BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.33_1
         (100 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|15891242|ref|NP_356914.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str.
           C58]
 gi|15159607|gb|AAK89699.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str.
           C58]
          Length = 531

 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 53/100 (53%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LGE G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKNINMDADVGSHMIYITNTDVPGMIGFMGTTLGEAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR VK   FNVD
Sbjct: 492 EAGDAIALLYVDGPVSEEVLDKLRANSAIRQVKPLTFNVD 531


>gi|325063120|gb|ADY66810.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium sp. H13-3]
          Length = 531

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/100 (51%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LGE G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKNINMDADVGSHMIYITNTDVPGMIGFMGTTLGEAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR V+   FN+D
Sbjct: 492 EGGDAIALLYVDGPVSEDVLDKLRANPAIRQVRPLTFNID 531


>gi|218509868|ref|ZP_03507746.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli Brasil 5]
          Length = 254

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 155 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 214

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 215 QGGDAIALLYVDGEVEDGVLEQLTAHQAIRQAKLLTFNID 254


>gi|218516339|ref|ZP_03513179.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli 8C-3]
          Length = 231

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 132 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 191

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 192 QGGDAIALLYVDGEVEDGVLEQLTAHQAIRQAKLLTFNID 231


>gi|190893267|ref|YP_001979809.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT
           652]
 gi|190698546|gb|ACE92631.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT
           652]
          Length = 531

 Score =  105 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 50/100 (50%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FNVD
Sbjct: 492 QGGDAIALLYVDGEVEDGVLERLTAHQAIRQAKLLTFNVD 531


>gi|218675485|ref|ZP_03525154.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli GR56]
          Length = 531

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGEVEDGVLERLTAHQAIRQAKLLTFNID 531


>gi|218663595|ref|ZP_03519525.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli IE4771]
          Length = 535

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 436 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGGAGVNIANFQLGRDK 495

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 496 QGGDAIALLYVDGEVEDGVLEQLTAHQAIRQAKLLTFNID 535


>gi|209550768|ref|YP_002282685.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536524|gb|ACI56459.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 531

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + ++VL +L+ N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGDVDDTVLAQLTANQAIRQAKLLTFNID 531


>gi|307300480|ref|ZP_07580260.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C]
 gi|306904646|gb|EFN35230.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C]
          Length = 531

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ I N D+ G++ F+G+ LG+ G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYITNTDVPGMIGFIGSTLGDAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGPVSEIVLDKLRANEAIRQAKPLVFNID 531


>gi|307318345|ref|ZP_07597780.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti AK83]
 gi|306896027|gb|EFN26778.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti AK83]
          Length = 531

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ I N D+ G++ F+G+ LG+ G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYITNTDVPGMIGFIGSTLGDAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGPVSEIVLDKLRANEAIRQAKPLVFNID 531


>gi|15966483|ref|NP_386836.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti 1021]
 gi|15075754|emb|CAC47309.1| Putative D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti
           1021]
          Length = 531

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ I N D+ G++ F+G+ LG+ G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYITNTDVPGMIGFIGSTLGDAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGPVSEIVLDKLRANEAIRQAKPLVFNID 531


>gi|327193458|gb|EGE60354.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli
           CNPAF512]
          Length = 531

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGEVEDGVLEQLTAHQAIRQAKLLTFNID 531


>gi|150397816|ref|YP_001328283.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium medicae WSM419]
 gi|150029331|gb|ABR61448.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium medicae WSM419]
          Length = 531

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 68/100 (68%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ + N D+ G++ F+G+ LG+ G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGAHMVYLTNTDVPGMIGFIGSTLGDAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +  +VL++L  N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGPVSETVLDRLRANEAIRQAKPLVFNID 531


>gi|17939923|emb|CAD19520.1| d-3 phosphoglycerate dehydrogenase, L-serine dehydratase [Rhizobium
           etli]
          Length = 125

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 66/100 (66%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 26  VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 85

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VL +L+ +  IR  K   FN+D
Sbjct: 86  QGGDAIALLYVDGEVEDGVLTQLTAHQAIRQAKLLTFNID 125


>gi|163758780|ref|ZP_02165867.1| D-3-phosphoglycerate dehydrogenase [Hoeflea phototrophica DFL-43]
 gi|162284070|gb|EDQ34354.1| D-3-phosphoglycerate dehydrogenase [Hoeflea phototrophica DFL-43]
          Length = 531

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 68/100 (68%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G+ MI I N D+ G++ F+G+ LG+ G+NIA+FHLGR  
Sbjct: 432 VFSDGKPRFIQIKGINMDADVGQHMIYIANTDVPGMIGFMGSTLGDAGVNIANFHLGRET 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            +  AI+ L +D  +   VL KL+ +  I+  K   FNVD
Sbjct: 492 ESGDAIALLYVDELVSQDVLAKLTAHHAIKQAKPLVFNVD 531


>gi|227823299|ref|YP_002827271.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium fredii NGR234]
 gi|227342300|gb|ACP26518.1| phosphoglycerate dehydrogenase [Sinorhizobium fredii NGR234]
          Length = 531

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 66/100 (66%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ + N D+ G++ F+G  LG+  +NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYLTNTDVPGMIGFIGTTLGDANVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +  +VL+KL  N  +R  K   FNVD
Sbjct: 492 QGGDAIALLYVDGPVSEAVLDKLRANPAVRQAKPLVFNVD 531


>gi|241206175|ref|YP_002977271.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860065|gb|ACS57732.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 531

 Score =  102 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + ++VL +L+ +  +R  K   FN+D
Sbjct: 492 QGGDAIALLYVDGKVDDAVLAELTAHQAVRQAKPLTFNID 531


>gi|86359045|ref|YP_470937.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli CFN 42]
 gi|86283147|gb|ABC92210.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CFN 42]
          Length = 531

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 66/100 (66%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VL +L+ +  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGEVEDGVLTQLTAHQAIRQAKLLTFNID 531


>gi|116253700|ref|YP_769538.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258348|emb|CAK09450.1| putative D-3-phosphoglycerate dehydrogenase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 531

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + ++VL +L+ +  +R  K   FN+D
Sbjct: 492 QGGDAIALLYVDGKVDDAVLAELTAHQAVRQAKPLTFNID 531


>gi|222086960|ref|YP_002545494.1| D-3-phosphoglycerate dehydrogenase protein [Agrobacterium
           radiobacter K84]
 gi|221724408|gb|ACM27564.1| D-3-phosphoglycerate dehydrogenase protein [Agrobacterium
           radiobacter K84]
          Length = 531

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ + N D+ G++ F+G+ LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYLANTDVPGMIGFIGSTLGSAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG I + VL KL+ +  IR  K   FNVD
Sbjct: 492 QGGDAIALLYVDGPINDEVLGKLTAHQAIRQAKPLVFNVD 531


>gi|222149645|ref|YP_002550602.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis S4]
 gi|221736627|gb|ACM37590.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis S4]
          Length = 531

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/100 (46%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGPHMIYISNTDVPGMIGFMGTTLGNAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            +  AI+ L +DG +  +VL++L+ N  I+  +   F V+
Sbjct: 492 ESGDAIALLYVDGPVEQTVLDQLTANAAIKQARLLTFAVE 531


>gi|319781038|ref|YP_004140514.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166926|gb|ADV10464.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 533

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 66/99 (66%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G+ M+   NAD  GI+  +G + GE G+NIA+F LGR++ 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGQHMLYTTNADAPGIIGLLGTVCGENGVNIANFQLGRNRP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
              AI+ L +D     +VLEK+  + +I   K+ +F+V+
Sbjct: 493 GGDAIALLYLDAPFPEAVLEKVKAHKSIDSAKRLQFDVN 531


>gi|61612115|gb|AAX47292.1| 3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri]
          Length = 533

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 66/99 (66%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G+ M+   NAD  GI+  +G + GE G+NIA+F LGR++ 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGQHMLYTTNADAPGIIGLLGTVCGENGVNIANFQLGRNRP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
              AI+ L +D     +VLEK+  + +I   K+ +F+V+
Sbjct: 493 GGDAIALLYLDAPFPEAVLEKVKAHKSIDSAKRLQFDVN 531


>gi|149912706|ref|ZP_01901240.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. AzwK-3b]
 gi|149813112|gb|EDM72938.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. AzwK-3b]
          Length = 531

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 64/99 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IGR M+   N D  GI+  +G  +GE G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGRHMLYTTNNDEPGIIGTLGQTMGENGVNIANFTLGRSN 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  I  +V++KL      + V+  +F+V
Sbjct: 492 AGGEAIALLYVDAPIETAVIKKLEATGKFQQVRALQFDV 530


>gi|310814538|ref|YP_003962502.1| D-3-phosphoglycerate dehydrogenase [Ketogulonicigenium vulgare Y25]
 gi|308753273|gb|ADO41202.1| D-3-phosphoglycerate dehydrogenase [Ketogulonicigenium vulgare Y25]
          Length = 531

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 46/100 (46%), Positives = 64/100 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+EIN D +IG  MI   N D+ G++  +G ILGE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKEINVDAEIGADMIYTTNKDVPGVIGTLGGILGENGVNIANFTLGRAD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG    +VL+K+  +     V    F+V+
Sbjct: 492 QGGEAIAVLYVDGRPDEAVLDKVRASGKFGQVTAMHFDVN 531


>gi|260467077|ref|ZP_05813257.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium opportunistum
           WSM2075]
 gi|259029186|gb|EEW30482.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium opportunistum
           WSM2075]
          Length = 533

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 42/98 (42%), Positives = 64/98 (65%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G+ M+   NAD  GI+  +G + GE G+NIA+F LGR++ 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGQHMLYTTNADAPGIIGLLGTVCGENGVNIANFQLGRNRP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D      VLE++  + +I   K+ +F+V
Sbjct: 493 GGDAIALLYLDAPFPEKVLEQVRAHKSIDSAKRLQFDV 530


>gi|13473319|ref|NP_104886.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium loti MAFF303099]
 gi|14024068|dbj|BAB50672.1| phosphoglycerate dehydrogenase [Mesorhizobium loti MAFF303099]
          Length = 533

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 42/98 (42%), Positives = 64/98 (65%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G+ M+   NAD  GI+  +G + GE G+NIA+F LGR++ 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGQHMLYTTNADAPGIIGLLGTVCGENGVNIANFQLGRNRP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D      VLE++  + +I   K+ +F+V
Sbjct: 493 GGDAIALLYLDAPFPEKVLEQVRAHKSIDSAKRLQFDV 530


>gi|77464929|ref|YP_354433.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides 2.4.1]
 gi|221640849|ref|YP_002527111.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides KD131]
 gi|77389347|gb|ABA80532.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides 2.4.1]
 gi|221161630|gb|ACM02610.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides KD131]
          Length = 534

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 63/98 (64%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++GR M+   N D+ GI+  +G  +G+ G+NIA+F LGR+  
Sbjct: 436 FSDGKPRFIQIKGINIDAEVGRHMLYTTNEDVPGIIGLLGMTMGKNGVNIANFTLGRTSV 495

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            + AI+ L +D +I   V+E L      + VK  EF+V
Sbjct: 496 GQEAIAILYLDQAIDPKVVETLESTGLFQQVKPLEFDV 533


>gi|255264452|ref|ZP_05343794.1| phosphoglycerate dehydrogenase [Thalassiobium sp. R2A62]
 gi|255106787|gb|EET49461.1| phosphoglycerate dehydrogenase [Thalassiobium sp. R2A62]
          Length = 530

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG+ M+   N D+ GI+  +G  +GE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGQHMLYTTNEDVPGIIGTLGQTMGENGVNIANFTLGRAD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L ID  +   V+ KL        VK  +F+V
Sbjct: 492 RGGEAIALLYIDDPVAADVIAKLEATEMFTQVKPLDFDV 530


>gi|126460798|ref|YP_001041912.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102462|gb|ABN75140.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 531

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 63/98 (64%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++GR M+   N D+ GI+  +G  +G+ G+NIA+F LGR+  
Sbjct: 433 FSDGKPRFIQIKGINIDAEVGRHMLYTTNEDVPGIIGLLGMTMGKNGVNIANFTLGRTSV 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            + AI+ L +D +I   V+E L      + VK  EF+V
Sbjct: 493 GQEAIAILYLDQAIDPKVVETLESTGLFQQVKPLEFDV 530


>gi|254700347|ref|ZP_05162175.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261750842|ref|ZP_05994551.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261740595|gb|EEY28521.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
          Length = 533

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 42/98 (42%), Positives = 61/98 (62%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR Q 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDQP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|85705886|ref|ZP_01036982.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. 217]
 gi|85669474|gb|EAQ24339.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. 217]
          Length = 531

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 64/99 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IGR M+   N D+ GI+  +G  +GE G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGRHMLYTTNEDVPGIIGTLGMTMGENGVNIANFTLGRSD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  + ++ L      + +++ +F+V
Sbjct: 492 AGGEAIALLYVDAPVPEAAIKALHATGKFQQIRELKFDV 530


>gi|149202983|ref|ZP_01879954.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. TM1035]
 gi|149143529|gb|EDM31565.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. TM1035]
          Length = 531

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 64/99 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IGR M+   N D+ GI+  +G  +G++G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGRHMLYTTNEDVPGIIGTLGMTMGDHGVNIANFTLGRSD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  + ++ L      + +++  F+V
Sbjct: 492 AGGEAIALLYVDAPVPEAAIKALHATGKFQQIRELRFDV 530


>gi|146276068|ref|YP_001166227.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554309|gb|ABP68922.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 531

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 63/98 (64%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++GR M+   N D+ GI+  +G  +G+ G+NIA+F LGR+  
Sbjct: 433 FSDGKPRFIQIKGINIDAEVGRHMLYTTNEDVPGIIGLLGMTMGKNGVNIANFTLGRTSV 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            + AI+ L +D +I   V+E L      + VK  EF+V
Sbjct: 493 GQEAIAILYLDQAIDPKVVETLESTGMFQQVKPLEFDV 530


>gi|254462167|ref|ZP_05075583.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium HTCC2083]
 gi|206678756|gb|EDZ43243.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 531

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +GN +G+ G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDVPGIIGLLGNTMGKSGVNIANFTLGRAD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  I   VL+ L        VK  EF+V
Sbjct: 492 VGGEAIALLYVDNPIPADVLKTLDGTGMFSQVKPLEFDV 530


>gi|114763689|ref|ZP_01443083.1| D-3-phosphoglycerate dehydrogenase [Pelagibaca bermudensis
           HTCC2601]
 gi|114543690|gb|EAU46703.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. HTCC2601]
          Length = 531

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 63/99 (63%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G +LGE+ +N+A+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGEHMLYTTNEDVPGIIGKLGTMLGEHKVNLANFTLGRSA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+   +D ++  SV++ L      R VK  EF+V
Sbjct: 492 QGGEAIAIAYLDEAMDASVVDALKATGLFRQVKPLEFDV 530


>gi|239832773|ref|ZP_04681102.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum intermedium LMG
           3301]
 gi|239825040|gb|EEQ96608.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum intermedium LMG
           3301]
          Length = 538

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 61/98 (62%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 438 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHNVNIANFSLGRDHP 497

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L+    I+     EFNV
Sbjct: 498 GGDAIAMLYVDEQIPQAALDELTAQEAIKAATPLEFNV 535


>gi|237816063|ref|ZP_04595059.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus str. 2308 A]
 gi|237788726|gb|EEP62938.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus str. 2308 A]
          Length = 538

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 438 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 497

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 498 GGDAIAMLYVDEQIPQAALDELMAQEAIRVATPLEFNV 535


>gi|83952581|ref|ZP_00961312.1| D-3-phosphoglycerate dehydrogenase [Roseovarius nubinhibens ISM]
 gi|83836254|gb|EAP75552.1| D-3-phosphoglycerate dehydrogenase [Roseovarius nubinhibens ISM]
          Length = 531

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 63/99 (63%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D  GI+  +G  +G+ G+NIA+F LGRSQ
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDEPGIIGMLGQTMGQNGVNIANFTLGRSQ 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   V+++L      + V+  +F+V
Sbjct: 492 AGGEAIALLYVDAEVPAPVIKQLEDTGMFKQVRPLQFDV 530


>gi|163745024|ref|ZP_02152384.1| D-3-phosphoglycerate dehydrogenase [Oceanibulbus indolifex HEL-45]
 gi|161381842|gb|EDQ06251.1| D-3-phosphoglycerate dehydrogenase [Oceanibulbus indolifex HEL-45]
          Length = 531

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ I  D +IG  M+   N D+ GI+  +G  +GE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGITIDAEIGEHMLYTTNEDVPGIIGTLGQTMGENGVNIANFTLGRNT 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  +V+ KL      R +K  +F+V
Sbjct: 492 AKGEAIALLYVDDQVPEAVIGKLRDTGMFRQIKPLQFDV 530


>gi|62290557|ref|YP_222350.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 1 str.
           9-941]
 gi|82700473|ref|YP_415047.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis biovar
           Abortus 2308]
 gi|189024778|ref|YP_001935546.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus S19]
 gi|254689854|ref|ZP_05153108.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|254694347|ref|ZP_05156175.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698003|ref|ZP_05159831.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730889|ref|ZP_05189467.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|256258108|ref|ZP_05463644.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|260547197|ref|ZP_05822935.1| SerA family protein [Brucella abortus NCTC 8038]
 gi|260755386|ref|ZP_05867734.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260758607|ref|ZP_05870955.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260762439|ref|ZP_05874776.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884402|ref|ZP_05896016.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|261214655|ref|ZP_05928936.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297248957|ref|ZP_06932665.1| phosphoglycerate dehydrogenase [Brucella abortus bv. 5 str. B3196]
 gi|62196689|gb|AAX74989.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 1
           str. 9-941]
 gi|82616574|emb|CAJ11653.1| ATP/GTP-binding site motif A (P-loop):Amino acid-binding
           ACT:D-isomer specific 2-hydroxyacid dehydrogenase,
           catalytic domain: [Brucella melitensis biovar Abortus
           2308]
 gi|189020350|gb|ACD73072.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus S19]
 gi|260095562|gb|EEW79440.1| SerA family protein [Brucella abortus NCTC 8038]
 gi|260668925|gb|EEX55865.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260672865|gb|EEX59686.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675494|gb|EEX62315.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260873930|gb|EEX80999.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|260916262|gb|EEX83123.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297174090|gb|EFH33447.1| phosphoglycerate dehydrogenase [Brucella abortus bv. 5 str. B3196]
          Length = 533

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRVATPLEFNV 530


>gi|89070040|ref|ZP_01157371.1| D-3-phosphoglycerate dehydrogenase [Oceanicola granulosus HTCC2516]
 gi|89044377|gb|EAR50515.1| D-3-phosphoglycerate dehydrogenase [Oceanicola granulosus HTCC2516]
          Length = 530

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG+ M+   N D+ GI+  +G  +G  G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGQHMLYTTNEDVPGIIGTLGTTMGSNGVNIANFTLGRSA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +    L+ L      R VK  +F V
Sbjct: 492 AKGEAIALLYVDEEVPAKALDALKQTGMFRQVKTLQFEV 530


>gi|225628254|ref|ZP_03786288.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti str. Cudo]
 gi|225616100|gb|EEH13148.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti str. Cudo]
          Length = 538

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 438 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 497

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 498 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 535


>gi|294850937|ref|ZP_06791613.1| phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|294821580|gb|EFG38576.1| phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-0026]
          Length = 533

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|256160401|ref|ZP_05458090.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
 gi|265998770|ref|ZP_06111327.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
 gi|262553459|gb|EEZ09228.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
          Length = 533

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|260167901|ref|ZP_05754712.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
 gi|261757340|ref|ZP_06001049.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
 gi|261737324|gb|EEY25320.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
          Length = 533

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|254708700|ref|ZP_05170511.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261316192|ref|ZP_05955389.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261295415|gb|EEX98911.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
          Length = 533

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|163845265|ref|YP_001622920.1| D-3-phosphoglycerate dehydrogenase [Brucella suis ATCC 23445]
 gi|163675988|gb|ABY40098.1| D-3-phosphoglycerate dehydrogenase [Brucella suis ATCC 23445]
          Length = 533

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|23502543|ref|NP_698670.1| D-3-phosphoglycerate dehydrogenase [Brucella suis 1330]
 gi|148559678|ref|YP_001259539.1| D-3-phosphoglycerate dehydrogenase [Brucella ovis ATCC 25840]
 gi|161619616|ref|YP_001593503.1| D-3-phosphoglycerate dehydrogenase [Brucella canis ATCC 23365]
 gi|254703466|ref|ZP_05165294.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|254708447|ref|ZP_05170275.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|254714547|ref|ZP_05176358.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|254717444|ref|ZP_05179255.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|254719689|ref|ZP_05181500.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|256030226|ref|ZP_05443840.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|256061723|ref|ZP_05451860.1| D-3-phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|256370095|ref|YP_003107606.1| D-3-phosphoglycerate dehydrogenase [Brucella microti CCM 4915]
 gi|260568773|ref|ZP_05839241.1| SerA family protein [Brucella suis bv. 4 str. 40]
 gi|261219276|ref|ZP_05933557.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|261315946|ref|ZP_05955143.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261322337|ref|ZP_05961534.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|261325728|ref|ZP_05964925.1| phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|261754095|ref|ZP_05997804.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|265984704|ref|ZP_06097439.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|265987255|ref|ZP_06099812.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|306837853|ref|ZP_07470715.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. NF 2653]
 gi|306841404|ref|ZP_07474106.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO2]
 gi|306844678|ref|ZP_07477263.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO1]
 gi|23348542|gb|AAN30585.1| D-3-phosphoglycerate dehydrogenase [Brucella suis 1330]
 gi|148370935|gb|ABQ60914.1| phosphoglycerate dehydrogenase [Brucella ovis ATCC 25840]
 gi|161336427|gb|ABX62732.1| D-3-phosphoglycerate dehydrogenase [Brucella canis ATCC 23365]
 gi|256000258|gb|ACU48657.1| D-3-phosphoglycerate dehydrogenase [Brucella microti CCM 4915]
 gi|260154157|gb|EEW89239.1| SerA family protein [Brucella suis bv. 4 str. 40]
 gi|260924365|gb|EEX90933.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|261295027|gb|EEX98523.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|261301708|gb|EEY05205.1| phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|261304972|gb|EEY08469.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261743848|gb|EEY31774.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|264659452|gb|EEZ29713.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|264663296|gb|EEZ33557.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|306274850|gb|EFM56620.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO1]
 gi|306288510|gb|EFM59862.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO2]
 gi|306407092|gb|EFM63309.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. NF 2653]
          Length = 533

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|17986632|ref|NP_539266.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
 gi|17982247|gb|AAL51530.1| d-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
          Length = 538

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 438 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 497

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 498 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 535


>gi|86139432|ref|ZP_01058001.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. MED193]
 gi|85823935|gb|EAQ44141.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. MED193]
          Length = 531

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 63/99 (63%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +GE+G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNNDVPGIIGTLGQTMGEHGVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D ++      KL+       +K  +F+V
Sbjct: 492 AGGEAIALLYVDAAVPAEARAKLAETDLFNQIKPLQFDV 530


>gi|304394494|ref|ZP_07376415.1| phosphoglycerate dehydrogenase [Ahrensia sp. R2A130]
 gi|303293404|gb|EFL87783.1| phosphoglycerate dehydrogenase [Ahrensia sp. R2A130]
          Length = 533

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 59/97 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN + + G  M+   N+D  GI+  +G + GE G+NIAHF+LGR+ 
Sbjct: 435 VFSDGKPRFIQIKGINMEAEAGEHMLYTTNSDAPGIIGKLGTLFGEAGVNIAHFYLGRNH 494

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AIS + +D  +    LEKL     I   K  EF
Sbjct: 495 AGGDAISLIQLDHPVPADFLEKLKDTPEIDSAKPLEF 531


