Sbjct: 492 QGGDAIALLYVDGEVEDGVLERLTAHQAIRQAKLLTFNVD 531