>gi|225853142|ref|YP_002733375.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis ATCC 23457]
 gi|256045296|ref|ZP_05448190.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256263367|ref|ZP_05465899.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260565812|ref|ZP_05836295.1| aspartyl/glutamyl tRNA amidotransferase subunit C [Brucella
           melitensis bv. 1 str. 16M]
 gi|265991722|ref|ZP_06104279.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|225641507|gb|ACO01421.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis ATCC 23457]
 gi|260151185|gb|EEW86280.1| aspartyl/glutamyl tRNA amidotransferase subunit C [Brucella
           melitensis bv. 1 str. 16M]
 gi|263002678|gb|EEZ15081.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093365|gb|EEZ17434.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|326409698|gb|ADZ66763.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis M28]
 gi|326539406|gb|ADZ87621.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis M5-90]
          Length = 533

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|256114254|ref|ZP_05454999.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265995559|ref|ZP_06108116.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|262766843|gb|EEZ12461.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
          Length = 533

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|159045858|ref|YP_001534652.1| D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shibae DFL 12]
 gi|157913618|gb|ABV95051.1| D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shibae DFL 12]
          Length = 531

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D  G++  +G ILGE  +NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGEHMLYTTNKDTPGMIGTLGGILGENQVNIANFTLGRNE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   V +KL      + V+  +FNV
Sbjct: 492 TNGDAIAMLYLDAPLPRDVQDKLIATGLFQQVRPLQFNV 530


>gi|126738641|ref|ZP_01754346.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. SK209-2-6]
 gi|126720440|gb|EBA17146.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. SK209-2-6]
          Length = 531

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +GE+G+NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNNDVPGIIGSLGQTMGEHGVNIANFTLGRSE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+       +K  +F+V
Sbjct: 492 AGGEAIALLYVDEPVPAEARAKLAETDLFNQIKPLQFDV 530


>gi|260432240|ref|ZP_05786211.1| phosphoglycerate dehydrogenase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416068|gb|EEX09327.1| phosphoglycerate dehydrogenase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 531

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +GE+G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGKTMGEHGVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+       +K  EF+V
Sbjct: 492 AGGEAIALLYVDEPVPAEARAKLAETGLFTQIKPLEFDV 530


>gi|254466037|ref|ZP_05079448.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium Y4I]
 gi|206686945|gb|EDZ47427.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium Y4I]
          Length = 531

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN + D+G  M+   N D+ GI+  +G  LG+ G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINLEADVGAHMLYTTNEDVPGIIGTLGQTLGDNGVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   +  KL+       +K  EF+V
Sbjct: 492 AGGEAIALLYVDEPVPAEIRAKLAETGLFNQIKPLEFDV 530


>gi|254486096|ref|ZP_05099301.1| phosphoglycerate dehydrogenase [Roseobacter sp. GAI101]
 gi|214042965|gb|EEB83603.1| phosphoglycerate dehydrogenase [Roseobacter sp. GAI101]
          Length = 531

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +G  LG  G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDVPGIIGTLGQTLGANGVNIANFTLGRSV 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L ID  +  + +++L        VK+ EF+V
Sbjct: 492 AKGEAIALLYIDDVLPATAIKQLQDTGLFTQVKELEFDV 530


>gi|110635490|ref|YP_675698.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium sp. BNC1]
 gi|110286474|gb|ABG64533.1| D-3-phosphoglycerate dehydrogenase [Chelativorans sp. BNC1]
          Length = 532

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D  GI+  +G I G++G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINLDAEVGEHMLYTTNNDTPGIIGQLGTICGKHGVNIANFQLGRNR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D      VLE+L    +I   K   F+V
Sbjct: 492 PGGDAIALLYLDAPFPQPVLEELKSTGSIISAKPLRFDV 530


>gi|83855133|ref|ZP_00948663.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. NAS-14.1]
 gi|83842976|gb|EAP82143.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. NAS-14.1]
          Length = 531

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN + ++G  M+   N D+ GI+  +G  LG   +NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIEAEVGAHMLYTTNNDVPGIIGTLGQTLGANDVNIANFTLGRST 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L IDG +    L+ L      + VK+ EF V
Sbjct: 492 AKGEAIALLYIDGPLPEKALKDLRDTGLFKQVKELEFEV 530


>gi|260429359|ref|ZP_05783336.1| phosphoserine aminotransferase [Citreicella sp. SE45]
 gi|260419982|gb|EEX13235.1| phosphoserine aminotransferase [Citreicella sp. SE45]
          Length = 918

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 64/99 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G +LG++ +N+A+F LGRS 
Sbjct: 819 VFSDGKPRFIQIKGINIDAEVGEHMLYTTNEDVPGIIGKLGTLLGDHKVNLANFTLGRSA 878

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+   +D ++ +SV++ L      R VK  EF++
Sbjct: 879 QGAEAIAISYLDEALDDSVVKALKDTGLFRQVKPLEFDL 917


>gi|83941656|ref|ZP_00954118.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. EE-36]
 gi|83847476|gb|EAP85351.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. EE-36]
          Length = 531

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN + ++G  M+   N D+ GI+  +G  LG   +NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIEAEVGAHMLYTTNNDVPGIIGTLGQTLGANDVNIANFTLGRST 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L IDG +    L+ L      + VK+ EF V
Sbjct: 492 AKGEAIALLYIDGPLPEKALKDLRDTGLFKQVKELEFEV 530


>gi|254453066|ref|ZP_05066503.1| phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
 gi|198267472|gb|EDY91742.1| phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
          Length = 516

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  MI   N D+ GI+  +G  +G++ +NIA+F LGRS 
Sbjct: 417 VFSDGKPRFIQIKGINIDAEIGAHMIYTTNEDVPGIIGTLGQTMGKHNVNIANFTLGRSA 476

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D ++  + L ++        VK   F+V
Sbjct: 477 ANGEAIALLYVDETVPAAALAEIEATGMFTQVKPLTFDV 515


>gi|254436982|ref|ZP_05050476.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 307]
 gi|198252428|gb|EDY76742.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 307]
          Length = 531

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  MI   N D+ GI+  +G  +G++ +NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMIYTTNEDVPGIIGTLGQTMGKHNVNIANFTLGRSA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  + L++L        VK   F+V
Sbjct: 492 ANGEAIALLYVDEVVPAATLKELEATGMFTQVKPLTFDV 530


>gi|260574246|ref|ZP_05842251.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sp. SW2]
 gi|259023712|gb|EEW27003.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sp. SW2]
          Length = 531

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 61/98 (62%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D +IGR M+   N D+ GI+  +G  +G+  +NIA+F LGRS  
Sbjct: 433 FSDGKPRFIQIKGINIDAEIGRHMLYTTNEDVPGIIGLLGMTMGKNSVNIANFTLGRSGV 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            + AI+ L +D  I   V++ L      + VK  EF+V
Sbjct: 493 GQDAIAILYLDQRIDPKVVDTLESTGLFQQVKALEFDV 530


>gi|153008560|ref|YP_001369775.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560448|gb|ABS13946.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum anthropi ATCC
           49188]
          Length = 533

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGK RFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ INIA+F LGR   
Sbjct: 433 FSDGKARFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHNINIANFSLGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L+    I+     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELTAQEAIKAATPLEFNV 530


>gi|84687790|ref|ZP_01015661.1| D-3-phosphoglycerate dehydrogenase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84664226|gb|EAQ10719.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2654]
          Length = 532

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ I  D +IG  M+   N D+ GI+  +G  LGE G+NIA+F LGR+Q
Sbjct: 434 VFSDGKPRFIQIKGITIDAEIGEHMLYTTNKDVPGIIGTLGRTLGEMGVNIANFTLGRNQ 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  +  +V + LS     + V   +F +
Sbjct: 494 QGGDAIALLYVDAEVPANVRKALSDTGMFQNVSALQFAI 532


>gi|126733884|ref|ZP_01749631.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS2]
 gi|126716750|gb|EBA13614.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS2]
          Length = 530

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 58/99 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D  G++  +G  LG   +NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGEHMVYTTNEDRPGVIGTLGTTLGANNVNIANFTLGRSE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  I    +E L      + VK   FNV
Sbjct: 492 AKGEAIALLYVDEPIPAQAIEALETTGLFQQVKPLTFNV 530


>gi|56698179|ref|YP_168551.1| D-3-phosphoglycerate dehydrogenase [Ruegeria pomeroyi DSS-3]
 gi|56679916|gb|AAV96582.1| D-3-phosphoglycerate dehydrogenase [Ruegeria pomeroyi DSS-3]
          Length = 531

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +G  +GE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGINVDAEIGAHMLYTTNEDVPGIIGTLGQTMGENGVNIANFTLGRAA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+       +K  EF+V
Sbjct: 492 AGGEAIALLYVDEPVPAEARAKLAETGLFNQIKPLEFDV 530


>gi|126724751|ref|ZP_01740594.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705915|gb|EBA05005.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
          Length = 530

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +G  +G  G+NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDVPGIIGTLGQTMGGNGVNIANFTLGRSE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D +I   +L +L      + V    F+V
Sbjct: 492 VGGEAIALLYVDSAIPAPILAELKTTGMFQSVNPLRFDV 530


>gi|110677605|ref|YP_680612.1| D-3-phosphoglycerate dehydrogenase [Roseobacter denitrificans OCh
           114]
 gi|109453721|gb|ABG29926.1| D-3-phosphoglycerate dehydrogenase [Roseobacter denitrificans OCh
           114]
          Length = 531

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ I  D ++G  M+   N D+ GI+  +G  +GE G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGIQIDAEVGAHMLYTTNEDVPGIIGTLGQTMGENGVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   V++KL        VK   F+V
Sbjct: 492 AKGEAIALLYVDDQVPAPVIKKLEKTGMFTQVKPLIFDV 530


>gi|126732689|ref|ZP_01748485.1| D-3-phosphoglycerate dehydrogenase [Sagittula stellata E-37]
 gi|126706819|gb|EBA05889.1| D-3-phosphoglycerate dehydrogenase [Sagittula stellata E-37]
          Length = 532

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 59/99 (59%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  LG  G+NIA+F LGRS 
Sbjct: 433 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGMTLGGMGVNIANFTLGRSA 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+     R +K   F+V
Sbjct: 493 AKGEAIALLYVDEPVPAEARAKLAETGMFRQIKPLSFDV 531


>gi|84502815|ref|ZP_01000928.1| D-3-phosphoglycerate dehydrogenase [Oceanicola batsensis HTCC2597]
 gi|84388798|gb|EAQ01668.1| D-3-phosphoglycerate dehydrogenase [Oceanicola batsensis HTCC2597]
          Length = 531

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +G+ G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGQTMGQNGVNIANFTLGRAS 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D +     L  L      R +K  +F++
Sbjct: 492 AAGEAIALLYLDEAPRKDALSALEQTGLFRQIKPLQFDI 530


>gi|163733251|ref|ZP_02140695.1| D-3-phosphoglycerate dehydrogenase [Roseobacter litoralis Och 149]
 gi|161393786|gb|EDQ18111.1| D-3-phosphoglycerate dehydrogenase [Roseobacter litoralis Och 149]
          Length = 531

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ I  D ++G  M+   N D+ GI+  +G  +GE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGIQIDAEVGAHMLYTTNEDVPGIIGALGQTMGENGVNIANFTLGRAV 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   V++KL        VK   F+V
Sbjct: 492 AQGEAIALLYVDDQVPAPVIKKLEATGMFTQVKPLMFDV 530


>gi|89052752|ref|YP_508203.1| D-3-phosphoglycerate dehydrogenase [Jannaschia sp. CCS1]
 gi|88862301|gb|ABD53178.1| D-3-phosphoglycerate dehydrogenase [Jannaschia sp. CCS1]
          Length = 531

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 57/97 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N DI GI+  +G  +GE G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGEHMLYTTNHDIPGIIGTLGQTMGENGVNIANFTLGRSG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ L +D      VL KL        VK  +F
Sbjct: 492 RDGEAIALLYLDEQPPADVLGKLMETGLFESVKPLQF 528


>gi|218461199|ref|ZP_03501290.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli Kim 5]
          Length = 463

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 49/71 (69%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 393 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGGAGVNIANFQLGRDK 452

Query: 61  STEHAISFLCI 71
               AI+ L +
Sbjct: 453 QGGDAIALLYV 463


>gi|119383566|ref|YP_914622.1| D-3-phosphoglycerate dehydrogenase [Paracoccus denitrificans
           PD1222]
 gi|119373333|gb|ABL68926.1| D-3-phosphoglycerate dehydrogenase [Paracoccus denitrificans
           PD1222]
          Length = 529

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ G++  +G  LG+ G+NIA+F LGR++
Sbjct: 431 VFSDGKPRFIQIRGINVDAEIGEHMLYTRNRDVPGVIGALGMTLGDLGVNIANFTLGRTK 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           + + AI+ L +D  +    LE L        V+  +F V
Sbjct: 491 TGDDAIAILYLDEPLKPEALEALRATGKFLQVRPLQFEV 529


>gi|254509701|ref|ZP_05121768.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium KLH11]
 gi|221533412|gb|EEE36400.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium KLH11]
          Length = 531

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +G  +GE+ +NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDVPGIIGVLGQTMGEHNVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +       L+       +K  EF+V
Sbjct: 492 AGGEAIALLYVDAPVPAEARAVLAETGLFTQIKPLEFDV 530


>gi|114704945|ref|ZP_01437853.1| phosphoglycerate dehydrogenase [Fulvimarina pelagi HTCC2506]
 gi|114539730|gb|EAU42850.1| phosphoglycerate dehydrogenase [Fulvimarina pelagi HTCC2506]
          Length = 532

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 37/83 (44%), Positives = 56/83 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D  GI+  +G + G+ G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGEHMVYTTNNDAPGIIGLLGTVFGKAGVNIANFQLGRNR 491

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               AI+ L +D ++   VL+++
Sbjct: 492 PGGDAIALLYVDSAVPEGVLDQV 514


>gi|163742511|ref|ZP_02149897.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis 2.10]
 gi|161384096|gb|EDQ08479.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis 2.10]
          Length = 531

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 52/72 (72%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G ILG+ G+NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGQILGDMGVNIANFTLGRSE 491

Query: 61  STEHAISFLCID 72
           +   AI+ L +D
Sbjct: 492 AGGEAIALLYVD 503


>gi|163738093|ref|ZP_02145509.1| flagellar L-ring protein precursor H [Phaeobacter gallaeciensis
           BS107]
 gi|161388709|gb|EDQ13062.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis
           BS107]
          Length = 531

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 37/72 (51%), Positives = 52/72 (72%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G ILG+ G+NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGQILGDMGVNIANFTLGRSE 491

Query: 61  STEHAISFLCID 72
           +   AI+ L +D
Sbjct: 492 AGGEAIALLYVD 503


>gi|114769879|ref|ZP_01447489.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium HTCC2255]
 gi|114549584|gb|EAU52466.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium HTCC2255]
          Length = 529

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 59/99 (59%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N DI GI+  +G  +GEY +NIA+F LGR  
Sbjct: 431 VFSDGKPRFIQIKGINIDAEVGSHMLYTTNKDIPGIIGTLGQTMGEYDVNIANFTLGRKN 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D +   + ++ L      + V   +F V
Sbjct: 491 TGGDAIALLYLDCAPNQNAMDSLQKTGIFQTVSALKFEV 529


>gi|218679036|ref|ZP_03526933.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli CIAT 894]
          Length = 231

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 45/61 (73%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 156 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 215

Query: 61  S 61
           +
Sbjct: 216 A 216


>gi|84514603|ref|ZP_01001967.1| D-3-phosphoglycerate dehydrogenase [Loktanella vestfoldensis SKA53]
 gi|84511654|gb|EAQ08107.1| D-3-phosphoglycerate dehydrogenase [Loktanella vestfoldensis SKA53]
          Length = 530

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G+ILG   +NIA+F LGR++
Sbjct: 432 VFNDGKPRFIQIKGINIDAEVGENMVYTTNNDVPGIIGVLGSILGTNSVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +    + +L      + VK   F++
Sbjct: 492 AKGEAIALLYLDEPLPAKAVAELEGTGKFKQVKPLRFDI 530


>gi|90418985|ref|ZP_01226896.1| D-3-phosphoglycerate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337065|gb|EAS50770.1| D-3-phosphoglycerate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 535

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 59/99 (59%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G+ M+   N D  GI+  +G   G  G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINLDAEVGQHMVYTTNNDAPGIIGLLGTTFGAAGVNIANFQLGRNR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  +   +L+ +  +  I   K   F+V
Sbjct: 492 PGGDAIALLYLDSPMPEDLLKTVLSHKEIISAKPLRFDV 530


>gi|259417745|ref|ZP_05741664.1| phosphoglycerate dehydrogenase [Silicibacter sp. TrichCH4B]
 gi|259346651|gb|EEW58465.1| phosphoglycerate dehydrogenase [Silicibacter sp. TrichCH4B]
          Length = 531

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 58/99 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  LG+  +NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNKDVPGIIGTLGQTLGDMDVNIANFTLGRNE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  +      KL+       +K   F+V
Sbjct: 492 VGGEAIALLYVDAEVPADARAKLAETGYFTQIKPLAFDV 530


>gi|99082861|ref|YP_615015.1| D-3-phosphoglycerate dehydrogenase [Ruegeria sp. TM1040]
 gi|99039141|gb|ABF65753.1| D-3-phosphoglycerate dehydrogenase [Ruegeria sp. TM1040]
          Length = 531

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 58/99 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  LG+  +NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNQDVPGIIGTLGQTLGDMDVNIANFTLGRNE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  +      KL+       +K   F+V
Sbjct: 492 VGGEAIALLYVDAEVPADARAKLAETGYFTQIKPLAFDV 530


>gi|294678963|ref|YP_003579578.1| phosphoglycerate dehydrogenase [Rhodobacter capsulatus SB 1003]
 gi|294477783|gb|ADE87171.1| phosphoglycerate dehydrogenase [Rhodobacter capsulatus SB 1003]
          Length = 531

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 62/98 (63%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++GR M+   N D+ GI+  +G +LGE  +N+A+F LGR+ +
Sbjct: 433 FSDGKPRFIQIKGINVDAEVGRHMLYTTNKDVPGIIGKLGTLLGENKVNLANFTLGRAAA 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+   +D ++   V+ +L      + VK  EFN+
Sbjct: 493 GGEAIAIAYLDEALDAKVVSELEATGLFQQVKPLEFNI 530


>gi|328542552|ref|YP_004302661.1| Aspartyl/glutamyl tRNA amidotransferase subunit C [Polymorphum
           gilvum SL003B-26A1]
 gi|326412298|gb|ADZ69361.1| Aspartyl/glutamyl tRNA amidotransferase subunit C [Polymorphum
           gilvum SL003B-26A1]
          Length = 528

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 62/97 (63%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+++ IN + ++G  M+ I N D  G +   G +LG+ G+NIA F+LGR++
Sbjct: 432 VFADGKPRIIQVKGINMEAELGPHMLYITNEDKPGFIGKFGTLLGQAGVNIATFNLGRTE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI+ + +DG +    LE+++    ++ VK  +F
Sbjct: 492 AGGDAIALIEVDGDVPARTLEQINALPLVKQVKLLKF 528


>gi|254477808|ref|ZP_05091194.1| phosphoglycerate dehydrogenase [Ruegeria sp. R11]
 gi|214032051|gb|EEB72886.1| phosphoglycerate dehydrogenase [Ruegeria sp. R11]
          Length = 531

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 58/99 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +G+  +NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGALGKTMGDNDVNIANFTLGRSD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+       +K   F+V
Sbjct: 492 AGGEAIALLYVDEPVPAEARAKLAETGLFTQIKPLAFDV 530


>gi|118588317|ref|ZP_01545726.1| D-3-phosphoglycerate dehydrogenase [Stappia aggregata IAM 12614]
 gi|118439023|gb|EAV45655.1| D-3-phosphoglycerate dehydrogenase [Stappia aggregata IAM 12614]
          Length = 528

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+++ IN + ++G  M+ I N D  G +  +G  LG  G+NIA FHLGR  
Sbjct: 432 VFADGKPRIIQVKGINMEAELGPQMLYITNEDKPGFIGHLGMELGNSGVNIATFHLGRLA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + AI  + +DG +   VL +L     ++ VK  +F
Sbjct: 492 PGDDAICLVEVDGDVSPDVLARLEAVSHVKQVKALKF 528


>gi|307944592|ref|ZP_07659932.1| phosphoglycerate dehydrogenase [Roseibium sp. TrichSKD4]
 gi|307772341|gb|EFO31562.1| phosphoglycerate dehydrogenase [Roseibium sp. TrichSKD4]
          Length = 528

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 58/97 (59%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+PR I+++ IN +  +   M+ I N D  G +  +G  LG  G+NIA F+LGR+ 
Sbjct: 432 VFADGRPRIIQVKGINMEAGLSEHMLYITNEDKPGFIGQLGMELGSNGVNIASFNLGRTA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E AI  + +DG +  S++ +LS    ++ VK  +F
Sbjct: 492 PGEDAICLIEVDGEVPASIMARLSAVPHVKQVKALQF 528


>gi|326389093|ref|ZP_08210675.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206693|gb|EGD57528.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 528

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +G+PR ++I +I  + D+   M+ IVN D  G +  +G +LG+  INI  FHLGR Q
Sbjct: 431 LFGNGQPRLVEIFDIAVEADLDGDMLYIVNTDAPGFIGSIGTLLGQSNINIGTFHLGRRQ 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  + + VL K      +R VK  +F
Sbjct: 491 AGGEAVLLLSVDSPVSDEVLAKAKTLNGVRLVKALKF 527


>gi|254559246|ref|YP_003066341.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens DM4]
 gi|254266524|emb|CAX22288.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens DM4]
          Length = 535

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ IN D     LM+ + N D  G V   G +LGE G+N+A F +GR  
Sbjct: 439 VFNDGKPRVIEIRGINIDAPFAPLMLYVRNHDRPGFVGSFGTVLGEAGVNLATFAMGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIEAIPQVKRVRPVRF 535


>gi|240137235|ref|YP_002961704.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens AM1]
 gi|240007201|gb|ACS38427.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens AM1]
          Length = 535

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ IN D     LM+ + N D  G V   G +LGE G+N+A F +GR  
Sbjct: 439 VFNDGKPRVIEIRGINIDAPFAPLMLYVRNHDRPGFVGSFGTVLGEAGVNLATFAMGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIEAIPQVKRVRPVRF 535


>gi|218528706|ref|YP_002419522.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium
           chloromethanicum CM4]
 gi|218521009|gb|ACK81594.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium
           chloromethanicum CM4]
          Length = 535

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ IN D     LM+ + N D  G V   G +LGE G+N+A F +GR  
Sbjct: 439 VFNDGKPRVIEIRGINIDAPFAPLMLYVRNHDRPGFVGSFGTVLGEAGVNLATFAMGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIEAIPQVKRVRPVRF 535


>gi|163850102|ref|YP_001638145.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium extorquens
           PA1]
 gi|163661707|gb|ABY29074.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium extorquens
           PA1]
          Length = 535

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ IN D     LM+ + N D  G V   G +LGE G+N+A F +GR  
Sbjct: 439 VFNDGKPRVIEIRGINIDAPFAPLMLYVRNHDRPGFVGSFGTVLGEAGVNLATFAMGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIEAIPQVKRVRPVRF 535


>gi|325284843|ref|YP_004264305.1| D-3-phosphoglycerate dehydrogenase [Deinococcus proteolyticus MRP]
 gi|324316558|gb|ADY27670.1| D-3-phosphoglycerate dehydrogenase [Deinococcus proteolyticus MRP]
          Length = 534

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ G++  +G  LG+ G+NIA+F LGRS 
Sbjct: 437 VFSDGKPRFIQIRGINLDAEVGEHMLYTRNRDVPGVIGSLGTALGDLGVNIANFTLGRSA 496

Query: 61  STEHAISFLCID 72
             + AI+ + +D
Sbjct: 497 QGD-AIAIIYLD 507


>gi|209886269|ref|YP_002290126.1| phosphoglycerate dehydrogenase [Oligotropha carboxidovorans OM5]
 gi|209874465|gb|ACI94261.1| phosphoglycerate dehydrogenase [Oligotropha carboxidovorans OM5]
          Length = 529

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DG PR + I+ I  D + G+ MI I N D  G +    ++LG+  +NIA FHLGR+Q
Sbjct: 433 VYADGAPRLVNIKGIRVDAEFGKSMIYITNEDKPGFIGKFASLLGDAKVNIATFHLGRNQ 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   +L K++    ++  K   F
Sbjct: 493 QGGDAIALVEVDGPVPQEILTKVAALPQVKQAKALAF 529


>gi|92116697|ref|YP_576426.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter hamburgensis X14]
 gi|91799591|gb|ABE61966.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter hamburgensis X14]
          Length = 529

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+ G+NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAGVNIATFNLGRHG 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++  +VL K+     ++ VK   F
Sbjct: 493 QGGDAIALVEVDGNVPENVLAKVQALPQVKQVKALTF 529


>gi|148253350|ref|YP_001237935.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. BTAi1]
 gi|146405523|gb|ABQ34029.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. BTAi1]
          Length = 529

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+  INIA FHLGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKINIATFHLGRVA 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI+ + IDG++   +L K+     ++  K   F
Sbjct: 493 AGSDAIALVEIDGAVPAELLAKIQALPQVKQAKALTF 529


>gi|254504693|ref|ZP_05116844.1| D-3-phosphoglycerate dehydrogenase [Labrenzia alexandrii DFL-11]
 gi|222440764|gb|EEE47443.1| D-3-phosphoglycerate dehydrogenase [Labrenzia alexandrii DFL-11]
          Length = 528

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+++ IN + ++G  M+ I N D  G +  +G  LG   +NIA F+LGR+ 
Sbjct: 432 VFADGKPRIIQVKGINMEAELGEHMLYITNEDKPGFIGHLGMELGNNEVNIATFNLGRTA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E AI  + +D  +   V+ +L     ++ VK   F
Sbjct: 492 PGEEAICLVEVDAPVSKEVMARLETVSHVKQVKPLRF 528


>gi|75677149|ref|YP_319570.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
 gi|74422019|gb|ABA06218.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
          Length = 529

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DG PR + I+ I  D + G+ MI + N D  G +    ++LG+ G+NIA F+LGR  
Sbjct: 433 VYADGHPRLVDIKGIRVDAEFGKSMIYVTNEDRPGFIGKFASLLGDAGVNIATFNLGRHS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DGS+  +VL K+     +R  K   F
Sbjct: 493 QGGDAIALVEVDGSVPENVLAKVQALPQVRQAKALTF 529


>gi|46203185|ref|ZP_00208842.1| COG0111: Phosphoglycerate dehydrogenase and related dehydrogenases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 534

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DGKPR I+I+ I+ D      M+ + N D  G +   G++LGE G+N+A F LGR  
Sbjct: 438 VFHDGKPRVIEIRGIDIDAAFAPHMLYVRNHDKPGFIGRFGSVLGEAGVNVATFALGREA 497

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +DG +   VL+ +     ++ V+   F
Sbjct: 498 EGGNAIAFVAVDGPVPAEVLKTIEAIPQVKRVRPVRF 534


>gi|146342773|ref|YP_001207821.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. ORS278]
 gi|146195579|emb|CAL79606.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. ORS278]
          Length = 529

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 54/97 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+  INIA FHLGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKINIATFHLGRVA 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   +L K+     ++  K   F
Sbjct: 493 PGSDAIALVEVDGAVPAELLAKIQALPQVKQAKALAF 529


>gi|39937368|ref|NP_949644.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           CGA009]
 gi|192293149|ref|YP_001993754.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           TIE-1]
 gi|39651226|emb|CAE29749.1| putative phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           CGA009]
 gi|192286898|gb|ACF03279.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           TIE-1]
          Length = 529

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G  MI + N D  G +    ++LG+  +NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGSSMIYVTNEDKPGFIGKFASLLGDAKVNIATFNLGRHT 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + IDG     VLEK+     ++ VK   F
Sbjct: 493 EGGDAIALVTIDGPAPTEVLEKVQALPQVKQVKALTF 529


>gi|85715274|ref|ZP_01046257.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter sp. Nb-311A]
 gi|85697920|gb|EAQ35794.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter sp. Nb-311A]
          Length = 549

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DG PR + I+ I  D + G+ MI + N D  G +    ++LG+ G+NIA F+LGR  
Sbjct: 453 VYADGHPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGRFASLLGDAGLNIATFNLGRHS 512

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DGS+  +VL K+     ++  K   F
Sbjct: 513 QGGDAIALVEVDGSVPENVLAKVQALPQVKQAKALTF 549


>gi|299134302|ref|ZP_07027495.1| D-3-phosphoglycerate dehydrogenase [Afipia sp. 1NLS2]
 gi|298591049|gb|EFI51251.1| D-3-phosphoglycerate dehydrogenase [Afipia sp. 1NLS2]
          Length = 529

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DG PR + I+ I  D + G+ MI I N D  G +    ++LG+  +NIA FHLGR+Q
Sbjct: 433 VYADGAPRLVNIKGIRVDAEFGKSMIYITNEDKPGFIGQFASLLGDAKVNIATFHLGRNQ 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   +L K++    ++  K   F
Sbjct: 493 QGGDAIALVEVDGPVPAEILAKVAKLPHVKQAKALTF 529


>gi|188579907|ref|YP_001923352.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium populi BJ001]
 gi|179343405|gb|ACB78817.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium populi BJ001]
          Length = 535

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ I  D     LM+ + N D  G V   G++LG+ G+N+A F LGR  
Sbjct: 439 VFNDGKPRVIEIRGIGIDAPFAPLMLYVRNHDKPGFVGSFGSVLGDAGVNLATFALGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIETIPQVKRVRLVRF 535


>gi|254473015|ref|ZP_05086413.1| phosphoglycerate dehydrogenase [Pseudovibrio sp. JE062]
 gi|211957736|gb|EEA92938.1| phosphoglycerate dehydrogenase [Pseudovibrio sp. JE062]
          Length = 532

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D KPR I+I+ IN + ++G  M+ + N D  G +  +G+ILG+  INIA F+LGR  
Sbjct: 432 VFGDQKPRIIQIKGINMEAELGENMLYVTNQDKPGFIGQLGSILGDAKINIATFNLGRKV 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E AI  + IDG I  + + +++    +   K   F
Sbjct: 492 EGEEAICLVEIDGEIAEATVNEIAAIEQVNQAKLLHF 528


>gi|117924723|ref|YP_865340.1| D-3-phosphoglycerate dehydrogenase [Magnetococcus sp. MC-1]
 gi|117608479|gb|ABK43934.1| D-3-phosphoglycerate dehydrogenase [Magnetococcus sp. MC-1]
          Length = 527

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 56/97 (57%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+  +PR I + EI  +     L++ + N D  G++  VG +LGE G+NI+ FHLGR Q
Sbjct: 431 LFNGTEPRLISMDEIPIEAQPEGLLLFVANDDTPGLIGRVGTLLGEAGVNISSFHLGREQ 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI+F+ +D  +   ++++L     +R VK   +
Sbjct: 491 AGGRAIAFINVDSEVPAPLMQQLHETANVREVKLIRY 527


>gi|158422609|ref|YP_001523901.1| D-3-phosphoglycerate dehydrogenase [Azorhizobium caulinodans ORS
           571]
 gi|158329498|dbj|BAF86983.1| D-3-phosphoglycerate dehydrogenase [Azorhizobium caulinodans ORS
           571]
          Length = 528

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+PR + I+ I  D      M+ + N D  G +    ++LG+ G+NIA F LGR  
Sbjct: 432 VFADGQPRIVDIKGIKVDAGFAPNMLYVTNEDKPGFIGRFASLLGDAGVNIATFALGRDH 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   VL K+S    +R VKQ  F
Sbjct: 492 PGGDAIALVEVDGPVPADVLGKVSALPHVRQVKQLRF 528


>gi|154245150|ref|YP_001416108.1| D-3-phosphoglycerate dehydrogenase [Xanthobacter autotrophicus Py2]
 gi|154159235|gb|ABS66451.1| D-3-phosphoglycerate dehydrogenase [Xanthobacter autotrophicus Py2]
          Length = 528

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+PR + I+ IN D +    MI + N D  G +     +LG+ G+NIA F LGR  
Sbjct: 432 VFADGRPRIVNIKGINVDAEFAPSMIYVTNEDKPGFIGRFAGLLGDAGLNIATFALGRDH 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   VL K+     ++  K   F
Sbjct: 492 LGGDAIALVAVDGTVPADVLGKVQALPQVKAAKALAF 528


>gi|316935825|ref|YP_004110807.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           DX-1]
 gi|315603539|gb|ADU46074.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           DX-1]
          Length = 529

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G  MI + N D  G +    ++LG+  +NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGASMIYVTNEDKPGFIGKFASLLGDAKVNIATFNLGRHS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + IDG     VLEK+     ++ VK   F
Sbjct: 493 QGGDAIALVEIDGPAPAEVLEKVQALPPVKQVKALTF 529


>gi|154252585|ref|YP_001413409.1| D-3-phosphoglycerate dehydrogenase [Parvibaculum lavamentivorans
           DS-1]
 gi|154156535|gb|ABS63752.1| D-3-phosphoglycerate dehydrogenase [Parvibaculum lavamentivorans
           DS-1]
          Length = 525

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 56/97 (57%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFS G PR I+I+ +N +  +GR M+ + N D  G +  +G+ LG+ GINIA+F+LGR +
Sbjct: 429 VFSGGLPRLIQIKSVNMEAALGRHMLYVTNLDKPGFIGALGSTLGKAGINIANFNLGREK 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI  + +D  +  + L ++     +  VK   F
Sbjct: 489 AGGDAICLIEVDADVPAATLAEIQALPHVVQVKALSF 525


>gi|116620780|ref|YP_822936.1| D-3-phosphoglycerate dehydrogenase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223942|gb|ABJ82651.1| D-3-phosphoglycerate dehydrogenase [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 525

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 55/93 (59%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           KPR +++  I  +  +   +I + N D+ G++  VG +LG+  INIA+F LGR + T  A
Sbjct: 431 KPRLLQVDGIYCEAALCGFLIVMKNQDVPGVIGHVGTVLGKNCINIANFSLGRREGTPEA 490

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
           ++ +  DG +  SVL +L  +  ++F +  EF+
Sbjct: 491 VALVSTDGLVPESVLLQLKEHAAVKFARSVEFH 523


>gi|87200693|ref|YP_497950.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87136374|gb|ABD27116.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 540

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +G+PR ++I  I  + D+   M+ IVN+D  G +  +G +LG+  INI  FHLGR +
Sbjct: 443 LFGNGQPRLVEIFGIGIEADLDGDMLYIVNSDAPGFIGRIGTLLGQNTINIGTFHLGRRE 502

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +   VL++      +R VK  +F
Sbjct: 503 AGGEAVLLLSLDNPVSEDVLKEAREIQGVRVVKALKF 539


>gi|27382512|ref|NP_774041.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium japonicum USDA
           110]
 gi|27355684|dbj|BAC52666.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium japonicum USDA
           110]
          Length = 529

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V+ DGKPR + ++ I  D + G+ MI + N D  G +    ++LG   +NIA FHLGR +
Sbjct: 433 VYHDGKPRLVDVKGIRVDAEFGKSMIYVTNEDKPGFIGAFASLLGAAKLNIATFHLGRVK 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   VL K+     ++  K   F
Sbjct: 493 LGGDAIALVEVDGAVPADVLAKVQALPQVKQAKALTF 529


>gi|312115664|ref|YP_004013260.1| D-3-phosphoglycerate dehydrogenase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220793|gb|ADP72161.1| D-3-phosphoglycerate dehydrogenase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 526

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 31/82 (37%), Positives = 50/82 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPR I+I  +  D +    M+  VNAD  G +  +G +LG+ G+NIA F+LGR  
Sbjct: 430 VFSDGKPRVIQINHVPMDAEFAPNMLFTVNADKPGHIGALGTLLGDEGVNIATFNLGREA 489

Query: 61  STEHAISFLCIDGSILNSVLEK 82
               A++ + +D  + ++ ++K
Sbjct: 490 QGGKAMALVTVDEPVSDATIQK 511


>gi|209965081|ref|YP_002297996.1| D-3-phosphoglycerate dehydrogenase [Rhodospirillum centenum SW]
 gi|209958547|gb|ACI99183.1| D-3-phosphoglycerate dehydrogenase [Rhodospirillum centenum SW]
          Length = 525

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 57/97 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   KPR ++I+++  + ++   M+ I N D  G +  +G  LG+ G+NIA FHLGR+ 
Sbjct: 429 LFGGDKPRLVEIEDVPIEAEVTPNMLFIRNEDKPGFIGKLGTALGDAGVNIATFHLGRTA 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + E AI+ +C+D  + + ++E++    ++   K   F
Sbjct: 489 AGETAIALVCVDQPLGDDLVERIRALPSVVRAKALTF 525


>gi|217977921|ref|YP_002362068.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
 gi|217503297|gb|ACK50706.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
          Length = 531

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF  GKPR I +  I  D  +  +MI + N D  G V    +ILG  G+NIA F LGR +
Sbjct: 432 VFHAGKPRIISVNGIEVDAVVAPVMIYVSNDDKPGFVGRFTSILGAAGLNIATFALGRDR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++ + +DG++ + VL  +     +R VK   F
Sbjct: 492 EGGSAVALIAVDGAVPDEVLADIRAAPGVREVKALHF 528


>gi|114800302|ref|YP_761802.1| D-3-phosphoglycerate dehydrogenase [Hyphomonas neptunium ATCC
           15444]
 gi|114740476|gb|ABI78601.1| D-3-phosphoglycerate dehydrogenase [Hyphomonas neptunium ATCC
           15444]
          Length = 531

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 32/93 (34%), Positives = 54/93 (58%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GKPR ++++ +  + D   + + + N D  G +  +G +LGE  +NIA FHLGR ++   
Sbjct: 439 GKPRIVEVKGMALEGDFSPVTLYVNNIDKPGFIGALGQMLGEAKVNIATFHLGRQEAGGE 498

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI+ + ID +   S++EKL     +R+VK   F
Sbjct: 499 AIALIGIDSTPPASLVEKLDALPQVRYVKVLSF 531


>gi|298292958|ref|YP_003694897.1| D-3-phosphoglycerate dehydrogenase [Starkeya novella DSM 506]
 gi|296929469|gb|ADH90278.1| D-3-phosphoglycerate dehydrogenase [Starkeya novella DSM 506]
          Length = 528

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+PR ++I+ I  D +    M+ + N D  G V    ++LG+ GINIA F LGR +
Sbjct: 432 VFADGRPRIVEIKGIKVDAEFAPSMLYVTNEDRPGFVGRFASLLGDAGINIATFALGRDR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   +L+K+    +++  K   F
Sbjct: 492 QGGDAIALVEVDGKVPAELLDKVQQIPSVKQAKPLVF 528


>gi|90425581|ref|YP_533951.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
 gi|90107595|gb|ABD89632.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
          Length = 529

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 54/97 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG PR + I+ I  D + G+ MI + N D  G +    ++LG+  INIA F+LGR +
Sbjct: 433 VFADGHPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKINIATFNLGRHE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   V+ K+     ++  K   F
Sbjct: 493 LGGDAIALVEVDGAVPAEVIAKVQALPQVKQAKALVF 529


>gi|182678253|ref|YP_001832399.1| D-3-phosphoglycerate dehydrogenase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634136|gb|ACB94910.1| D-3-phosphoglycerate dehydrogenase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 529

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DGKPR I I +I  D  +  +MI + N D  G +    ++LG   +NIA F LGR +
Sbjct: 433 VFHDGKPRIIAINDIKIDAAVAPVMIYVSNEDKPGFIGRFASLLGNASVNIATFALGRDR 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++  SV  ++     ++ VK   F
Sbjct: 493 EGGSAIALVEVDGAVPESVQNEVKALPGVKKVKALAF 529


>gi|115526154|ref|YP_783065.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
 gi|115520101|gb|ABJ08085.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
          Length = 530

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG PR + I+ I  D + G+ MI + N D  G +    ++LG+  INIA F+LGR  
Sbjct: 434 VFADGHPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKINIATFNLGRHS 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   +L K+     ++  K   F
Sbjct: 494 QGGDAIALVEVDGAVPTELLAKVQSLPQVKQAKALVF 530


>gi|86748440|ref|YP_484936.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
 gi|86571468|gb|ABD06025.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
          Length = 529

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+  +NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGQSMIYVTNEDKPGFIGKFASLLGDAKVNIATFNLGRHS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + IDG     V+ K+     ++  K   F
Sbjct: 493 QGGDAIALVEIDGPAPADVIAKVQALPQVKQAKALAF 529


>gi|83312292|ref|YP_422556.1| D-3-phosphoglycerate dehydrogenase [Magnetospirillum magneticum
           AMB-1]
 gi|82947133|dbj|BAE51997.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Magnetospirillum magneticum AMB-1]
          Length = 526

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 52/83 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   K R ++I+ I+ + ++G+ M+ + N D  G +  +G++LG  G+NIA FHLGRS+
Sbjct: 429 LFGGNKARVVEIKGISIEAELGQNMLYVTNQDKPGFIGALGSLLGANGVNIATFHLGRSE 488

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   AI    +D  + N +LEK+
Sbjct: 489 AGGDAILLTQVDQPVSNDLLEKV 511


>gi|307294836|ref|ZP_07574678.1| D-3-phosphoglycerate dehydrogenase [Sphingobium chlorophenolicum
           L-1]
 gi|306879310|gb|EFN10528.1| D-3-phosphoglycerate dehydrogenase [Sphingobium chlorophenolicum
           L-1]
          Length = 526

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + +PR +++  I  + D+   M+ IVN D  G +  +G+ LGE  +NI  FHLGR  
Sbjct: 429 LFGNAQPRLVELFGIKVEADLAGDMLYIVNQDAPGFIGRLGSTLGEANVNIGTFHLGRRN 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +DG++  +VL  +     ++ VK   F
Sbjct: 489 QGGEAVLLLSLDGAVSEAVLSDICKLAGVKTVKLLRF 525


>gi|170744437|ref|YP_001773092.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium sp. 4-46]
 gi|168198711|gb|ACA20658.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium sp. 4-46]
          Length = 531

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DG PR ++I+ I  +      M+ + NAD  G +   G +LGE G+N+A FHLGR +
Sbjct: 435 VFQDGVPRIVEIRSIPLEAAFAPHMLYVRNADQPGFIGRFGTLLGEAGVNVATFHLGRDR 494

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI F  +D  +  ++L ++     ++  +   F
Sbjct: 495 PGGDAICFAAVDQPVSPALLRQIEAIPQVKRARAVRF 531


>gi|148261633|ref|YP_001235760.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|326405123|ref|YP_004285205.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium multivorum AIU301]
 gi|146403314|gb|ABQ31841.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|325051985|dbj|BAJ82323.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium multivorum AIU301]
          Length = 528

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   KPR ++++ I  + D GR M+ + N D  G +     IL E GINIA FHLGR++
Sbjct: 432 LFGGAKPRLVEVKGIKVEADFGRHMLYVTNRDKPGFIAQCSAILAEKGINIATFHLGRTE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  + ID ++ +  L  +     +    Q  F
Sbjct: 492 KGGDAVCLISIDETLPDDALAAIRALPQVMQATQISF 528


>gi|220926557|ref|YP_002501859.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium nodulans ORS
           2060]
 gi|219951164|gb|ACL61556.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium nodulans ORS
           2060]
          Length = 531

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DG PR ++I+ I  +      M+ + NAD  G +   G +LGE G+N+A FHLGR +
Sbjct: 435 VFHDGVPRTVEIRSIPLEAAFAPHMLYVRNADQPGFIGRFGTLLGEAGVNVATFHLGRDR 494

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI F+ +D  +  ++L ++     ++  +   F
Sbjct: 495 PGGDAICFVAVDQPVSPALLRQIEAIPQVKRARAVRF 531


>gi|91978368|ref|YP_571027.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
 gi|91684824|gb|ABE41126.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
          Length = 529

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+  +NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKVNIATFNLGRHS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   V+ ++     ++  K   F
Sbjct: 493 QGGDAIALVEVDGPVPAEVIAQVQALPPVKQAKALVF 529


>gi|46201295|ref|ZP_00208046.1| COG0111: Phosphoglycerate dehydrogenase and related dehydrogenases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 526

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 50/83 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   K R ++I+ I+ + ++G  M+ + N D  G +  +G +LG  G+NIA FHLGRS+
Sbjct: 429 LFGGDKARVVEIKGISIEAELGSHMLYVTNQDKPGFIGALGTLLGANGVNIATFHLGRSE 488

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   AI    +D  + N +LEK+
Sbjct: 489 AGGDAILLTQVDQPVSNELLEKV 511


>gi|148557578|ref|YP_001265160.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas wittichii RW1]
 gi|148502768|gb|ABQ71022.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas wittichii RW1]
          Length = 525

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 54/97 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F++ +PR ++I  +  + D+G  M+ IVN D  G +  +G+ LGE  +NI  FHLGR  
Sbjct: 429 LFANAEPRLVEIYGVKVEADLGGTMLYIVNVDAPGFIGRLGSTLGEANVNIGTFHLGRRS 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  + +++  K++    ++  K   F
Sbjct: 489 AGGEAVLLLSVDTPVDDALKAKIAQLPGVKTAKALSF 525


>gi|294010170|ref|YP_003543630.1| D-3-phosphoglycerate dehydrogenase [Sphingobium japonicum UT26S]
 gi|292673500|dbj|BAI95018.1| D-3-phosphoglycerate dehydrogenase [Sphingobium japonicum UT26S]
          Length = 526

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + +PR +++  I  + D+   M+ IVN D  G +  +G+ LGE  +NI  FHLGR  
Sbjct: 429 LFGNAQPRLVELFGIKVEADLAGDMLYIVNQDAPGFIGRLGSTLGEAQVNIGTFHLGRRN 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +DG++  +VL  +     ++ VK   F
Sbjct: 489 QGGEAVLLLSLDGAVNEAVLSDICKLAGVKTVKLLRF 525


>gi|217977556|ref|YP_002361703.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
 gi|217502932|gb|ACK50341.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
          Length = 528

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I I  I  D  +G  M+ + N D  G +    +ILG  GINIA F LGR +
Sbjct: 432 VFNDGKPRIIMINGIKVDAAVGPSMVYVTNEDRPGFIGRFASILGNAGINIATFALGRDR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               +I+ + +D ++   VL+ +     ++  K   F
Sbjct: 492 EGGSSIALVEVDENVPEKVLDAVRRLPGVKEAKALRF 528


>gi|144897885|emb|CAM74749.1| D-3-phosphoglycerate dehydrogenase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 525

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 51/83 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   KPR + I+ I  + ++G  M+ + N D  G +  +G++LG  G+NIA FHLGRS+
Sbjct: 429 LFGGDKPRVVAIKGIPIEAELGSHMLYVTNQDKPGFIGALGSLLGARGVNIATFHLGRSE 488

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   AI    +D  + +++L+++
Sbjct: 489 AGGDAILLTQVDQPLTDAILDEV 511


>gi|163796990|ref|ZP_02190946.1| Phosphoglycerate dehydrogenase and related dehydrogenase [alpha
           proteobacterium BAL199]
 gi|159177737|gb|EDP62288.1| Phosphoglycerate dehydrogenase and related dehydrogenase [alpha
           proteobacterium BAL199]
          Length = 525

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 48/78 (61%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           KPR +++Q I  + D GR M+ + N D  G +  +G+ LG +G+NIA FHLGR      A
Sbjct: 434 KPRLVEVQGIAIEADFGRHMLYVRNYDKPGFIGALGSALGNHGVNIATFHLGRRDVGGEA 493

Query: 66  ISFLCIDGSILNSVLEKL 83
           I+ + +D +I  ++L ++
Sbjct: 494 IALVEVDQAIDAALLTEV 511


>gi|94496033|ref|ZP_01302612.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas sp. SKA58]
 gi|94424725|gb|EAT09747.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas sp. SKA58]
          Length = 517

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 43/75 (57%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   +PR +++  I  + D+G  M+ IVN D  G +  +G+ LGE  +NI  FHLGR  
Sbjct: 420 LFGHAQPRLVELFGIKVEADLGGTMLYIVNQDAPGFIGRLGSTLGEANVNIGTFHLGRRD 479

Query: 61  STEHAISFLCIDGSI 75
               A+  L +DG++
Sbjct: 480 QGGEAVLLLSVDGTV 494


>gi|288819163|ref|YP_003433511.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
 gi|288788563|dbj|BAI70310.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
 gi|308752746|gb|ADO46229.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
          Length = 530

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (55%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR  +I     DV+   +M+   N D+ G++  VG+ILG+ G+NIA F LGR +    A+
Sbjct: 440 PRIFRIDNYRVDVEPEGIMLIFENKDVPGVIGKVGSILGDAGVNIAGFRLGREKRGGIAL 499

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
             L +D  +   +L +LS    + FVKQ
Sbjct: 500 GILNLDDPVPEEILHELSKLPEVLFVKQ 527


>gi|332188569|ref|ZP_08390288.1| phosphoglycerate dehydrogenase [Sphingomonas sp. S17]
 gi|332011413|gb|EGI53499.1| phosphoglycerate dehydrogenase [Sphingomonas sp. S17]
          Length = 516

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 46/83 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F D  PR +++  I  + D+   M+ +VN D  G +  +G  LGE G+NI  FHLGR  
Sbjct: 420 LFGDQAPRLVELFGIKVEADLAGPMLYVVNEDAPGFIGRLGTTLGEAGVNIGTFHLGRRS 479

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D ++   +L K+
Sbjct: 480 AGGEAVLLLSVDEAVDAELLAKV 502


>gi|77920705|ref|YP_358520.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
 gi|77546788|gb|ABA90350.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
          Length = 535

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 50/90 (55%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G P+ +K+++ N D      M+ I  AD  G++  +G ILGE GINI   +LGR   + 
Sbjct: 435 EGIPKIVKMRDFNTDFQPEEHMLVISYADKPGLIGKIGTILGEAGINIGSMNLGRRAKSG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
            A+  L +D      VLE+L+ ++   F++
Sbjct: 495 EAMVVLSLDTPAPAEVLEQLATSIDAAFIR 524


>gi|149186566|ref|ZP_01864878.1| phosphoglycerate dehydrogenase [Erythrobacter sp. SD-21]
 gi|148829793|gb|EDL48232.1| phosphoglycerate dehydrogenase [Erythrobacter sp. SD-21]
          Length = 537

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 47/82 (57%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I  +  + ++   M+ IVN D  G +  +G++LGE GINI  F+LGR  
Sbjct: 441 LFGADAPRLVEIFGVRIEAELDGHMLYIVNEDAPGFIGRIGSLLGENGINIGTFNLGRRA 500

Query: 61  STEHAISFLCIDGSILNSVLEK 82
           +   A+  L +D  I N V++K
Sbjct: 501 AGGEAVLLLSVDQPIPNEVVKK 522


>gi|323135941|ref|ZP_08071024.1| D-3-phosphoglycerate dehydrogenase [Methylocystis sp. ATCC 49242]
 gi|322399032|gb|EFY01551.1| D-3-phosphoglycerate dehydrogenase [Methylocystis sp. ATCC 49242]
          Length = 528

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 41/80 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DGKPR  +I +I  D +    MI   N D  G +     +LGE  +NIA F LGR  
Sbjct: 432 VFHDGKPRIARIGDIGIDAEFAPSMIYTENEDRPGFIGRFAGLLGEAKVNIATFALGRDM 491

Query: 61  STEHAISFLCIDGSILNSVL 80
               A++ + IDG +   VL
Sbjct: 492 PGGCAVALVAIDGELPEDVL 511


>gi|103486109|ref|YP_615670.1| D-3-phosphoglycerate dehydrogenase [Sphingopyxis alaskensis RB2256]
 gi|98976186|gb|ABF52337.1| D-3-phosphoglycerate dehydrogenase [Sphingopyxis alaskensis RB2256]
          Length = 528

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + +PR +++  I  + D+   M+ IVN D  G +  +G+ LG+ G+NI  FHLGR  
Sbjct: 432 LFGNNEPRLVEMFGIKVEADLDGDMLYIVNEDAPGFIGRIGSTLGDAGLNIGTFHLGRRA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +   +L ++     ++ VK  +F
Sbjct: 492 AGGEAVLLLSLDSPMPEPLLWQVCQLPGVKMVKGLKF 528


>gi|327399776|ref|YP_004340645.1| D-3-phosphoglycerate dehydrogenase [Hippea maritima DSM 10411]
 gi|327182405|gb|AEA34586.1| D-3-phosphoglycerate dehydrogenase [Hippea maritima DSM 10411]
          Length = 529

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 54/94 (57%), Gaps = 1/94 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   K R + +   + ++++   +I   N D  GI+  VG ILG++ INIA F LGR Q
Sbjct: 433 VFEPNKARIVYMDGFDMEIELTGNIIVFRNYDKPGIIGKVGEILGKHNINIADFRLGRKQ 492

Query: 61  STEHAISFLCIDGSILNSVL-EKLSVNVTIRFVK 93
           +   A+SF+ +D  + +++L E LS++  I   K
Sbjct: 493 ALGEALSFIKVDQEVNDAILKEILSIDGAISIAK 526


>gi|254294765|ref|YP_003060788.1| D-3-phosphoglycerate dehydrogenase [Hirschia baltica ATCC 49814]
 gi|254043296|gb|ACT60091.1| D-3-phosphoglycerate dehydrogenase [Hirschia baltica ATCC 49814]
          Length = 525

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 50/94 (53%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G+ R + ++++  +      ++ I N D  G +  +G+ILGE G+NIA F+LGR +   
Sbjct: 432 NGQSRIVAVKDMALEAKFRPFILFINNNDEAGFIGSLGSILGEAGVNIATFNLGREEQGG 491

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            AI+ + ID  +    + K+     +R+ K   F
Sbjct: 492 DAIAMVGIDQDVPAEAMAKIEALTQVRYAKVLRF 525


>gi|237752566|ref|ZP_04583046.1| d-3-phosphoglycerate dehydrogenase [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376055|gb|EEO26146.1| d-3-phosphoglycerate dehydrogenase [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 527

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 2/84 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++  P+ + I     D++    MI   N D  G++ FVG  L ++ INIA F LGR  
Sbjct: 433 VFNENTPKIVNINNFALDIEPKGKMILFRNDDTPGVIGFVGTTLAKHNINIADFRLGR-- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
             + A++ + +D +I  SVL++L+
Sbjct: 491 YGKEALALIIVDDAISQSVLDELA 514


>gi|152992147|ref|YP_001357868.1| D-3-phosphoglycerate dehydrogenase [Sulfurovum sp. NBC37-1]
 gi|151424008|dbj|BAF71511.1| D-3-phosphoglycerate dehydrogenase [Sulfurovum sp. NBC37-1]
          Length = 529

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D   R I+I +   DV+    MI   N D  G++  VG IL E G+NI+ F LGR +
Sbjct: 434 VFDDTVQRIIEIDDYILDVEPKGTMIFFRNTDTPGVIGDVGRILAENGLNISDFRLGRDK 493

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
             + A++ + +DG +   VL+ LS
Sbjct: 494 K-QQALAVVRVDGQVSKEVLDALS 516


>gi|296284464|ref|ZP_06862462.1| D-3-phosphoglycerate dehydrogenase [Citromicrobium bathyomarinum
           JL354]
          Length = 528

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I  I  + ++   MI +VN D  G +  +G++LG  GINI  F+LGR Q
Sbjct: 432 LFGREAPRLVEIFGIGIEAELDGHMIYVVNDDAPGFIGRIGSLLGNRGINIGTFNLGRKQ 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  + ++++ +      +R V    F
Sbjct: 492 AGGEAVLLLSLDQPVDDALIAEAEALEGVRTVTALSF 528


>gi|73662348|ref|YP_301129.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72494863|dbj|BAE18184.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 538

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 47/94 (50%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I +   D    R  + I + D  GIV   G ILGEYGINIA  HLGR     +A+
Sbjct: 438 PRIVRINDYPVDFKPERHQLVINHNDRPGIVGRTGQILGEYGINIASMHLGRINQGGNAL 497

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
             L ID  + + V++ L        ++  E  ++
Sbjct: 498 MILSIDHPVTDDVIDGLYEIEGFNLIRSVELEIE 531


>gi|94967146|ref|YP_589194.1| D-3-phosphoglycerate dehydrogenase [Candidatus Koribacter
           versatilis Ellin345]
 gi|94549196|gb|ABF39120.1| D-3-phosphoglycerate dehydrogenase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 531

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR-- 58
           V     PR +    I+ +  +   ++ I N DI G+V  VG ILGE+ +NIA+F LGR  
Sbjct: 433 VLHGNSPRLLSFDNIDVEAPLEGTLLVIRNRDIPGVVGRVGTILGEHEVNIANFALGRPS 492

Query: 59  SQSTEHAISFLCIDGSILNSVLEKL 83
             S  +AI+ + +DG +   VL++L
Sbjct: 493 GNSGGNAIAAVQVDGPLKEPVLQQL 517


>gi|198283146|ref|YP_002219467.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667460|ref|YP_002425374.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|198247667|gb|ACH83260.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218519673|gb|ACK80259.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 527

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 48/79 (60%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           + R +++  I+ ++ +   ++ I N D  G++  +G +LG  GINIA FHLGR +    A
Sbjct: 436 QARLVQLDGIDVEMPLAGDLLYIQNRDEPGLIGRIGGLLGAAGINIAQFHLGREKPAGAA 495

Query: 66  ISFLCIDGSILNSVLEKLS 84
           +SF+ +D  +   +LE+++
Sbjct: 496 LSFIAVDQPLTEVLLEQVA 514


>gi|167648422|ref|YP_001686085.1| D-3-phosphoglycerate dehydrogenase [Caulobacter sp. K31]
 gi|167350852|gb|ABZ73587.1| D-3-phosphoglycerate dehydrogenase [Caulobacter sp. K31]
          Length = 526

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 50/93 (53%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G PR ++++ +  D      M+ I N D  G +  +G +LGE G+NIA F+LGR  + E 
Sbjct: 434 GAPRMVEVKGMELDAGFAPAMLYINNLDKPGFIGALGMLLGEAGVNIATFNLGRLSADED 493

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI+ + +D +   ++L K+     ++  +   F
Sbjct: 494 AIALVGVDQAPDEALLAKIQALPHVKEARALTF 526


>gi|224437370|ref|ZP_03658342.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
 gi|313143835|ref|ZP_07806028.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
 gi|313128866|gb|EFR46483.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
          Length = 526

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D   R   I +  FD++    MI   N D+ G+V  VG+ILG Y +NIA F L R  
Sbjct: 432 VFEDRHLRITSINQFQFDIEPKGKMIFFKNTDVPGVVGLVGSILGNYKVNIADFRLARQN 491

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
             + A++ + +D  + N  + +L
Sbjct: 492 --KEAMAVILVDSDVPNEAINEL 512


>gi|85373221|ref|YP_457283.1| D-3-phosphoglycerate dehydrogenase [Erythrobacter litoralis
           HTCC2594]
 gi|84786304|gb|ABC62486.1| phosphoglycerate dehydrogenase [Erythrobacter litoralis HTCC2594]
          Length = 527

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 44/81 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I  +  +  +   M+ IVN D  G +  +G +LGE+GINI  F+LGR  
Sbjct: 431 LFGSDAPRLVEIFGVRIEAQLEGHMLYIVNEDAPGFIGRIGTLLGEHGINIGTFNLGRRS 490

Query: 61  STEHAISFLCIDGSILNSVLE 81
           +   A+  L +D  I   V++
Sbjct: 491 AGGEAVLLLSVDQPIPQDVVK 511


>gi|294085874|ref|YP_003552634.1| phosphoglycerate dehydrogenase and related dehydrogenase
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665449|gb|ADE40550.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 527

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 49/92 (53%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           K R +++Q I  + D    ++ + N D  G +  +G + G+YG+NIA FHLGR      A
Sbjct: 434 KARIVEVQHIAVESDFPAHLLYLRNYDKPGFIGDLGTLCGKYGVNIATFHLGRRDVGGEA 493

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           ++ + IDG + +S+L  L     +  V   +F
Sbjct: 494 VALVEIDGELPDSMLGDLRALKQVVRVDALQF 525


>gi|226225601|ref|YP_002759707.1| D-3-phosphoglycerate dehydrogenase [Gemmatimonas aurantiaca T-27]
 gi|226088792|dbj|BAH37237.1| D-3-phosphoglycerate dehydrogenase [Gemmatimonas aurantiaca T-27]
          Length = 534

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 42/71 (59%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G PR  +I   + DV+  + ++ + N D+ G++  VG +LGE G+NIA +H  R      
Sbjct: 439 GTPRLTRIGSFHVDVNPRQTLLVLTNHDVPGVIGRVGTLLGERGVNIAEYHQARLAQGGD 498

Query: 65  AISFLCIDGSI 75
           A++ + +DG++
Sbjct: 499 ALAAVSVDGTV 509


>gi|56552581|ref|YP_163420.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56544155|gb|AAV90309.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 527

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R ++I  I  + ++   M+ IVN D  G +  +G +LG+ G+NI  FHLGR  
Sbjct: 430 LFGSEGTRLVEIFGIKIEANLSGDMLYIVNDDAPGFIGRLGTLLGKAGVNIGTFHLGRRN 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +    + K++    +R VK   F
Sbjct: 490 TGGEAVLLLSVDSPVTAGKMAKVAELSGVREVKSLHF 526


>gi|289523971|ref|ZP_06440825.1| phosphoglycerate dehydrogenase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289502627|gb|EFD23791.1| phosphoglycerate dehydrogenase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 544

 Score = 53.9 bits (128), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 46/83 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +GK R + + +   D      ++   N D  G++  +G +LG+YG+NIA+F LGR  
Sbjct: 445 VTEEGKKRIVGVDDYEIDFVPEGWVLLFSNHDRPGVIGKIGTLLGDYGVNIANFALGRKN 504

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
            +  AI+ L +D SI    +EK+
Sbjct: 505 GSGLAIAALQLDSSIPKEAMEKI 527


>gi|260753763|ref|YP_003226656.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258553126|gb|ACV76072.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 527

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R ++I  I  + ++   M+ IVN D  G +  +G +LG+ G+NI  FHLGR  
Sbjct: 430 LFGSEGTRLVEIFGIKVEANLSGDMLYIVNDDAPGFIGRLGTLLGKAGVNIGTFHLGRRN 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +    + K++    +R VK   F
Sbjct: 490 TGGEAVLLLSVDSPVTAGKMAKVAELSGVREVKSLHF 526


>gi|242309369|ref|ZP_04808524.1| d-3-phosphoglycerate dehydrogenase [Helicobacter pullorum MIT
           98-5489]
 gi|239523940|gb|EEQ63806.1| d-3-phosphoglycerate dehydrogenase [Helicobacter pullorum MIT
           98-5489]
          Length = 117

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 47/84 (55%), Gaps = 2/84 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++  P+ ++I     D++    MI   N D  G++  VG  L +Y INIA F LGR  
Sbjct: 23  VFNEDTPKIVEINHFEMDIEPKGRMILFRNNDTPGVIGHVGTTLAKYNINIADFRLGR-- 80

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
             + A++ + +D  + N V+++LS
Sbjct: 81  YGKEALAVILVDDEVSNEVIKELS 104


>gi|241762175|ref|ZP_04760258.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373425|gb|EER63025.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 527

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R ++I  I  + ++   M+ IVN D  G +  +G +LG+ G+NI  FHLGR  
Sbjct: 430 LFGSEGTRLVEIFGIKVEANLSGDMLYIVNDDAPGFIGRLGTLLGKAGVNIGTFHLGRRN 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +    + K++    +R VK   F
Sbjct: 490 TGGEAVLLLSVDSPVTAGKMAKVAELSGVREVKSLHF 526


>gi|206890990|ref|YP_002248773.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742928|gb|ACI21985.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 529

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 48/83 (57%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S   PR ++I +I+ ++     MI + N D  G++  +G +LG+  INI H H GR +
Sbjct: 430 LLSRKDPRIVQINDISMEIIPEGNMIFLRNHDRPGVIGNIGTLLGQNNINIGHMHFGRKE 489

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A S + +D ++ + ++EK+
Sbjct: 490 AGGIAFSVISVDATLTDDIIEKI 512


>gi|313679957|ref|YP_004057696.1| d-3-phosphoglycerate dehydrogenase [Oceanithermus profundus DSM
           14977]
 gi|313152672|gb|ADR36523.1| D-3-phosphoglycerate dehydrogenase [Oceanithermus profundus DSM
           14977]
          Length = 520

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 5   GKPRFIKIQEINFDVD-IGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G+PR ++I +   +++  G +++CI N D  G+V  VG +LGE G+NIA   LGR Q   
Sbjct: 428 GRPRLVRIDDYALEIEPTGAVLVCI-NRDQPGVVGRVGTLLGEAGVNIAGLQLGRDQPGG 486

Query: 64  HAISFLCID 72
            A+  L +D
Sbjct: 487 RALFVLAVD 495


>gi|195953161|ref|YP_002121451.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobaculum sp. Y04AAS1]
 gi|195932773|gb|ACG57473.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobaculum sp. Y04AAS1]
          Length = 527

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 48/88 (54%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I     DV+   +M+   N D  G++  +G+ILG+  +NIA F LGR +    A+
Sbjct: 437 PRILQIDRFYVDVEPEGVMLVFENKDAPGVIGTIGSILGQANVNIAGFRLGREKKGGLAL 496

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
             L +D  + + VLEKL     I  +KQ
Sbjct: 497 GVLNLDSKVSDEVLEKLKRIPQIISMKQ 524


>gi|39996300|ref|NP_952251.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens PCA]
 gi|39983180|gb|AAR34574.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens PCA]
 gi|298505310|gb|ADI84033.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens KN400]
          Length = 542

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 51/90 (56%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++ + D      M+ +  AD  G++  +G I+G++ INIA  +LGRS+   
Sbjct: 436 EGLPRIVRLRDYSMDFAPEEHMLLLHYADRPGMIGKIGTIMGQHEINIASMNLGRSEKKG 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
            A+  L +D ++   VLE++       F+K
Sbjct: 496 EAMVILSLDSAVPPQVLEEVRAATDATFIK 525


>gi|258593832|emb|CBE70173.1| D-3-phosphoglycerate dehydrogenase [NC10 bacterium 'Dutch
           sediment']
          Length = 526

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 50/93 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +FS  +PR ++I E   +      ++   N D+ G++  +G +LG++ +NIA   LGR Q
Sbjct: 430 LFSRREPRVVRINEFRLEAIPEGYLLIFSNLDVPGVIGTIGTLLGKHRVNIAGMQLGREQ 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
               A+S + +D  +   V++++     I FVK
Sbjct: 490 PGGRAVSVVNVDNPVPAHVIDEIRRLPNIVFVK 522


>gi|116071264|ref|ZP_01468533.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. BL107]
 gi|116066669|gb|EAU72426.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. BL107]
          Length = 528

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 47/84 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G+++GE+ +NIA   +GR  
Sbjct: 432 VFADGELRITSIDEFPVNVSPSRHMLFTRHRDMPGIIGHLGSMMGEHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               A+  L ID  I   +L+K++
Sbjct: 492 VRGDAVMVLSIDDPIPAELLQKIT 515


>gi|322419774|ref|YP_004198997.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M18]
 gi|320126161|gb|ADW13721.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M18]
          Length = 532

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 49/90 (54%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +K+++   D      M+ +  AD  GI+  +G ILG++ INIA  +LGR +   
Sbjct: 435 EGIPRIVKLRDYQMDFRPEEHMLLLAYADRPGIIGKIGTILGKHEINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
            A+  L +D ++   V+E++       F+K
Sbjct: 495 EAMVILSLDSAVPADVVEEVREATDATFIK 524


>gi|319892782|ref|YP_004149657.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162478|gb|ADV06021.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464187|gb|ADX76340.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           ED99]
          Length = 531

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 32/77 (41%), Positives = 41/77 (53%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I +   D       + I + D  GIV   G ILGE+G+NIA  HLGRSQ    A+
Sbjct: 438 PRIVRINDYPVDFKPEHYQLVIHHFDRPGIVGKTGQILGEHGVNIASMHLGRSQIGGDAM 497

Query: 67  SFLCIDGSILNSVLEKL 83
             L ID  I  +V E L
Sbjct: 498 MILSIDHPINETVREAL 514


>gi|77918032|ref|YP_355847.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
 gi|77544115|gb|ABA87677.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
          Length = 534

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 50/90 (55%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G+PR +++++   D      M+ I   D  G++  +G ILGE+ INIA  +LGR +   
Sbjct: 434 EGQPRIVRLRDYQVDFAPEEHMLVITYRDQPGMIGKIGQILGEHDINIAAMNLGRQEKLG 493

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
            A+  L +D ++ + V+ ++   V   F+K
Sbjct: 494 EAMVILSLDSAVASHVVAEIGSVVDATFIK 523


>gi|295688138|ref|YP_003591831.1| D-3-phosphoglycerate dehydrogenase [Caulobacter segnis ATCC 21756]
 gi|295430041|gb|ADG09213.1| D-3-phosphoglycerate dehydrogenase [Caulobacter segnis ATCC 21756]
          Length = 526

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 45/79 (56%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G PR ++++ +  D      M+ I N D  G +  +G +LGE G+NIA F+LGR  + E 
Sbjct: 434 GAPRIVEVKGMELDAAFSPAMLYINNLDKPGFIGALGMMLGEAGVNIATFNLGRLAADED 493

Query: 65  AISFLCIDGSILNSVLEKL 83
           AI+ + +D +    +L K+
Sbjct: 494 AIALVGVDQAPSADLLAKI 512


>gi|225873973|ref|YP_002755432.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium capsulatum ATCC
           51196]
 gi|225792519|gb|ACO32609.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium capsulatum ATCC
           51196]
          Length = 525

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V      R + +  I+ +  +  +++ + N D+ G++  VG ILG++ INI +F LGRS 
Sbjct: 427 VLHGNSARLLNLDGIDIEAPLEGMLLSLRNLDVPGVIGRVGTILGDHQINIGNFALGRSD 486

Query: 61  STEH--AISFLCIDGSILNSVLEKL 83
              H  A++ + +DG++   VL+ L
Sbjct: 487 RDHHGTALAVIQVDGAVTEQVLQAL 511


>gi|167629222|ref|YP_001679721.1| d-3-phosphoglycerate dehydrogenase [Heliobacterium modesticaldum
           Ice1]
 gi|167591962|gb|ABZ83710.1| d-3-phosphoglycerate dehydrogenase [Heliobacterium modesticaldum
           Ice1]
          Length = 526

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 45/79 (56%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           KPRF+ I   + D+     M+ + + D   I+  +G I+GE+ +NIA  HLGR     +A
Sbjct: 434 KPRFVSIDGYDMDMAPEGHMLVVPHTDKPRIIGQLGTIIGEHNVNIAGMHLGRKDFGGNA 493

Query: 66  ISFLCIDGSILNSVLEKLS 84
           ++ L IDG +  +VL  L+
Sbjct: 494 VAILTIDGPVPAAVLTDLA 512


>gi|16127445|ref|NP_422009.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 gi|221236257|ref|YP_002518694.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
 gi|13424897|gb|AAK25177.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 gi|220965430|gb|ACL96786.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
          Length = 526

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 49/93 (52%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G PR ++++ +  D      M+ + N D  G +  +G +LGE G+NIA F+LGR  + E 
Sbjct: 434 GAPRIVEVKGMELDAAFSPAMLYVNNLDKPGFIGALGMLLGEAGVNIATFNLGRVSADED 493

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI+ + +D +    +L K+     ++  +   F
Sbjct: 494 AIALVGVDQAPDAGLLAKIQALPHVKEARALTF 526


>gi|224417936|ref|ZP_03655942.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|253827274|ref|ZP_04870159.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|313141477|ref|ZP_07803670.1| d-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|253510680|gb|EES89339.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|313130508|gb|EFR48125.1| d-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
          Length = 527

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 47/84 (55%), Gaps = 2/84 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++  P+ ++I     D+     MI   N D  G++ FVG  L ++ INIA F LGR  
Sbjct: 433 VFNENTPKIVEINHFELDIAPKGRMILFRNNDTPGVIGFVGTTLAKHNINIADFRLGR-- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
             + A++ + +D  + N V+++L+
Sbjct: 491 YGKEALAVILVDDEVSNEVIKELA 514


>gi|78184104|ref|YP_376539.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9902]
 gi|78168398|gb|ABB25495.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9902]
          Length = 528

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 47/84 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G+++GE+ +NIA   +GR  
Sbjct: 432 VFADGELRITSIDEYPVNVSPSRHMLFTRHRDMPGIIGHLGSMMGEHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               A+  L ID  I   +L+K++
Sbjct: 492 VRGDAVMVLSIDDPIPADLLQKIT 515


>gi|85707813|ref|ZP_01038879.1| phosphoglycerate dehydrogenase [Erythrobacter sp. NAP1]
 gi|85689347|gb|EAQ29350.1| phosphoglycerate dehydrogenase [Erythrobacter sp. NAP1]
          Length = 534

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I  I  + D+   M+ +VN D  G +  +G +LG  GINI  F+LGR  
Sbjct: 438 LFGKDAPRLVEIFGIGIEADLDGNMLYVVNDDKPGFIGRIGTLLGSQGINIGTFNLGRRD 497

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D      V+ +      ++ VK   F
Sbjct: 498 AGGEAVLLLSLDDEPSADVMAEAEKVEGVKMVKALSF 534


>gi|189425146|ref|YP_001952323.1| D-3-phosphoglycerate dehydrogenase [Geobacter lovleyi SZ]
 gi|189421405|gb|ACD95803.1| D-3-phosphoglycerate dehydrogenase [Geobacter lovleyi SZ]
          Length = 535

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 50/90 (55%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++   D      M+ +  AD  G++  +G I+G++ INI   +LGRS+   
Sbjct: 435 EGAPRIVRLRDYAMDFTPEEHMLLLHYADRPGMIGKIGTIMGKHEINIGSMNLGRSEKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
            A+  L ID ++  +V+E++       F++
Sbjct: 495 EAMVILSIDSAVSQAVIEEIKQATEATFIR 524


>gi|118580120|ref|YP_901370.1| D-3-phosphoglycerate dehydrogenase [Pelobacter propionicus DSM
           2379]
 gi|118502830|gb|ABK99312.1| D-3-phosphoglycerate dehydrogenase [Pelobacter propionicus DSM
           2379]
          Length = 539

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 49/95 (51%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++ + D      M+ +   D+ G++  +G I+G + INIA  +LGR +   
Sbjct: 435 EGAPRIVRLRDFSIDFSPEEHMLLLHYIDLPGMIGRIGTIMGTHDINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            A+  L +D ++   V+E++       F+K     
Sbjct: 495 EAMVILSLDSAVPLQVVEEIRTATDASFIKPLHLK 529


>gi|269121298|ref|YP_003309475.1| D-3-phosphoglycerate dehydrogenase [Sebaldella termitidis ATCC
           33386]
 gi|268615176|gb|ACZ09544.1| D-3-phosphoglycerate dehydrogenase [Sebaldella termitidis ATCC
           33386]
          Length = 528

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (55%), Gaps = 2/86 (2%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I +   DV I   M+ + N D+ G++  VG ILGE  +NIA  H+GR +++  AI 
Sbjct: 441 RIVEINDYPIDVVISENMLLVENNDVPGVIGNVGRILGEEQVNIATMHVGRKENS--AIM 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVK 93
            L +D  +    ++KL     IR VK
Sbjct: 499 LLTVDDVVEEKSIKKLEEFEQIRKVK 524


>gi|152990413|ref|YP_001356135.1| D-3-phosphoglycerate dehydrogenase [Nitratiruptor sp. SB155-2]
 gi|151422274|dbj|BAF69778.1| D-3-phosphoglycerate dehydrogenase [Nitratiruptor sp. SB155-2]
          Length = 529

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +   R + I     DV+    MI   N D+ G++  VG IL ++ INIA F LGR  
Sbjct: 434 IFEENVQRIVDINNFALDVEPKGKMILFKNTDVPGVIGEVGMILAKHNINIADFRLGRDN 493

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
              HA++ + +D  +   VL++LS
Sbjct: 494 HG-HALAVIIVDDDVSKEVLKELS 516


>gi|256255607|ref|ZP_05461143.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti B1/94]
 gi|261222811|ref|ZP_05937092.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti B1/94]
 gi|260921395|gb|EEX88048.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti B1/94]
          Length = 478

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/46 (45%), Positives = 33/46 (71%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEY 47
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKH 478


>gi|123966748|ref|YP_001011829.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9515]
 gi|123201114|gb|ABM72722.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9515]
          Length = 528

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG++ +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRFMLITRHRDMPGIIGKLGSLLGDHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+  L ID  I  ++LE +
Sbjct: 492 VRGEAVMVLSIDDPIPTNLLESI 514


>gi|33861910|ref|NP_893471.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|33640278|emb|CAE19813.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
          Length = 528

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG++ +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRFMLITRHRDMPGIIGKLGSLLGDHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+  L ID  I  ++LE +
Sbjct: 492 VRGEAVMVLSIDDPIPTNLLESI 514


>gi|257433819|ref|ZP_05610177.1| LOW QUALITY PROTEIN: D-3-phosphoglycerate dehydrogenase
           [Staphylococcus aureus subsp. aureus E1410]
 gi|257281912|gb|EEV12049.1| LOW QUALITY PROTEIN: D-3-phosphoglycerate dehydrogenase
           [Staphylococcus aureus subsp. aureus E1410]
          Length = 294

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 194 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 253

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 254 AGGDALMILSVDQPVSNNIIDEL 276


>gi|297619680|ref|YP_003707785.1| D-3-phosphoglycerate dehydrogenase [Methanococcus voltae A3]
 gi|297378657|gb|ADI36812.1| D-3-phosphoglycerate dehydrogenase [Methanococcus voltae A3]
          Length = 525

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 34/90 (37%), Positives = 47/90 (52%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG+  F KI   + DV     +  I + D  G+V  VG +LGEYGINIA   +GR +   
Sbjct: 432 DGEVVFRKINGYDIDVKPEGDLCVIRHIDRPGMVGKVGVLLGEYGINIAKMQVGRKEPGG 491

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
           H+I  L +D +I   V+ KL     +R  K
Sbjct: 492 HSIMILDVDHTISEDVMSKLKEMDNVRTAK 521


>gi|15606928|ref|NP_214309.1| D-3-phosphoglycerate dehydrogenase [Aquifex aeolicus VF5]
 gi|2984165|gb|AAC07698.1| D-3-phosphoglycerate dehydrogenase [Aquifex aeolicus VF5]
          Length = 533

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 45/88 (51%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR  +I     D++   +++   N D+ G++  +G+ILGE  INIA F LGR +    AI
Sbjct: 443 PRITEIDRYKVDIEPEGILLVFENKDVPGVIGKIGSILGEANINIAGFRLGREKKGGIAI 502

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
             L +D      VL ++     I FVK 
Sbjct: 503 GILNLDEPASEEVLSRIKEIPEILFVKH 530


>gi|253700874|ref|YP_003022063.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M21]
 gi|251775724|gb|ACT18305.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M21]
          Length = 532

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 47/90 (52%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +K+++   D      M+ +   D  GI+  +G ILG + INIA  +LGR +   
Sbjct: 435 EGIPRIVKLRDYQMDFRPEEHMLLMAYGDRPGIIGKIGTILGTHEINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
            A+  L +D ++   V+E++       FVK
Sbjct: 495 EAMVILSLDSAVTPEVVEEVRGATDATFVK 524


>gi|262276980|ref|ZP_06054773.1| phosphoglycerate dehydrogenase [alpha proteobacterium HIMB114]
 gi|262224083|gb|EEY74542.1| phosphoglycerate dehydrogenase [alpha proteobacterium HIMB114]
          Length = 526

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 46/94 (48%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GKPR + ++ I  + ++ +  + I N D  G +  +  IL +  INIA F+LGR  S   
Sbjct: 432 GKPRIVNVKGIKIEAELAKHNLYISNEDKPGFISNLSKILSDNNINIATFNLGRKDSGGE 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
           AI+ +  D  I   VL+ +     +   K   FN
Sbjct: 492 AIALISTDNPIEEKVLDGIKKLPLVIQAKTLTFN 525


>gi|32265634|ref|NP_859666.1| D-3-phosphoglycerate dehydrogenase [Helicobacter hepaticus ATCC
           51449]
 gi|32261682|gb|AAP76732.1| D-3-phosphoglycerate dehydrogenase [Helicobacter hepaticus ATCC
           51449]
          Length = 526

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 49/95 (51%), Gaps = 5/95 (5%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D   R   I    FD++    MI   N D+ G++  VG+ILG + +NI+ F L R  
Sbjct: 432 VFEDRHLRLTSINHFQFDIEPKGKMIFFKNTDVPGVIGLVGSILGNHQVNISDFRLARQN 491

Query: 61  STEHAISFLCIDGSILNSV---LEKLSVNVTIRFV 92
             + A++ + +D  + N V   LE +   ++I+ V
Sbjct: 492 --KEAMAVILVDSEVSNEVIGQLENIPACLSIKIV 524


>gi|285808609|gb|ADC36128.1| putative D-3-phosphoglycerate dehydrogenase [uncultured bacterium
           253]
          Length = 533

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 41/73 (56%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           M+ + N D+ G++  VG ILGE+ +NI+ FHLGR +    A++ + +D ++    L  L 
Sbjct: 460 MLVMRNRDVPGVIGRVGTILGEHDVNISRFHLGRRERGGEAMAVIEVDSTVAPKALAALR 519

Query: 85  VNVTIRFVKQFEF 97
               I  V++ E 
Sbjct: 520 SQEEILLVREIEL 532


>gi|313682014|ref|YP_004059752.1| d-3-phosphoglycerate dehydrogenase [Sulfuricurvum kujiense DSM
           16994]
 gi|313154874|gb|ADR33552.1| D-3-phosphoglycerate dehydrogenase [Sulfuricurvum kujiense DSM
           16994]
          Length = 529

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+D   R + I     DV+    MI   N D+ G++  VG +L  + +NIA F LGR++
Sbjct: 434 MFNDDVQRIVDINGFGVDVEPKGNMILFKNTDVPGVIGQVGTLLAAHEVNIADFRLGRNK 493

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
           S+E A++ + +D ++ +  L++LS
Sbjct: 494 SSE-ALAVIIVDSAVNDKTLKELS 516


>gi|222056517|ref|YP_002538879.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. FRC-32]
 gi|221565806|gb|ACM21778.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. FRC-32]
          Length = 540

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 50/90 (55%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++ + D      M+ +   D  G++  +G I+G +GINIA  +LGR +   
Sbjct: 436 EGAPRIVRLRDYSMDFAPDEHMLLLNYTDRPGMIGQIGTIMGTHGINIASMNLGRREKKG 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
            A+  L +D ++   V+E++   +   +++
Sbjct: 496 EAMVILSLDSAVPPEVVEEMKTAIDATYIR 525


>gi|197118344|ref|YP_002138771.1| D-3-phosphoglycerate dehydrogenase [Geobacter bemidjiensis Bem]
 gi|197087704|gb|ACH38975.1| D-3-phosphoglycerate dehydrogenase [Geobacter bemidjiensis Bem]
          Length = 532

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 47/90 (52%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +K+++   D      M+ +   D  GI+  +G ILG + INIA  +LGR +   
Sbjct: 435 EGIPRIVKLRDYQMDFRPEEHMLLMAYGDRPGIIGKIGTILGTHEINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
            A+  L +D ++   V+E++       FVK
Sbjct: 495 EAMVILSLDSAVTPEVVEEVRGATDATFVK 524


>gi|31790358|gb|AAP58615.1| putative D-3-phosphoglycerate dehydrogenase [uncultured
           Acidobacteria bacterium]
          Length = 561

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 37/59 (62%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKL 83
           M+ + N D+ G++  VG ILGE G+NI+HFHLGR +    A++ + +D +     L+ L
Sbjct: 488 MLVMRNRDVPGVIGRVGTILGERGVNISHFHLGRRERGGEAMAVIEVDAAADAETLDAL 546


>gi|218295353|ref|ZP_03496166.1| D-3-phosphoglycerate dehydrogenase [Thermus aquaticus Y51MC23]
 gi|218243985|gb|EED10511.1| D-3-phosphoglycerate dehydrogenase [Thermus aquaticus Y51MC23]
          Length = 521

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 40/79 (50%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GKPR + I +   +V     M+  VN D  G+V  VG +LGE G+NIA   LGR      
Sbjct: 429 GKPRLVGIDDYALEVVPEGYMLVCVNYDRPGVVGQVGTLLGEAGVNIAGMQLGRDVPGGR 488

Query: 65  AISFLCIDGSILNSVLEKL 83
           A+  L +D      VLE L
Sbjct: 489 ALFVLTVDQKPAPEVLEAL 507


>gi|289549238|ref|YP_003474226.1| D-3-phosphoglycerate dehydrogenase [Thermocrinis albus DSM 14484]
 gi|289182855|gb|ADC90099.1| D-3-phosphoglycerate dehydrogenase [Thermocrinis albus DSM 14484]
          Length = 530

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 46/87 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I     DV+   +++   N D+ G++  VG+ILG   +NIA F LGR +    A+ 
Sbjct: 441 RLVRIDSYMVDVEPEGILLIFENKDVPGVIGKVGSILGRANVNIAGFRLGREKKGGIALG 500

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQ 94
            L +D  +   VL +L     I FV+Q
Sbjct: 501 ILNLDDPVPEEVLAELKAVPEIFFVRQ 527


>gi|310778370|ref|YP_003966703.1| D-3-phosphoglycerate dehydrogenase [Ilyobacter polytropus DSM 2926]
 gi|309747693|gb|ADO82355.1| D-3-phosphoglycerate dehydrogenase [Ilyobacter polytropus DSM 2926]
          Length = 530

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S+ + + ++++  +F+V     M+ + N D+ G++  VG + GE GINIA   +GR  
Sbjct: 434 ISSNAEGKLVELEGYDFEVKPTEYMLFVKNKDVPGVIGHVGTLAGEKGINIATMQVGRKT 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
             + AI  L ID  + ++ LE+ 
Sbjct: 494 KGDTAIMILTIDEEVSSTTLEEF 516


>gi|254430175|ref|ZP_05043878.1| phosphoglycerate dehydrogenase [Cyanobium sp. PCC 7001]
 gi|197624628|gb|EDY37187.1| phosphoglycerate dehydrogenase [Cyanobium sp. PCC 7001]
          Length = 528

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 44/80 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTSIDEFPVNVTPSRHMLFTRHRDMPGIIGQIGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVL 80
               A+  L +D  I  S+L
Sbjct: 492 VRGDAVMVLSLDDPIPTSLL 511


>gi|34558837|gb|AAQ75181.1| D-3-phosphoglycerate dehydrogenase [Alvinella pompejana epibiont
           7G3]
          Length = 529

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +   R I+I     D++    MI   N D+ G++  VG I+  Y +NI+ F LGR  
Sbjct: 434 IFGENTQRIIEINGYKLDLEPKGKMILFRNTDVPGVIGDVGRIIASYNVNISDFRLGR-D 492

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
           S   A++ + +D ++  S+L++LS
Sbjct: 493 SNSQALAVVKVDDNVNKSLLQELS 516


>gi|110667020|ref|YP_656831.1| D-3-phosphoglycerate dehydrogenase [Haloquadratum walsbyi DSM
           16790]
 gi|109624767|emb|CAJ51173.1| phosphoglycerate dehydrogenase [Haloquadratum walsbyi DSM 16790]
          Length = 534

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIA-HFHLGRSQ 60
           F+ G+PR +KI     D      M+   NAD  G++ F+G++LGE+ INIA  F+  R  
Sbjct: 431 FTGGEPRIVKIDGYRVDAVPHGKMLVARNADKPGVIGFIGSVLGEHNINIAGMFNARRDI 490

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A++   +D S+   V+E+L
Sbjct: 491 EGGEALTIYNLDDSVPTDVVERL 513


>gi|224476814|ref|YP_002634420.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421421|emb|CAL28235.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 530

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 41/77 (53%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I +   D       + I + D  GIV   G ILGEY INIA  HLGR++    A+
Sbjct: 438 PRIVRINDYPVDFKPAEYQLIINHTDRPGIVGRTGQILGEYDINIASMHLGRAEEGGDAM 497

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D ++   +++ L
Sbjct: 498 MIISVDHTVSEDIIKAL 514


>gi|85680324|gb|ABC72353.1| phosphoglycerate dehydrogenase [Haloquadratum walsbyi]
          Length = 536

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIA-HFHLGRSQ 60
           F+ G+PR +KI     D      M+   NAD  G++ F+G++LGE+ INIA  F+  R  
Sbjct: 433 FTGGEPRIVKIDGYRVDAVPHGKMLVARNADKPGVIGFIGSVLGEHNINIAGMFNARRDI 492

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A++   +D S+   V+E+L
Sbjct: 493 EGGEALTIYNLDDSVPTDVVERL 515


>gi|218289859|ref|ZP_03494049.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239999|gb|EED07185.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 529

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +  PR +++     D  I  ++I   + D  G++  +G +LG+  INIA   +GR +
Sbjct: 433 VLGEYGPRIVELDGYPIDTPIQGILIYTRHEDRPGMIGRIGTLLGDRDINIAGMQVGRRE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D S+   V+++++ +  IR V+  E 
Sbjct: 493 TGGEAVMLLSVDKSVPQDVIDEIAKHPGIRLVRSIEL 529


>gi|257431137|ref|ZP_05607514.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257278085|gb|EEV08733.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 68-397]
          Length = 534

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|323440732|gb|EGA98441.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus O11]
          Length = 534

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|283470989|emb|CAQ50200.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 534

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|57652022|ref|YP_186607.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87160337|ref|YP_494364.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195533|ref|YP_500339.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|151221829|ref|YP_001332651.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|161509939|ref|YP_001575598.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221142358|ref|ZP_03566851.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|258450882|ref|ZP_05698935.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5948]
 gi|262049037|ref|ZP_06021915.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus D30]
 gi|262051787|ref|ZP_06024004.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 930918-3]
 gi|294849885|ref|ZP_06790624.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9754]
 gi|304380684|ref|ZP_07363355.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|57286208|gb|AAW38302.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87126311|gb|ABD20825.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87203091|gb|ABD30901.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|150374629|dbj|BAF67889.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|160368748|gb|ABX29719.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|257861418|gb|EEV84226.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5948]
 gi|259160281|gb|EEW45308.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 930918-3]
 gi|259162854|gb|EEW47418.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus D30]
 gi|269941202|emb|CBI49590.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TW20]
 gi|294823224|gb|EFG39654.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9754]
 gi|302751550|gb|ADL65727.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304340791|gb|EFM06720.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|315197191|gb|EFU27530.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320141667|gb|EFW33502.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143821|gb|EFW35594.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|329314397|gb|AEB88810.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329726965|gb|EGG63422.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21189]
          Length = 534

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|298694992|gb|ADI98214.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED133]
          Length = 534

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|282916984|ref|ZP_06324742.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283770802|ref|ZP_06343694.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
 gi|282319471|gb|EFB49823.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283460949|gb|EFC08039.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
          Length = 534

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|282911349|ref|ZP_06319151.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282325044|gb|EFB55354.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|312437820|gb|ADQ76891.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH60]
          Length = 534

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|82751311|ref|YP_417052.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus RF122]
 gi|82656842|emb|CAI81271.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus RF122]
          Length = 534

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|49483964|ref|YP_041188.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|253734492|ref|ZP_04868657.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257425837|ref|ZP_05602261.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428503|ref|ZP_05604901.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257436736|ref|ZP_05612780.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282904293|ref|ZP_06312181.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C160]
 gi|282906118|ref|ZP_06313973.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282909033|ref|ZP_06316851.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282914518|ref|ZP_06322304.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282919486|ref|ZP_06327221.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282924864|ref|ZP_06332530.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C101]
 gi|283958473|ref|ZP_06375924.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293503596|ref|ZP_06667443.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510612|ref|ZP_06669317.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M809]
 gi|293537153|ref|ZP_06671833.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|295428293|ref|ZP_06820922.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297590744|ref|ZP_06949382.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|49242093|emb|CAG40792.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|253727546|gb|EES96275.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257271531|gb|EEV03677.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275344|gb|EEV06831.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257284087|gb|EEV14210.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282313230|gb|EFB43626.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317296|gb|EFB47670.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282321699|gb|EFB52024.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282327297|gb|EFB57592.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331410|gb|EFB60924.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282595911|gb|EFC00875.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C160]
 gi|283790622|gb|EFC29439.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290919998|gb|EFD97066.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095262|gb|EFE25527.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466503|gb|EFF09024.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M809]
 gi|295127693|gb|EFG57330.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297575630|gb|EFH94346.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|302333388|gb|ADL23581.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|315195627|gb|EFU26014.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS00]
 gi|323442972|gb|EGB00594.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus O46]
 gi|329733088|gb|EGG69425.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21193]
          Length = 534

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|21283395|ref|NP_646483.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49486548|ref|YP_043769.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|297207564|ref|ZP_06923999.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300911645|ref|ZP_07129089.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|21204835|dbj|BAB95531.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49244991|emb|CAG43452.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|296887581|gb|EFH26479.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300887066|gb|EFK82267.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH70]
          Length = 534

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|15924714|ref|NP_372248.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15927301|ref|NP_374834.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus N315]
 gi|148268202|ref|YP_001247145.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150394270|ref|YP_001316945.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156980041|ref|YP_001442300.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253315102|ref|ZP_04838315.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732373|ref|ZP_04866538.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|255006509|ref|ZP_05145110.2| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257794107|ref|ZP_05643086.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9781]
 gi|258415811|ref|ZP_05682082.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9763]
 gi|258420640|ref|ZP_05683579.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9719]
 gi|258438290|ref|ZP_05689574.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9299]
 gi|258443748|ref|ZP_05692087.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A8115]
 gi|258445959|ref|ZP_05694135.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6300]
 gi|258448361|ref|ZP_05696478.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6224]
 gi|258454159|ref|ZP_05702130.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5937]
 gi|269203362|ref|YP_003282631.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282893218|ref|ZP_06301452.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8117]
 gi|282927853|ref|ZP_06335464.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A10102]
 gi|295406034|ref|ZP_06815842.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8819]
 gi|296276628|ref|ZP_06859135.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297245040|ref|ZP_06928917.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8796]
 gi|13701519|dbj|BAB42813.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus N315]
 gi|14247496|dbj|BAB57886.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|147741271|gb|ABQ49569.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946722|gb|ABR52658.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156722176|dbj|BAF78593.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253723895|gb|EES92624.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|257788079|gb|EEV26419.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9781]
 gi|257839404|gb|EEV63877.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9763]
 gi|257843244|gb|EEV67654.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9719]
 gi|257848334|gb|EEV72325.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9299]
 gi|257851154|gb|EEV75097.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A8115]
 gi|257855201|gb|EEV78140.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6300]
 gi|257858329|gb|EEV81214.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6224]
 gi|257863611|gb|EEV86368.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5937]
 gi|262075652|gb|ACY11625.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282590363|gb|EFB95442.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A10102]
 gi|282764536|gb|EFC04662.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8117]
 gi|285817406|gb|ADC37893.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 04-02981]
 gi|294969031|gb|EFG45052.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8819]
 gi|297178120|gb|EFH37368.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8796]
 gi|315130640|gb|EFT86626.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329727559|gb|EGG64015.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21172]
          Length = 534

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|284024770|ref|ZP_06379168.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 132]
          Length = 534

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|282924414|ref|ZP_06332087.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9765]
 gi|282592915|gb|EFB97918.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9765]
          Length = 534

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|320450108|ref|YP_004202204.1| phosphoglycerate dehydrogenase [Thermus scotoductus SA-01]
 gi|320150277|gb|ADW21655.1| phosphoglycerate dehydrogenase [Thermus scotoductus SA-01]
          Length = 521

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 5   GKPRFIKIQEINFDV-DIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           GKPR + I +   +V   G +++CI N D  G+V  VG +LGE G+NIA   LGR     
Sbjct: 429 GKPRLVGIDDYALEVVPEGYMLVCI-NYDRPGVVGQVGTLLGEAGVNIAGMQLGRDVPGG 487

Query: 64  HAISFLCIDGSILNSVLEKL 83
            A+  L +D      VLE L
Sbjct: 488 RALFVLTVDEKPSPEVLEAL 507


>gi|163781587|ref|ZP_02176587.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882807|gb|EDP76311.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 530

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 47/87 (54%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I +   D++   +++   N D+ G++  +G++LG   +NIA F LGR +    A+ 
Sbjct: 441 RIVQIDKYRVDIEPEGILLVFENKDVPGVIGKIGSVLGSASVNIAGFRLGREKKGGIALG 500

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQ 94
            L +D  +   V+E L     I FVKQ
Sbjct: 501 ILNLDDQVPEHVIEDLRGIPEILFVKQ 527


>gi|78779836|ref|YP_397948.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9312]
 gi|78713335|gb|ABB50512.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9312]
          Length = 528

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 45/83 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+  L ID  I N +L+ +
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTI 514


>gi|225174433|ref|ZP_03728432.1| D-3-phosphoglycerate dehydrogenase [Dethiobacter alkaliphilus AHT
           1]
 gi|225170218|gb|EEG79013.1| D-3-phosphoglycerate dehydrogenase [Dethiobacter alkaliphilus AHT
           1]
          Length = 525

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+    R +KI + N +V   R M+     D+ G++   G  LGE  INIA   +GR  
Sbjct: 428 LFNKDDIRIVKIDKYNIEVVPSRYMLVTKYMDMPGVIGRFGITLGESNINIAGMQVGRQS 487

Query: 61  STEHAISFLCIDGSILNSV---LEKLSVNVTIRFVK 93
               A+  L +D  +   V   LEKL   V+IRFVK
Sbjct: 488 IGGEAVMALQVDCPVPEDVIKKLEKLDAIVSIRFVK 523


>gi|123969087|ref|YP_001009945.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           AS9601]
 gi|123199197|gb|ABM70838.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. AS9601]
          Length = 528

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 45/83 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+  L ID  I N +L+ +
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTI 514


>gi|258424138|ref|ZP_05687020.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9635]
 gi|257845759|gb|EEV69791.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9635]
          Length = 534

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTK 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|126696878|ref|YP_001091764.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9301]
 gi|126543921|gb|ABO18163.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9301]
          Length = 528

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 45/83 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+  L ID  I N +L+ +
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTI 514


>gi|87123644|ref|ZP_01079494.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9917]
 gi|86168213|gb|EAQ69470.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9917]
          Length = 528

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/80 (36%), Positives = 43/80 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRVTSIDEFPVNVPPSRHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVL 80
               A+  L ID  I  S+L
Sbjct: 492 VRGDAVMVLSIDDPIPPSLL 511


>gi|242374013|ref|ZP_04819587.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W1]
 gi|242348264|gb|EES39866.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W1]
          Length = 531

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I   + D    +  I   + D  GIV   GN+LG +GINIA   LGR+     A+
Sbjct: 439 PRIVRINNFSLDFKPNQYQIVTCHKDKPGIVGHTGNLLGNHGINIASMTLGRNDEGGEAL 498

Query: 67  SFLCIDGSILNSVLE 81
             L ID    + V++
Sbjct: 499 MILSIDQQATDEVIK 513


>gi|46198894|ref|YP_004561.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB27]
 gi|46196518|gb|AAS80934.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB27]
          Length = 521

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 40/79 (50%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+PR + I +   +V     M+  VN D  G+V  VG +LGE G+NIA   LGR      
Sbjct: 429 GRPRLVGIDDYALEVVPEGYMLVCVNYDRPGVVGQVGTLLGEAGVNIAGMQLGRDVPGGR 488

Query: 65  AISFLCIDGSILNSVLEKL 83
           A+  L +D      VLE L
Sbjct: 489 ALFVLTVDQKPSPEVLEAL 507


>gi|55980921|ref|YP_144218.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB8]
 gi|55772334|dbj|BAD70775.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB8]
          Length = 521

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 40/79 (50%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+PR + I +   +V     M+  VN D  G+V  VG +LGE G+NIA   LGR      
Sbjct: 429 GRPRLVGIDDYALEVVPEGYMLVCVNYDRPGVVGQVGTLLGEAGVNIAGMQLGRDVPGGR 488

Query: 65  AISFLCIDGSILNSVLEKL 83
           A+  L +D      VLE L
Sbjct: 489 ALFVLTVDQKPSPEVLEAL 507


>gi|34557674|ref|NP_907489.1| D-3-phosphoglycerate dehydrogenase [Wolinella succinogenes DSM
           1740]
 gi|34483391|emb|CAE10389.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Wolinella succinogenes]
          Length = 528

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   R ++I     D++    MI   N D+ G++  +G  L ++ INIA F LGR+ 
Sbjct: 433 VFDENVQRIVEINGFGLDIEPKGRMILFKNTDVPGVIGMIGTTLAKHQINIADFRLGRNN 492

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
             + A++ + +D  +   V+E+L
Sbjct: 493 HNQ-ALAVIIVDDDVKKEVIEEL 514


>gi|148263798|ref|YP_001230504.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
 gi|146397298|gb|ABQ25931.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
          Length = 541

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 49/90 (54%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++ + D      M+ +   D  G++  +G I+G + INIA  +LGR +   
Sbjct: 436 EGAPRIVRLRDYSMDFAPAEHMLLLNYEDRPGMIGKIGTIMGAHSINIASMNLGRREEKG 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
            A+  L +D ++   V+E++ +     F++
Sbjct: 496 EAMVILSLDSAVPLEVMEEVRIATEATFIR 525


>gi|148242943|ref|YP_001228100.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. RCC307]
 gi|147851253|emb|CAK28747.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. RCC307]
          Length = 528

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRITSIDEFPLNVPPSRHMLFTRHRDMPGIIGNLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVL 80
               A+  L +D  I +S L
Sbjct: 492 VRGDAVMVLSLDDPIPSSTL 511


>gi|108803680|ref|YP_643617.1| D-3-phosphoglycerate dehydrogenase [Rubrobacter xylanophilus DSM
           9941]
 gi|108764923|gb|ABG03805.1| D-3-phosphoglycerate dehydrogenase [Rubrobacter xylanophilus DSM
           9941]
          Length = 527

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 42/78 (53%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +PR ++      D+   R M+ I N D+ G++  VG ILGE+GINI +  +GR +    A
Sbjct: 435 QPRLVEALGYTLDIVPERHMLFIRNEDVPGMIGKVGTILGEHGINIGNMAVGRGEPGSRA 494

Query: 66  ISFLCIDGSILNSVLEKL 83
              + +D  +   V+E L
Sbjct: 495 AMAVTVDEPVPPEVVESL 512


>gi|322379237|ref|ZP_08053628.1| D-3-phosphoglycerate dehydrogenase [Helicobacter suis HS1]
 gi|321148377|gb|EFX42886.1| D-3-phosphoglycerate dehydrogenase [Helicobacter suis HS1]
          Length = 524

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   +   I     DV     MI   N D  G++  VG  L +Y INIA F LGR+ 
Sbjct: 429 VFADNLLKITNINGFEMDVKPQGTMILFKNTDKPGVIGNVGQTLAKYDINIADFRLGRN- 487

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           S + A++ + +D SI   +L  L
Sbjct: 488 SKQEALAVILVDASISPKILHAL 510


>gi|148240317|ref|YP_001225704.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7803]
 gi|147848856|emb|CAK24407.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7803]
          Length = 528

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 44/80 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTNIDEFPVNVPPSRHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVL 80
               A+  L ID  I  ++L
Sbjct: 492 VRGDAVMVLSIDDPIPPALL 511


>gi|88807419|ref|ZP_01122931.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7805]
 gi|88788633|gb|EAR19788.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7805]
          Length = 528

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 44/80 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTNIDEFPVNVPPSRHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVL 80
               A+  L ID  I  ++L
Sbjct: 492 VRGDAVMVLSIDDPIPPALL 511


>gi|295398990|ref|ZP_06808972.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294978456|gb|EFG54052.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 524

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 44/72 (61%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           ++ I + D  G++  VGNILGE+ INIA   +GR Q+   AI  L +D  I +++L+KL+
Sbjct: 452 LLYIQHQDRPGMIGKVGNILGEHQINIATMQVGRQQAGGKAIMMLSLDKPIDDTLLQKLT 511

Query: 85  VNVTIRFVKQFE 96
               I  VK+ E
Sbjct: 512 EIEDIETVKRVE 523


>gi|116073644|ref|ZP_01470906.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9916]
 gi|116068949|gb|EAU74701.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9916]
          Length = 528

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 46/84 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTTIDEFPVNVPPSRHMLFTRHRDMPGIIGQLGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               A+  L ID  I  ++L  ++
Sbjct: 492 VRGDAVMVLSIDDPIPPTLLANIN 515


>gi|150402759|ref|YP_001330053.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C7]
 gi|150033789|gb|ABR65902.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C7]
          Length = 523

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 52/87 (59%), Gaps = 3/87 (3%)

Query: 10  IKIQEIN-FDVDIG-RLMICIV-NADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I  +EIN + +DI     ICI+ + D  G+V  VG +LGE+GINIA   +GR +   H+I
Sbjct: 433 IVFREINGYRMDIKPEGTICIIKHIDRPGMVGKVGVLLGEHGINIAGMQVGRREPGGHSI 492

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVK 93
            FL +D  I + V+E++     +R VK
Sbjct: 493 MFLDVDHMISDDVMEEIQKIENVRAVK 519


>gi|317182310|dbj|BAJ60094.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F57]
          Length = 524

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFASHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
             E A++ + +D  +   VLE+L
Sbjct: 489 QKE-ALALIIVDEEVSLKVLEEL 510


>gi|312110403|ref|YP_003988719.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y4.1MC1]
 gi|311215504|gb|ADP74108.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y4.1MC1]
          Length = 524

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 29/72 (40%), Positives = 44/72 (61%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           ++ I + D  G++  VGNILGE+ INIA   +GR Q+   AI  L +D  I +++L+KL+
Sbjct: 452 LLYIQHQDRPGMIGKVGNILGEHQINIATMQVGRQQAGGKAIMMLSLDKPIDDALLQKLT 511

Query: 85  VNVTIRFVKQFE 96
               I  VK+ E
Sbjct: 512 EIEDIETVKRVE 523


>gi|27468319|ref|NP_764956.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis ATCC
           12228]
 gi|57867245|ref|YP_188860.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           RP62A]
 gi|251811113|ref|ZP_04825586.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282875855|ref|ZP_06284722.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis SK135]
 gi|293366330|ref|ZP_06613010.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27315865|gb|AAO05000.1|AE016748_234 D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis ATCC
           12228]
 gi|57637903|gb|AAW54691.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           RP62A]
 gi|251805333|gb|EES57990.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281294880|gb|EFA87407.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis SK135]
 gi|291319568|gb|EFE59934.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329737454|gb|EGG73708.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU028]
 gi|329737488|gb|EGG73741.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU045]
          Length = 531

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I + + D    +  +   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VFAGFGPRIVRINDYSLDFKPNQYQLVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRND 492

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
           +   A+  L ID      V++ L+
Sbjct: 493 AGGDALMILSIDQQASEEVIKILN 516


>gi|197106733|ref|YP_002132110.1| D-3-phosphoglycerate dehydrogenase [Phenylobacterium zucineum HLK1]
 gi|196480153|gb|ACG79681.1| D-3-phosphoglycerate dehydrogenase [Phenylobacterium zucineum HLK1]
          Length = 524

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 46/79 (58%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G PR I+++ ++ D      M+ + N D  G +  +G +LG+  INIA F+LGR  + + 
Sbjct: 432 GAPRIIEVKGMDLDAPFAPQMLYVNNLDKPGFIGALGALLGDAKINIATFNLGRIDAGDD 491

Query: 65  AISFLCIDGSILNSVLEKL 83
           AI+ + +D +   ++L K+
Sbjct: 492 AIALVGVDQAPDEALLAKI 510


>gi|296445352|ref|ZP_06887310.1| D-3-phosphoglycerate dehydrogenase [Methylosinus trichosporium
           OB3b]
 gi|296257113|gb|EFH04182.1| D-3-phosphoglycerate dehydrogenase [Methylosinus trichosporium
           OB3b]
          Length = 528

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D +PR + I  +  +      MI + N D  G +     +LGE G+NIA   LGR +
Sbjct: 432 VFHDDEPRIVAIDGVRLETAFAPRMIFVSNEDRPGFMGLFAGLLGEAGVNIATCALGRDR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A + + +D       + +++    +RF    EF
Sbjct: 492 PGGSARALVGVDEPAPERAMARIAALPGVRFAAALEF 528


>gi|319401036|gb|EFV89255.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis FRI909]
          Length = 531

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I + + D    +  +   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VFAGFGPRIVRINDYSLDFKPNQYQLVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRND 492

Query: 61  STEHAISFLCID 72
           +   A+  L ID
Sbjct: 493 AGGDALMILSID 504


>gi|242242988|ref|ZP_04797433.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis W23144]
 gi|242233589|gb|EES35901.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis W23144]
          Length = 531

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I + + D    +  +   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VFAGFGPRIVRINDYSLDFKPNQYQLVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRND 492

Query: 61  STEHAISFLCID 72
           +   A+  L ID
Sbjct: 493 AGGDALMILSID 504


>gi|322437164|ref|YP_004219376.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX9]
 gi|321164891|gb|ADW70596.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX9]
          Length = 570

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 36/62 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V     PR + +  I+ +  +   ++ I N D+ G+V  +G ILGE+ INIA+F LGR+ 
Sbjct: 458 VLHGTSPRLLTLDGIDIEAPLNGTLVSIRNHDVPGVVGRIGTILGEHKINIANFALGRAS 517

Query: 61  ST 62
            T
Sbjct: 518 DT 519


>gi|124022234|ref|YP_001016541.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9303]
 gi|123962520|gb|ABM77276.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9303]
          Length = 528

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++G  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFANGDLRITTIDEFPVNVSPSRHMLLTRHRDMPGIIGQLGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVL 80
               A+  L ID  I  S+L
Sbjct: 492 VRGDAVMVLSIDDPIPPSLL 511


>gi|33863698|ref|NP_895258.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9313]
 gi|33635281|emb|CAE21606.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9313]
          Length = 532

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++G  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 436 VFANGDLRITTIDEFPVNVSPSRHMLLTRHRDMPGIIGQLGSVLGEHNVNIASMQVGRRI 495

Query: 61  STEHAISFLCIDGSILNSVL 80
               A+  L ID  I  S+L
Sbjct: 496 VRGDAVMVLSIDDPIPPSLL 515


>gi|328950683|ref|YP_004368018.1| D-3-phosphoglycerate dehydrogenase [Marinithermus hydrothermalis
           DSM 14884]
 gi|328451007|gb|AEB11908.1| D-3-phosphoglycerate dehydrogenase [Marinithermus hydrothermalis
           DSM 14884]
          Length = 521

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 31/80 (38%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 6   KPRFIKIQEINFDV-DIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           +PR + I +   +V   G L++C VN D  G+V  VG +LGE G+NIA   LGR      
Sbjct: 430 QPRLVGIDDYPLEVVPEGHLLVC-VNHDRPGVVGRVGTLLGEAGVNIAGMQLGRDAPGGR 488

Query: 65  AISFLCIDGSILNSVLEKLS 84
           A+  L +D      VLE L+
Sbjct: 489 ALFVLTVDERPSPEVLEALA 508


>gi|330813822|ref|YP_004358061.1| D-3-phosphoglycerate dehydrogenase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486917|gb|AEA81322.1| D-3-phosphoglycerate dehydrogenase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 527

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 46/94 (48%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GKPR ++++ I  D  +    + I N D  G +  +  +L +  INI  F+LGR +S   
Sbjct: 432 GKPRIVEVKGIEIDAGLSAHNLYISNEDKPGFIRDLSKVLADNKINIGTFNLGRKKSGGE 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
           A++ +  D  I  +V+E +     +   K   FN
Sbjct: 492 AVALISTDSEIEKTVIESIKKIPLVIQAKYLSFN 525


>gi|113954952|ref|YP_731454.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9311]
 gi|113882303|gb|ABI47261.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9311]
          Length = 528

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRVTSIDEFPVNVPPSRHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVL 80
               A+  L ID  I  ++L
Sbjct: 492 VRGDAVMVLSIDDPIPPALL 511


>gi|307352504|ref|YP_003893555.1| D-3-phosphoglycerate dehydrogenase [Methanoplanus petrolearius DSM
           11571]
 gi|307155737|gb|ADN35117.1| D-3-phosphoglycerate dehydrogenase [Methanoplanus petrolearius DSM
           11571]
          Length = 528

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 45/83 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V S  K R +KI E   D+  G  ++   + D+ G++     I+G+YG+NIA   +GR+Q
Sbjct: 432 VSSPEKLRIVKIGEYMTDMTPGGDVVISRHHDVPGVIGHFATIIGKYGVNIAGMQVGRNQ 491

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
             E A+  L +D  +    ++K+
Sbjct: 492 PGEEAVMVLNVDSEVPQEAMDKI 514


>gi|154147887|ref|YP_001406068.1| D-3-phosphoglycerate dehydrogenase [Campylobacter hominis ATCC
           BAA-381]
 gi|153803896|gb|ABS50903.1| phosphoglycerate dehydrogenase [Campylobacter hominis ATCC BAA-381]
          Length = 525

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D + R + I     D      MI   N D+ G++  V  IL +  INIA F LGR +
Sbjct: 430 VFNDDEERILNIDGFKTDFKPKGKMIIFKNTDVPGVIASVSAILAKDKINIADFRLGRGE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
              +A++ + +D  I  SVL++LS
Sbjct: 490 DG-NALAVILVDEDISKSVLDELS 512


>gi|312792696|ref|YP_004025619.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179836|gb|ADQ40006.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 531

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 41/76 (53%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E A+ 
Sbjct: 442 RIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGRIGTIVGEYGINIATMQVSRNKKGEKAVM 501

Query: 68  FLCIDGSILNSVLEKL 83
              IDG++ +  +EKL
Sbjct: 502 VCEIDGALPDEAVEKL 517


>gi|312878276|ref|ZP_07738197.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311794944|gb|EFR11352.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 531

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 41/76 (53%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E A+ 
Sbjct: 442 RIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGRIGTIVGEYGINIATMQVSRNKKGEKAVM 501

Query: 68  FLCIDGSILNSVLEKL 83
              IDG++ +  +EKL
Sbjct: 502 VCEIDGALPDEAVEKL 517


>gi|146296326|ref|YP_001180097.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409902|gb|ABP66906.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 531

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E A+ 
Sbjct: 442 RIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGEKAVM 501

Query: 68  FLCIDGSILNSVLEKL-SVNVTIR 90
              IDG++ +  +EKL SV+  +R
Sbjct: 502 VCEIDGALPDEAVEKLKSVDGILR 525


>gi|239827548|ref|YP_002950172.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. WCH70]
 gi|239807841|gb|ACS24906.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. WCH70]
          Length = 525

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/72 (37%), Positives = 44/72 (61%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           ++ I + D  G++  VGN+LGE+ +NIA   +GR Q+   AI  L +D  I +++L+KL+
Sbjct: 452 LLYIQHQDRPGMIGKVGNVLGEHQVNIATMQVGREQAGGKAIMMLSLDKPIDDALLQKLA 511

Query: 85  VNVTIRFVKQFE 96
               I  VK+ E
Sbjct: 512 EIEDIETVKRLE 523


>gi|78223581|ref|YP_385328.1| D-3-phosphoglycerate dehydrogenase [Geobacter metallireducens
           GS-15]
 gi|78194836|gb|ABB32603.1| D-3-phosphoglycerate dehydrogenase [Geobacter metallireducens
           GS-15]
          Length = 541

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 47/90 (52%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +K+++   D      M+ +   D  G++  +G I+G + INIA  +LGR +   
Sbjct: 435 EGSPRIVKLRDYQVDFAPDEHMLSLTYEDRPGMIGKIGTIMGAHDINIASMNLGRREKRG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
            A+  L +D ++   V+E++       F+K
Sbjct: 495 EAMVILSLDSAVPPFVVEEVRKATDATFIK 524


>gi|318042229|ref|ZP_07974185.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CB0101]
          Length = 528

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 44/80 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRITTIDEFPVNVAPSRHMLFTRHRDMPGIIGNLGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVL 80
               A+  L +D  +  S+L
Sbjct: 492 VRGDAVMVLSLDDPLPASLL 511


>gi|325294449|ref|YP_004280963.1| D-3-phosphoglycerate dehydrogenase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064897|gb|ADY72904.1| D-3-phosphoglycerate dehydrogenase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 529

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 48/94 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  D  P+ ++I    FD+      + I N D+ G++  +G+ILG+Y +NIA F LGR +
Sbjct: 433 VMDDQFPKIVEINGFLFDLTPKGKFLLIKNFDVPGVIGKLGSILGKYNVNIAGFQLGRIE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
             + A   + +D  +    + ++     I  VKQ
Sbjct: 493 RGKEAKGVILVDNDVPQEAINEIKKIPEILEVKQ 526


>gi|258511215|ref|YP_003184649.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477941|gb|ACV58260.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 529

 Score = 48.1 bits (113), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 50/97 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +  PR +++     D  I  ++I   + D  G++  +G +LG+  INIA   +GR +
Sbjct: 433 VLGEYGPRIVELDGYPIDTPIQGILIYTRHEDRPGMIGRIGTLLGDRDINIAGMQVGRRE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +   V+++++ +  IR V+  E 
Sbjct: 493 TGGEAVMLLSVDKRVPQDVIDEIAKHPGIRLVRAIEL 529


>gi|217966485|ref|YP_002351991.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 6724]
 gi|217335584|gb|ACK41377.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 6724]
          Length = 525

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 45/81 (55%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           S  + R + IQ+ + D+ + + M+   + D  GI+  VG +LG+  INIA   +GR +  
Sbjct: 431 SRNQERILAIQDYHLDLALSQYMLIAFHIDRPGIIGQVGTVLGKNNINIAAMQVGRKEIG 490

Query: 63  EHAISFLCIDGSILNSVLEKL 83
           + A+  L ID  + + VL +L
Sbjct: 491 KDAVMVLVIDNPVDDKVLREL 511


>gi|87301209|ref|ZP_01084050.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 5701]
 gi|87284177|gb|EAQ76130.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 5701]
          Length = 528

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRITTIDEFPVNVMPTRHMLITRHRDMPGIIGNIGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVL 80
               A+  L +D  I  S+L
Sbjct: 492 VRGDAVMVLSLDDPIPPSLL 511


>gi|301122067|ref|XP_002908760.1| phosphoserine aminotransferase, putative [Phytophthora infestans
           T30-4]
 gi|262099522|gb|EEY57574.1| phosphoserine aminotransferase, putative [Phytophthora infestans
           T30-4]
          Length = 3635

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   + RF+   ++  D      M+   N D  G++  V ++L ++ INI +F L R +
Sbjct: 461 VFGKSQLRFVSFDDLPMDAIPSGSMLLFNNTDQPGVLHKVTSVLAKHQINIGNFGLAREK 520

Query: 61  STEHAISFLCIDGSILNSV---LEKLSVNVTIRFVKQFEFN 98
           +T  A+S L +D +I + V   LE L +   +R V   E N
Sbjct: 521 ATAAAVSVLNVDEAIPDVVMDELEALGMLTDLRRVNLLELN 561


>gi|223043512|ref|ZP_03613557.1| phosphoglycerate dehydrogenase [Staphylococcus capitis SK14]
 gi|222443000|gb|EEE49100.1| phosphoglycerate dehydrogenase [Staphylococcus capitis SK14]
          Length = 531

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 34/66 (51%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I + + D       I   + D  GIV   GN+LG +GINIA   LGR+     A+
Sbjct: 439 PRIVRINDFSLDFKPNEYQIVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRNNEGGDAL 498

Query: 67  SFLCID 72
             L ID
Sbjct: 499 MILSID 504


>gi|222530091|ref|YP_002573973.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456938|gb|ACM61200.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor bescii DSM
           6725]
          Length = 531

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 40/76 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E A+ 
Sbjct: 442 RIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGEKAVM 501

Query: 68  FLCIDGSILNSVLEKL 83
              IDG + +  +EKL
Sbjct: 502 VCEIDGELPDEAIEKL 517


>gi|313673092|ref|YP_004051203.1| d-3-phosphoglycerate dehydrogenase [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939848|gb|ADR19040.1| D-3-phosphoglycerate dehydrogenase [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 540

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   R I I    FDV    + +   N D  G++  VG ILG + INIA F L R Q
Sbjct: 445 VFNDNIGRVIFIDNFYFDVVPKGIFLYFNNYDRPGVIGKVGTILGNHNINIAGFELSR-Q 503

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               AI+F+ +D  I N VL+++
Sbjct: 504 KQGQAIAFVSVDNPIGNEVLKEI 526


>gi|314933875|ref|ZP_07841240.1| phosphoglycerate dehydrogenase [Staphylococcus caprae C87]
 gi|313654025|gb|EFS17782.1| phosphoglycerate dehydrogenase [Staphylococcus caprae C87]
          Length = 531

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 34/66 (51%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I + + D       I   + D  GIV   GN+LG +GINIA   LGR+     A+
Sbjct: 439 PRIVRINDFSLDFKPNEYQIVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRNNEGGDAL 498

Query: 67  SFLCID 72
             L ID
Sbjct: 499 MILSID 504


>gi|33865069|ref|NP_896628.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 8102]
 gi|33638753|emb|CAE07048.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 8102]
          Length = 528

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 46/84 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V     M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRITSIDEFPVNVTPSSHMLFTRHRDMPGIIGQLGSMLGEHNVNIAAMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               A+  L ID  I  ++L+ ++
Sbjct: 492 VRGDAVMVLSIDDPIPAALLQTIT 515


>gi|45359151|ref|NP_988708.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis S2]
 gi|45048026|emb|CAF31144.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis S2]
          Length = 523

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 26  ICIV-NADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           ICI+ + D  G+V  VG +LGE+GINIA   +GR +   H+I FL ID  I + VL+++ 
Sbjct: 451 ICIIKHIDRPGMVGKVGVLLGEHGINIAGMQVGRREPGGHSIMFLDIDHMISDEVLDEIR 510

Query: 85  VNVTIRFVK 93
               +R  K
Sbjct: 511 KMENVRAAK 519


>gi|319956089|ref|YP_004167352.1| d-3-phosphoglycerate dehydrogenase [Nitratifractor salsuginis DSM
           16511]
 gi|319418493|gb|ADV45603.1| D-3-phosphoglycerate dehydrogenase [Nitratifractor salsuginis DSM
           16511]
          Length = 530

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +G  R + I     D++    MI   N D  G++  VG I+ E G+NI  F LGR  
Sbjct: 435 VFEEGIQRIVDIDGYTLDLEPKGRMILFKNNDEPGVIGDVGRIIAENGLNIGDFRLGRD- 493

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
           S   A++ + +DG I   ++++L+
Sbjct: 494 SNGQALAVVRVDGEIPKKLIDELA 517


>gi|312621616|ref|YP_004023229.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202083|gb|ADQ45410.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 531

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 40/76 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E A+ 
Sbjct: 442 RIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGEKAVM 501

Query: 68  FLCIDGSILNSVLEKL 83
              IDG + +  +EKL
Sbjct: 502 VCEIDGELPDEAVEKL 517


>gi|84489937|ref|YP_448169.1| D-3-phosphoglycerate dehydrogenase [Methanosphaera stadtmanae DSM
           3091]
 gi|84373256|gb|ABC57526.1| SerA [Methanosphaera stadtmanae DSM 3091]
          Length = 524

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 45/93 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  + + + I I + +  + +   M  I   D+ G +  +G ILG+Y INIA   +GR  
Sbjct: 428 VVENNEAKIISIDDYDVRLTLEGKMAIIKYVDLPGTIGKIGKILGDYKINIAEMQVGRQT 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
               AI  L +D  I   V+ KL  +  I FVK
Sbjct: 488 EGGEAIMVLKVDQEITEEVVSKLEDDNDIDFVK 520


>gi|312126868|ref|YP_003991742.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776887|gb|ADQ06373.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 531

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 40/76 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E A+ 
Sbjct: 442 RIIDFFGYKVDFKPEKYMLIIQNIDKPGMIGRIGTIVGEYGINIATMQVSRNKKGEKAVM 501

Query: 68  FLCIDGSILNSVLEKL 83
              IDG + +  +EKL
Sbjct: 502 VCEIDGELPDEAVEKL 517


>gi|206901901|ref|YP_002251552.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
 gi|206741004|gb|ACI20062.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
          Length = 525

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 45/81 (55%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           S G+ R + IQ+   D+ + + ++   + D  GI+  VG +LG+  INIA   +GR +  
Sbjct: 431 SRGQERVLAIQDYYLDLALSQYLLIAFHIDRPGIIGKVGTVLGKNNINIAAMQVGRKEIG 490

Query: 63  EHAISFLCIDGSILNSVLEKL 83
           + A+  L ID  +   VL++L
Sbjct: 491 KDAVMVLVIDNPVDEKVLKEL 511


>gi|312135806|ref|YP_004003144.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor owensensis
           OL]
 gi|311775857|gb|ADQ05344.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor owensensis
           OL]
          Length = 531

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 41/76 (53%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E A+ 
Sbjct: 442 RIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGEKAVM 501

Query: 68  FLCIDGSILNSVLEKL 83
              +DG++ +  +EKL
Sbjct: 502 VCEVDGALPDEAVEKL 517


>gi|302872524|ref|YP_003841160.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575383|gb|ADL43174.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 531

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 41/76 (53%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E A+ 
Sbjct: 442 RIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGEKAVM 501

Query: 68  FLCIDGSILNSVLEKL 83
              +DG++ +  +EKL
Sbjct: 502 VCEVDGALPDEAVEKL 517


>gi|118443172|ref|YP_879194.1| D-3-phosphoglycerate dehydrogenase [Clostridium novyi NT]
 gi|118133628|gb|ABK60672.1| D-3-phosphoglycerate dehydrogenase [Clostridium novyi NT]
          Length = 530

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 45/83 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V S+ + + ++IQ    DV     M+ + N D+ G++  VG I+G  GIN+A   +GR  
Sbjct: 434 VSSNHEGKIVEIQGYEVDVKPSTHMVFVQNKDVPGVIGQVGTIIGMEGINVATMQVGRKA 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
             E+A+  L +D  + +  ++K 
Sbjct: 494 KGENALMILNVDSEVSDESIKKF 516


>gi|251771412|gb|EES51991.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum
           ferrodiazotrophum]
          Length = 537

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 47/93 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R + +  +  +V    +M+ + N D  G+V  VG++LG +GINI+    GR  
Sbjct: 436 IFQKKDFRIVSLDSLPVEVVPDPIMLYLTNQDQPGVVGLVGSLLGSHGINISRMQFGRDF 495

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
               A+S + +D     +VLE++  N  I  +K
Sbjct: 496 PGGKAVSMIGVDSEPPAAVLEEIRKNPKIIALK 528


>gi|50954968|ref|YP_062256.1| D-3-phosphoglycerate dehydrogenase [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50951450|gb|AAT89151.1| D-3-phosphoglycerate dehydrogenase [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 530

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 3/95 (3%)

Query: 5   GKPRFIKIQEIN-FDVD--IGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           G  +  K+ EIN +DV+  I   +I +V  D  GIV   G   GE  INIA   + R+ +
Sbjct: 432 GTKQIEKVVEINGYDVEVPIAEHLIVMVYDDRPGIVAVYGREFGEAKINIAGMQIARTSA 491

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              A+S L +D S+   +LEK+ V +    +++ +
Sbjct: 492 GGKALSVLTVDSSVPEGLLEKVRVAIDADLLQEID 526


>gi|312830102|emb|CBX34944.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ECT-R 2]
          Length = 534

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 46/83 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D   +V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPDMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           +   A+  L +D  + N+++++L
Sbjct: 494 AGGDALMILSVDQPVSNNIIDEL 516


>gi|254526871|ref|ZP_05138923.1| phosphoglycerate dehydrogenase [Prochlorococcus marinus str. MIT
           9202]
 gi|221538295|gb|EEE40748.1| phosphoglycerate dehydrogenase [Prochlorococcus marinus str. MIT
           9202]
          Length = 528

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 45/83 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ + + I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELKIMSIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+  L ID  I N +L+ +
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTI 514


>gi|157413916|ref|YP_001484782.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9215]
 gi|157388491|gb|ABV51196.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9215]
          Length = 528

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 45/83 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ + + I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELKIMSIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+  L ID  I N +L+ +
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTI 514


>gi|302038732|ref|YP_003799054.1| d-3-phosphoglycerate dehydrogenase [Candidatus Nitrospira defluvii]
 gi|300606796|emb|CBK43129.1| D-3-phosphoglycerate dehydrogenase [Candidatus Nitrospira defluvii]
          Length = 530

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 46/87 (52%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR I+I +   +V     ++ I N D  G++  VG+ILG++ INIA     R +    A+
Sbjct: 436 PRIIEIDQFKVEVVPDNHLLLIQNEDRPGVIGTVGHILGDHNINIARMQCSREERGGKAL 495

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVK 93
               +D  +  SVL++++ +  I  VK
Sbjct: 496 QIFGLDAPLPKSVLDQITNSKHILSVK 522


>gi|150399650|ref|YP_001323417.1| D-3-phosphoglycerate dehydrogenase [Methanococcus vannielii SB]
 gi|150012353|gb|ABR54805.1| D-3-phosphoglycerate dehydrogenase [Methanococcus vannielii SB]
          Length = 523

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 29/69 (42%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 26  ICIV-NADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           ICI+ + D  G+V  VG ILGE+GINIA   +GR +   H+I FL ID  I   V++++ 
Sbjct: 451 ICIIKHIDRPGMVGKVGLILGEHGINIAGMQVGRKEPGGHSIMFLDIDHMIPEEVMDEIK 510

Query: 85  VNVTIRFVK 93
               +R V+
Sbjct: 511 KIENVRAVR 519


>gi|315453857|ref|YP_004074127.1| D-3-phosphoglycerate dehydrogenase [Helicobacter felis ATCC 49179]
 gi|315132909|emb|CBY83537.1| D-3-phosphoglycerate dehydrogenase [Helicobacter felis ATCC 49179]
          Length = 525

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFS+   +   I     D+     MI   N D  G++  VG+ L ++GINIA F LGR+ 
Sbjct: 430 VFSEDILKITNIDGFEMDIQPQGTMILFKNTDKPGVIGNVGHTLAKHGINIADFRLGRNA 489

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
             E A++ + +D  I +++L  L
Sbjct: 490 KKE-ALAVILVDTPINSAILHDL 511


>gi|315636539|ref|ZP_07891775.1| phosphoglycerate dehydrogenase [Arcobacter butzleri JV22]
 gi|315479188|gb|EFU69885.1| phosphoglycerate dehydrogenase [Arcobacter butzleri JV22]
          Length = 528

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   R I++     DVD    MI + N DI G++  VG +LG+  INIA F L R +
Sbjct: 433 VFADDVQRVIELDGFAIDVDPKGKMIVMKNKDIPGVIGTVGKLLGDNKINIADFRLSRGK 492

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A++   ID  + + +++ L
Sbjct: 493 DGI-ALAIALIDEKVTSEIIKNL 514


>gi|157738251|ref|YP_001490935.1| D-3-phosphoglycerate dehydrogenase [Arcobacter butzleri RM4018]
 gi|157700105|gb|ABV68265.1| D-3-phosphoglycerate dehydrogenase [Arcobacter butzleri RM4018]
          Length = 528

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   R I++     DVD    MI + N DI G++  VG +LG+  INIA F L R +
Sbjct: 433 VFADDVQRVIELDGFAIDVDPKGKMIVMKNKDIPGVIGTVGKLLGDNKINIADFRLSRGK 492

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A++   ID  + + +++ L
Sbjct: 493 DGI-ALAIALIDEKVTSEIIKNL 514


>gi|318061963|ref|ZP_07980684.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. SA3_actG]
 gi|318077433|ref|ZP_07984765.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. SA3_actF]
          Length = 531

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E   D+ +   M+ +  AD  G+V  VG +LGE GINIA   + R++    A++
Sbjct: 441 KIVAIGEHTVDLALADHMVVLRYADRPGVVGTVGRVLGESGINIAGMQVSRAEEGGEALA 500

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D S+   VL +++
Sbjct: 501 VLTVDDSVPADVLAEVA 517


>gi|302522080|ref|ZP_07274422.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB78]
 gi|302430975|gb|EFL02791.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB78]
          Length = 531

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E   D+ +   M+ +  AD  G+V  VG +LGE GINIA   + R++    A++
Sbjct: 441 KIVAIGEHTVDLALADHMVVLRYADRPGVVGTVGRVLGESGINIAGMQVSRAEEGGEALA 500

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D S+   VL +++
Sbjct: 501 VLTVDDSVPADVLAEVA 517


>gi|291294575|ref|YP_003505973.1| D-3-phosphoglycerate dehydrogenase [Meiothermus ruber DSM 1279]
 gi|290469534|gb|ADD26953.1| D-3-phosphoglycerate dehydrogenase [Meiothermus ruber DSM 1279]
          Length = 521

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 5   GKPRFIKIQEINFD-VDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           GKPR + I +   + V  G +++CI N D  G+V  VG +LGE  INIA   LGR     
Sbjct: 429 GKPRIVGIDDHTVEAVPRGFMLVCI-NRDRPGVVGKVGTLLGENNINIAGMQLGRDNPGG 487

Query: 64  HAISFLCIDGSILNSVLEKL 83
            A+  L ID     +VL  L
Sbjct: 488 KALFVLAIDERPGEAVLSAL 507


>gi|295836361|ref|ZP_06823294.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB74]
 gi|295825983|gb|EFG64595.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB74]
          Length = 531

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 43/77 (55%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E   D+ +   M+ +  AD  G+V  VG +LGE GINIA   + R++    A++
Sbjct: 441 KIVAIGEHTVDLALADHMVVLRYADRPGVVGTVGRVLGEAGINIAGMQVSRAEEGGEALA 500

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D S+   VL +++
Sbjct: 501 VLTVDDSVPADVLAEVA 517


>gi|254383224|ref|ZP_04998577.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. Mg1]
 gi|194342122|gb|EDX23088.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. Mg1]
          Length = 529

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 41/80 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   MI +  AD  G+V  VG  LGE G+NIA   + R++    A+ 
Sbjct: 439 KIVGIGEYDLDLALAEQMIVLRYADRPGVVGTVGRFLGEAGLNIAGMQVARAEEGGEALG 498

Query: 68  FLCIDGSILNSVLEKLSVNV 87
            L +D  +   VL  ++  +
Sbjct: 499 VLTVDAEVPAGVLADIAAEI 518


>gi|325181642|emb|CCA16093.1| phosphoserine aminotransferase putative [Albugo laibachii Nc14]
          Length = 964

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 42/83 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   +PR I + +++ D      M+   N D  G++  + ++L ++ INI  F L R  
Sbjct: 460 VFGKNQPRLIALNDLSVDCIPTGSMLMFQNQDQPGVLNSITSVLAKHDINIGCFGLARES 519

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
              HA+  L +D  I N  +++L
Sbjct: 520 KEAHAVGILNLDDPIPNQAIQEL 542


>gi|297566778|ref|YP_003685750.1| D-3-phosphoglycerate dehydrogenase [Meiothermus silvanus DSM 9946]
 gi|296851227|gb|ADH64242.1| D-3-phosphoglycerate dehydrogenase [Meiothermus silvanus DSM 9946]
          Length = 521

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 28/79 (35%), Positives = 38/79 (48%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GKPR + + +   +V     M+   N D  G+V  VG +LG  G+NIA   LGR      
Sbjct: 429 GKPRLVGVDDYRLEVVPEGFMLICTNRDQPGVVGKVGTLLGGSGVNIAGMQLGRDAPGGK 488

Query: 65  AISFLCIDGSILNSVLEKL 83
           A+  L ID      VL+ L
Sbjct: 489 ALFVLAIDERPSEEVLDAL 507


>gi|332178487|gb|AEE14176.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfobium narugense DSM
           14796]
          Length = 528

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 43/83 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SD KPR I+I     D      ++   + D  GI+   G ILG+  INIA   LGR+ 
Sbjct: 431 ILSDQKPRIIEIDSYRVDAFPEGYLLVSRHRDKPGIIGRFGTILGKNNINIAGMQLGRNL 490

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           ++  A+  L +D  + + VL +L
Sbjct: 491 TSGLAVMILSVDSEVNDDVLREL 513


>gi|168028593|ref|XP_001766812.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682021|gb|EDQ68443.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 565

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   ++   + DV +   +I     D  G++  VG+ILGE  +NI+   +GR    E
Sbjct: 472 DGVPYLSRVGSFSVDVSLEGSIILYRQVDQPGMIGKVGSILGEENVNISFMSVGRKSPRE 531

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           HA+  + +D     + L+KL     I  V++F F
Sbjct: 532 HAVMAIGVDEEPSKATLQKLG---DIPAVEEFVF 562


>gi|312128646|ref|YP_003993520.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778665|gb|ADQ08151.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 531

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 39/76 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I       D    + M+ I N D  G++  +G I+GEY INIA   + R++  E A+ 
Sbjct: 442 RIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYDINIAQMQVSRNKKGEKAVM 501

Query: 68  FLCIDGSILNSVLEKL 83
              +DG + N  +EKL
Sbjct: 502 VCEVDGIVPNEAIEKL 517


>gi|257461292|ref|ZP_05626389.1| phosphoglycerate dehydrogenase [Campylobacter gracilis RM3268]
 gi|257441320|gb|EEV16466.1| phosphoglycerate dehydrogenase [Campylobacter gracilis RM3268]
          Length = 535

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 1/93 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   + R + I     D      MI   N D+ G++  V  IL +  INIA F LGR +
Sbjct: 440 VFDGSEERIVNIGGFKTDFKPKGKMIIFKNTDVPGVIKSVSTILADENINIADFRLGRGE 499

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
             + A++ + +D  +  S L+KL+   T   V+
Sbjct: 500 EGD-ALAVILVDSEVQKSTLDKLAALQTCLMVR 531


>gi|303244898|ref|ZP_07331224.1| D-3-phosphoglycerate dehydrogenase [Methanothermococcus okinawensis
           IH1]
 gi|302484715|gb|EFL47653.1| D-3-phosphoglycerate dehydrogenase [Methanothermococcus okinawensis
           IH1]
          Length = 523

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   +I     D+    ++  I + D  G+V  VG +LG+YG+NIA   +GR +   
Sbjct: 430 DGNPVLREINGYKVDIKPEGIICVIKHIDRPGMVGKVGLLLGDYGVNIAGMQVGRKEPGG 489

Query: 64  HAISFLCIDGSILNSVLEKL 83
            +I  L +D  I + V+EKL
Sbjct: 490 ESIMVLNVDHMIPDEVIEKL 509


>gi|257052567|ref|YP_003130400.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
 gi|256691330|gb|ACV11667.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
          Length = 528

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 41/83 (49%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F+DG+PR + I     +      M+ + NAD  G++ F+G +LGEY +NIA     R   
Sbjct: 426 FADGEPRIVSIDRYWVEAIPHGHMLIVRNADEPGVIGFIGTVLGEYDVNIAGMFNAREAI 485

Query: 62  TEHAISFLCIDGSILNSVLEKLS 84
              A+S   +D      VL  L+
Sbjct: 486 GGEALSVYNLDDEPGEDVLAALN 508


>gi|134046847|ref|YP_001098332.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C5]
 gi|132664472|gb|ABO36118.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C5]
          Length = 523

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 51/87 (58%), Gaps = 3/87 (3%)

Query: 10  IKIQEIN-FDVDIG-RLMICIV-NADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I  +EIN + +DI     ICI+ + D  G+V  VG +LGE+GINIA   +GR +   H+I
Sbjct: 433 IVFREINGYRMDIKPEGTICIIKHIDRPGMVGKVGVLLGEHGINIAGMQVGRREPGGHSI 492

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVK 93
            FL +D  I + V+ +++    +R  K
Sbjct: 493 MFLDVDHMISDEVMAEITKMENVRAAK 519


>gi|312880178|ref|ZP_07739978.1| D-3-phosphoglycerate dehydrogenase [Aminomonas paucivorans DSM
           12260]
 gi|310783469|gb|EFQ23867.1| D-3-phosphoglycerate dehydrogenase [Aminomonas paucivorans DSM
           12260]
          Length = 549

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 2/84 (2%)

Query: 1   VFSDGKPRFIKIQEINFD-VDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           V  +G+ R +++ +   D +  GRL++   N D  G++  VG +LG+ G+NIA+F LGR 
Sbjct: 449 VTEEGRQRVVRLDDYWLDLIPSGRLLL-FQNHDRPGVIGKVGTLLGQAGVNIANFALGRK 507

Query: 60  QSTEHAISFLCIDGSILNSVLEKL 83
             +  A++ L ID  +   +L  L
Sbjct: 508 NGSGLALAALQIDQELGEELLSTL 531


>gi|329727877|gb|EGG64327.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU144]
          Length = 531

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   P  ++I + + D    +  +   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VFAGFGPSIVRINDYSLDFKPNQYQLVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRND 492

Query: 61  STEHAISFLCID 72
           +   A+  L ID
Sbjct: 493 AGGDALMILSID 504


>gi|148265877|ref|YP_001232583.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
 gi|146399377|gb|ABQ28010.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
          Length = 539

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 46/90 (51%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++   D      M+ +   D  G++  +G ILG   INIA  +LGR +   
Sbjct: 435 EGAPRIVRLRDYAMDFSPEGHMLLLNYIDRPGMIGRIGTILGTRDINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
            A+  L +D ++   V+E+L       F++
Sbjct: 495 EAMVILSLDSAVPPDVVEELRNATNATFIR 524


>gi|330684332|gb|EGG96064.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU121]
          Length = 531

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I   + D    +  I   + D  GIV   GN+LG  GINI    LGR+     A+
Sbjct: 439 PRIVRINNFSLDFKPSQYQIVTCHNDQPGIVGKTGNLLGNKGINIGSMTLGRTNEGGQAL 498

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVK 93
             L ID    ++++ +L  N  I F K
Sbjct: 499 MILSIDQPASHALVAEL--NNAIPFNK 523


>gi|225849496|ref|YP_002729661.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643873|gb|ACN98923.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 529

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 45/82 (54%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F D  PR + +     D++   +++   N D+ G++  +G IL  + INIA F LGR + 
Sbjct: 434 FYDKLPRIMLVDNYWIDIEPSGVILMFENKDVPGVIGKLGTILARHNINIAGFRLGRLEK 493

Query: 62  TEHAISFLCIDGSILNSVLEKL 83
            + A+  L +D  +  +VLE++
Sbjct: 494 GKIALGALQLDDKLNEAVLEEI 515


>gi|317969029|ref|ZP_07970419.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CB0205]
          Length = 528

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E    V   + M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTTIDEFPVSVTPSKHMLFTRHRDMPGIIGHIGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCID 72
               A+  L +D
Sbjct: 492 VRGDAVMVLSLD 503


>gi|206602883|gb|EDZ39364.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum sp. Group II
           '5-way CG']
          Length = 535

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 45/83 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF     R + + ++  +V    +MI ++N D  G+V  VG +LG + +NI+    GR  
Sbjct: 434 VFQRKDYRIVSLDDLPVEVVPEPIMIYLINQDQPGVVGSVGTVLGTHKVNISRMQFGRDF 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+S + +D +I + +LE+L
Sbjct: 494 PGGKAVSMIGVDQNIDSKLLEEL 516


>gi|149176983|ref|ZP_01855592.1| phosphoglycerate dehydrogenase [Planctomyces maris DSM 8797]
 gi|148844238|gb|EDL58592.1| phosphoglycerate dehydrogenase [Planctomyces maris DSM 8797]
          Length = 541

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 50/95 (52%), Gaps = 2/95 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R  ++ E   D  +   ++   + D+ G++ ++G +LG + +NIAH  LGR Q
Sbjct: 432 IFGQDFLRLTRLDEFYLDGYLDGNLLIYRHNDVPGLIGYIGTVLGNHNVNIAHMALGRLQ 491

Query: 61  STE--HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
           +     AI+ L +DG +  + + ++S +  +  VK
Sbjct: 492 NQPGGEAIAVLNVDGEVPEAAIAEVSSHKDVSCVK 526


>gi|159903950|ref|YP_001551294.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9211]
 gi|159889126|gb|ABX09340.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9211]
          Length = 528

 Score = 46.2 bits (108), Expect = 0.001,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 4/90 (4%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 432 VFADGDLRITCIDEFPVNVAPSRHMLFTRHRDMPGIIGKIGSLLGVHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSI----LNSVLEKLSVN 86
               A+  L ID  I    L S+L+   +N
Sbjct: 492 VRGEAVMVLSIDDPIPSELLKSILQIQGIN 521


>gi|317011252|gb|ADU84999.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           SouthAfrica7]
          Length = 524

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN+   +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNVFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|296109202|ref|YP_003616151.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus infernus ME]
 gi|295434016|gb|ADG13187.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus infernus ME]
          Length = 523

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/83 (33%), Positives = 50/83 (60%), Gaps = 4/83 (4%)

Query: 3   SDGKPRFIKIQ--EINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           S+ KP  ++I+  E+NF  +   +++ I + D  G++  VG ILGEYGINIA   +GR +
Sbjct: 429 SNNKPIILEIEGYEVNFIPE--SVVLIIRHIDKPGMIGKVGTILGEYGINIAEMQVGRKE 486

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               ++  + +D ++   VL+K+
Sbjct: 487 PGGDSVMLIKLDHNVPEEVLKKI 509


>gi|117927917|ref|YP_872468.1| D-3-phosphoglycerate dehydrogenase [Acidothermus cellulolyticus
           11B]
 gi|117648380|gb|ABK52482.1| D-3-phosphoglycerate dehydrogenase [Acidothermus cellulolyticus
           11B]
          Length = 530

 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 42/76 (55%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + +KI + + D+ +   +      D  GIV  +G ILGE+GINIA   + R     HA+ 
Sbjct: 438 KLVKIDDFDVDLTLSEHLGFFRYEDRPGIVGILGRILGEHGINIAGMQVARDVKGGHALI 497

Query: 68  FLCIDGSILNSVLEKL 83
            L +D +I ++V+E +
Sbjct: 498 ALTVDSAIPDTVVETV 513


>gi|109947057|ref|YP_664285.1| D-3-phosphoglycerate dehydrogenase [Helicobacter acinonychis str.
           Sheeba]
 gi|109714278|emb|CAJ99286.1| D-3-phosphoglycerate dehydrogenase [Helicobacter acinonychis str.
           Sheeba]
          Length = 524

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN+   +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNVFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|304317984|ref|YP_003853129.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779486|gb|ADL70045.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 533

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 13  QEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCID 72
             +NF+      M+ + N DI G++  +GN+LG++GINIA  H+  +++   A+  +  D
Sbjct: 449 HRVNFEPT--EYMLFVRNKDIPGVIGHIGNVLGDFGINIASMHVSPNKNDGTALMIVNTD 506

Query: 73  GSILNSVLEKLS 84
             I N  +E L+
Sbjct: 507 REIPNEAVESLN 518


>gi|322368216|ref|ZP_08042785.1| D-3-phosphoglycerate dehydrogenase [Haladaptatus paucihalophilus
           DX253]
 gi|320552232|gb|EFW93877.1| D-3-phosphoglycerate dehydrogenase [Haladaptatus paucihalophilus
           DX253]
          Length = 527

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 43/98 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+D  PR ++I     D      M+   N D  G++ F+G +LGE+  NIA     R  
Sbjct: 428 LFADDDPRIVRIDGYRVDAIPHGHMLVARNQDKPGVIGFIGTVLGEHDTNIAGMFNARET 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A+S   +D  +  +  E L  +  I  V+    N
Sbjct: 488 DGGEALSVYNLDSEVSTAAKEALEADERIIEVRNIALN 525


>gi|296272027|ref|YP_003654658.1| D-3-phosphoglycerate dehydrogenase [Arcobacter nitrofigilis DSM
           7299]
 gi|296096202|gb|ADG92152.1| D-3-phosphoglycerate dehydrogenase [Arcobacter nitrofigilis DSM
           7299]
          Length = 527

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 52/96 (54%), Gaps = 5/96 (5%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   R +++    FD+     MI + N+DI G++  VG  LG+  INIA F L R +
Sbjct: 433 VFDEDVQRIVEVNGFVFDIAPKGNMIFLRNSDIPGVIGTVGKTLGDNNINIADFRLSRGK 492

Query: 61  STEHAISFLCIDGSILNSV---LEKLSVNVTIRFVK 93
            +  A++ + +D  + + V   LE L   +++ +V+
Sbjct: 493 DS--ALAVILVDTFVSHDVLKQLENLEAAISVSYVE 526


>gi|319790479|ref|YP_004152112.1| D-3-phosphoglycerate dehydrogenase [Thermovibrio ammonificans HB-1]
 gi|317114981|gb|ADU97471.1| D-3-phosphoglycerate dehydrogenase [Thermovibrio ammonificans HB-1]
          Length = 533

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 8   RFIKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           +F KI EIN   FD+     ++ I N D+ G++  +G+ILG++ +NIA F LGR +  + 
Sbjct: 441 KFPKIVEINGFLFDLTPEGKLLLIKNYDVPGVIGKLGSILGKHRVNIAGFQLGRKEKGKE 500

Query: 65  AISFLCIDGSI 75
           A   + ID  +
Sbjct: 501 AKGVILIDDDV 511


>gi|15614165|ref|NP_242468.1| D-3-phosphoglycerate dehydrogenase [Bacillus halodurans C-125]
 gi|10174219|dbj|BAB05321.1| D-3-phosphoglycerate dehydrogenase [Bacillus halodurans C-125]
          Length = 540

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 43/91 (47%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR +KI   N D      +I I + D  G++  +G +L E+ +NIA   +GR +    AI
Sbjct: 450 PRIVKINGFNVDFVPEGHLIYIQHNDRPGVIGKMGQLLAEHNVNIATMQVGRQEEGGDAI 509

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + +D    + V+E L     I F  + E 
Sbjct: 510 MMVAVDKVATDEVIEALKAVDEIHFADRIEL 540


>gi|302142267|emb|CBI19470.3| unnamed protein product [Vitis vinifera]
          Length = 532

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 38/69 (55%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DGKP   K+     DV +   +I + + D  GI+  VG+ILGE  +N++   +GR+   +
Sbjct: 439 DGKPHLTKVGSFGVDVSLEGSLILLRHVDQPGIIGKVGSILGEENVNVSFMSVGRTAPRK 498

Query: 64  HAISFLCID 72
            A+  + +D
Sbjct: 499 QAVMTIGVD 507


>gi|225849892|ref|YP_002730126.1| D-3-phosphoglycerate dehydrogenase [Persephonella marina EX-H1]
 gi|225646129|gb|ACO04315.1| phosphoglycerate dehydrogenase [Persephonella marina EX-H1]
          Length = 529

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 43/77 (55%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           P+ + I     D+D   +++   N D+ G++  +G IL  + INIA F LGR +  + A+
Sbjct: 439 PKIMLIDRYWIDIDPEGVILVFENKDVPGVIAKLGEILARHNINIAGFRLGRLEKGKIAL 498

Query: 67  SFLCIDGSILNSVLEKL 83
             L +D  I  ++LE++
Sbjct: 499 GALQLDERINEAILEEI 515


>gi|225458719|ref|XP_002283022.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 605

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 38/69 (55%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DGKP   K+     DV +   +I + + D  GI+  VG+ILGE  +N++   +GR+   +
Sbjct: 512 DGKPHLTKVGSFGVDVSLEGSLILLRHVDQPGIIGKVGSILGEENVNVSFMSVGRTAPRK 571

Query: 64  HAISFLCID 72
            A+  + +D
Sbjct: 572 QAVMTIGVD 580


>gi|282861276|ref|ZP_06270341.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. ACTE]
 gi|282563934|gb|EFB69471.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. ACTE]
          Length = 530

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R  +   A+ 
Sbjct: 439 KIVAIGEHDVDLALADHMVVLRYEDRPGVVGAVGKILGEAGLNIAGMQVSRQDAGGEALV 498

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D +I  SVL +++
Sbjct: 499 VLTVDDTIPQSVLSEIA 515


>gi|260434318|ref|ZP_05788288.1| phosphoglycerate dehydrogenase [Synechococcus sp. WH 8109]
 gi|260412192|gb|EEX05488.1| phosphoglycerate dehydrogenase [Synechococcus sp. WH 8109]
          Length = 528

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 43/84 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I     +V     M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRITSIDAFPVNVTPSSHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               A+  L ID  I   +L+ ++
Sbjct: 492 VRGDAVMVLSIDDPIPADLLQTIT 515


>gi|78213665|ref|YP_382444.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9605]
 gi|78198124|gb|ABB35889.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9605]
          Length = 528

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 43/84 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I     +V     M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRITSIDAFPVNVTPSSHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               A+  L ID  I   +L+ ++
Sbjct: 492 VRGDAVMVLSIDDPIPADLLQTIT 515


>gi|317178639|dbj|BAJ56427.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F30]
          Length = 524

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A+S + +D
Sbjct: 489 QKE-ALSLIIVD 499


>gi|268679255|ref|YP_003303686.1| D-3-phosphoglycerate dehydrogenase [Sulfurospirillum deleyianum DSM
           6946]
 gi|268617286|gb|ACZ11651.1| D-3-phosphoglycerate dehydrogenase [Sulfurospirillum deleyianum DSM
           6946]
          Length = 528

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + I    FD      MI   N D+ G++  + +IL + GINIA F LGR  
Sbjct: 433 VFGEDEQRIVGINGFKFDFKPKGKMIIFKNNDVPGVIANITSILAKEGINIADFRLGRG- 491

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
           + + A++ + +D  I   ++ +L+
Sbjct: 492 AHQFAMAVILVDTDIDKKIITELN 515


>gi|304319942|ref|YP_003853585.1| putative phosphoglycerate dehydrogenase [Parvularcula bermudensis
           HTCC2503]
 gi|303298845|gb|ADM08444.1| putative phosphoglycerate dehydrogenase [Parvularcula bermudensis
           HTCC2503]
          Length = 527

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+PR ++I  +  + +    M+ + N D  G +  +G +L    INIA F+LGR+     
Sbjct: 435 GEPRAVRIGNVRLESNFAPHMLYVQNKDKPGFIGNLGKLLSSKDINIATFNLGRAAPGGT 494

Query: 65  AISFLCIDGSILNSVLEKLS 84
           A + L +D  + +  L+ LS
Sbjct: 495 AYALLAVDQPLDDDTLKALS 514


>gi|302554336|ref|ZP_07306678.1| phosphoglycerate dehydrogenase [Streptomyces viridochromogenes DSM
           40736]
 gi|302471954|gb|EFL35047.1| phosphoglycerate dehydrogenase [Streptomyces viridochromogenes DSM
           40736]
          Length = 529

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 44/80 (55%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +   D  G+V  VG ILGE GINIA   + R+ +   A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLRYEDRPGVVGTVGRILGEAGINIAGMQVSRAVAGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNV 87
            L +D ++   VL +++  +
Sbjct: 499 VLTVDDTVTPGVLAEVAAEI 518


>gi|320105785|ref|YP_004181375.1| D-3-phosphoglycerate dehydrogenase [Terriglobus saanensis SP1PR4]
 gi|319924306|gb|ADV81381.1| D-3-phosphoglycerate dehydrogenase [Terriglobus saanensis SP1PR4]
          Length = 537

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 30/104 (28%), Positives = 54/104 (51%), Gaps = 11/104 (10%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V     PR +    I+ +  +   ++ I N D+ G++  +G ILGE  +N+A+F LGR+ 
Sbjct: 428 VLHGNSPRLLSYDGIDIEAPLTGTLLSIRNQDVPGVIGRIGTILGEQKVNVANFALGRNV 487

Query: 61  STE-----HAISFLCID---GSILNSVLE---KLSVNVTIRFVK 93
            ++      A++ + ID    +   SVLE   K+   V++R V+
Sbjct: 488 RSQRVPQGQALAVVQIDLPAAAKAQSVLEALRKVEAIVSVRLVE 531


>gi|290957185|ref|YP_003488367.1| D-3-phosphoglycerate dehydrogenase [Streptomyces scabiei 87.22]
 gi|260646711|emb|CBG69808.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces scabiei
           87.22]
          Length = 529

 Score = 45.4 bits (106), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 43/80 (53%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +   D  G+V  VG + GE GINIA   + RS +   A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLSYVDRPGVVGTVGRVFGEAGINIAGMQVARSTAGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNV 87
            L +D ++  +VL ++   +
Sbjct: 499 VLTVDDTVPPAVLAEVEAEI 518


>gi|182435790|ref|YP_001823509.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326776414|ref|ZP_08235679.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
 gi|178464306|dbj|BAG18826.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|326656747|gb|EGE41593.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 530

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R+     A+ 
Sbjct: 439 KIVAIGEHDVDLALADHMVVLRYQDRPGVVGAVGKILGEAGLNIAGMQVSRAAEGGEALV 498

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D ++  SVL ++S
Sbjct: 499 VLTVDETVPQSVLTEIS 515


>gi|320008407|gb|ADW03257.1| D-3-phosphoglycerate dehydrogenase [Streptomyces flavogriseus ATCC
           33331]
          Length = 530

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R  +   A+ 
Sbjct: 439 KIVAIGEHDVDLALADHMVVLRYEDRPGVVGAVGKILGEAGLNIAGMQVSRQDAGGEALV 498

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D +I  SVL +++
Sbjct: 499 VLTVDDTIPQSVLTEIA 515


>gi|124514290|gb|EAY55804.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum rubarum]
          Length = 535

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 25/83 (30%), Positives = 44/83 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF     R + + ++  +V    +MI ++N D  G+V  VG +LG + +NI+    GR  
Sbjct: 434 VFQRKDYRIVSLDDLPVEVVPEPIMIYLINQDQPGVVGSVGTVLGTHKVNISRMQFGRDF 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+S + +D +I   +LE+L
Sbjct: 494 PGGKAVSMIGVDQNIDAKLLEEL 516


>gi|228474509|ref|ZP_04059242.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus hominis SK119]
 gi|228271538|gb|EEK12900.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus hominis SK119]
          Length = 869

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I + + D           + D+ G+V   G +LG++ INIA   LGRS     A+ 
Sbjct: 778 RIVRINDYSVDFKPNTYQFISYHKDLPGMVGLTGQLLGKHDINIASMSLGRSSEGGQAMM 837

Query: 68  FLCIDGSILNSVLEKL 83
            L ID  I   V+++L
Sbjct: 838 ILSIDQPITQQVIKEL 853


>gi|299136357|ref|ZP_07029541.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX8]
 gi|298602481|gb|EFI58635.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX8]
          Length = 540

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 33/53 (62%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           PR +    I+ + ++   ++ I N D+ G++  +G ILGE  +NIA+F LGRS
Sbjct: 440 PRLLSYDGIDVEAELTGTLVVIRNQDVPGVIGRIGTILGEAKLNIANFALGRS 492


>gi|239637958|ref|ZP_04678919.1| phosphoglycerate dehydrogenase [Staphylococcus warneri L37603]
 gi|239596521|gb|EEQ79057.1| phosphoglycerate dehydrogenase [Staphylococcus warneri L37603]
          Length = 531

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I   + D    +  I   + D  GIV   GN+LG+ GINI    LGR+     A+
Sbjct: 439 PRIVRINNFSLDFKPNQYQIVTCHNDQPGIVGKTGNLLGDNGINIGSMTLGRTIEGGQAL 498

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVK 93
             L ID     +++ +L  N  I F K
Sbjct: 499 MILSIDQPASQTLVTEL--NNAIPFNK 523


>gi|294631551|ref|ZP_06710111.1| phosphoglycerate dehydrogenase [Streptomyces sp. e14]
 gi|292834884|gb|EFF93233.1| phosphoglycerate dehydrogenase [Streptomyces sp. e14]
          Length = 529

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 44/80 (55%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +   D  G+V  VG I+GE G+NIA   + R+     A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLRYEDRPGVVGTVGRIIGEAGVNIAGMQVARAAVGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNV 87
            L +D ++  +VL ++S  +
Sbjct: 499 VLTVDDTVPPAVLSEVSAEI 518


>gi|317050557|ref|YP_004111673.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
 gi|316945641|gb|ADU65117.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
          Length = 544

 Score = 45.1 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 43/84 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   R I++ E + D +    M+   N D  G++  V  +LGE GINI+HF L R  
Sbjct: 447 VFENAMARVIRLDEYDVDFNPEAPMLIFKNQDRNGLIGEVATLLGEAGINISHFALNRHP 506

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
             E A+  +    ++   +L +L+
Sbjct: 507 RGETALGVVNTGVAVSAELLTRLN 530


>gi|159905466|ref|YP_001549128.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C6]
 gi|159886959|gb|ABX01896.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C6]
          Length = 523

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 50/87 (57%), Gaps = 3/87 (3%)

Query: 10  IKIQEIN-FDVDIG-RLMICIV-NADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I  +EIN + +DI     ICI+ + D  G+V  VG +LGE+GINIA   +GR +   H+I
Sbjct: 433 IVFREINGYRMDIKPEGTICIIKHIDRPGMVGKVGVLLGEHGINIAGMQVGRREPGGHSI 492

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVK 93
            FL +D  I + V+ ++     +R  K
Sbjct: 493 MFLDVDHMISDDVMAEIMKIENVRAAK 519


>gi|308177181|ref|YP_003916587.1| phosphoglycerate dehydrogenase [Arthrobacter arilaitensis Re117]
 gi|307744644|emb|CBT75616.1| phosphoglycerate dehydrogenase [Arthrobacter arilaitensis Re117]
          Length = 531

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 40/74 (54%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I     ++ I   MI +  AD  G+V  +GN+LGE G+NIA   + R +    A++
Sbjct: 440 KLVGINGHEIEIPISDHMIVVRYADRPGVVGSLGNVLGEQGVNIAGMQVSRDEKKAEALA 499

Query: 68  FLCIDGSILNSVLE 81
            + ID ++   VL+
Sbjct: 500 VINIDSALPQGVLD 513


>gi|33240885|ref|NP_875827.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
 gi|33238414|gb|AAQ00480.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 528

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 43/83 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +DG+ R   I E   +V   R M+   + D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 432 VLADGELRISSIDEFPINVSPSRYMLFTRHRDMPGIIGKLGSLLGTHNVNIAAMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+  L ID  I + +L  +
Sbjct: 492 VRGEAVMVLSIDDPIPSELLTSI 514


>gi|239928756|ref|ZP_04685709.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
 gi|291437078|ref|ZP_06576468.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
 gi|291339973|gb|EFE66929.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
          Length = 529

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 44/80 (55%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + + + D+ +   M+ +   D  G+V  VG ILGE GINIA   + R+     A++
Sbjct: 439 KIVAVGDYDVDLALADHMVVLRYEDRPGVVGTVGRILGEAGINIAGMQVARAAVGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNV 87
            L +D ++  +VL +L+  +
Sbjct: 499 VLTVDDTVSAAVLGELAAEI 518


>gi|15645025|ref|NP_207195.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 26695]
 gi|2313497|gb|AAD07461.1| phosphoglycerate dehydrogenase (serA) [Helicobacter pylori 26695]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|224063477|ref|XP_002301163.1| predicted protein [Populus trichocarpa]
 gi|222842889|gb|EEE80436.1| predicted protein [Populus trichocarpa]
          Length = 598

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DGKP   K+     DV + G L++C    D  G++  VGNILGE  +N+    +GR    
Sbjct: 505 DGKPHLTKVGSFGVDVSMEGSLVLC-RQVDQPGMIGSVGNILGEENVNVNFMSVGRIAPR 563

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + A+  + +D       L+++     I  V++F F
Sbjct: 564 KQAVMIIGVDEEPSKEALKRIG---EIPAVEEFVF 595


>gi|325997911|gb|ADZ50119.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 2017]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|317014441|gb|ADU81877.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           Gambia94/24]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|313125075|ref|YP_004035339.1| d-3-phosphoglycerate dehydrogenase [Halogeometricum borinquense DSM
           11551]
 gi|312291440|gb|ADQ65900.1| D-3-phosphoglycerate dehydrogenase [Halogeometricum borinquense DSM
           11551]
          Length = 534

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 31/99 (31%), Positives = 46/99 (46%), Gaps = 1/99 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIA-HFHLGRS 59
           +F+   PR ++I     D      M+   N D  G++ F+G +LGE  +NIA  F+  RS
Sbjct: 432 LFAGEDPRIVRIDGYRVDAIPHGQMLVARNYDKPGVIGFIGTVLGENDVNIAGMFNARRS 491

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
                A++   +D  I   V EKL  +  I  VK    N
Sbjct: 492 ADGGEALTVYNLDDPIPEEVSEKLLADERITDVKYLTLN 530


>gi|307637719|gb|ADN80169.1| D-3-phospho glycerate dehydrogenase [Helicobacter pylori 908]
 gi|325996322|gb|ADZ51727.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 2018]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|297380233|gb|ADI35120.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori v225d]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|217034326|ref|ZP_03439742.1| hypothetical protein HP9810_491g19 [Helicobacter pylori 98-10]
 gi|216943211|gb|EEC22678.1| hypothetical protein HP9810_491g19 [Helicobacter pylori 98-10]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|210135216|ref|YP_002301655.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori P12]
 gi|210133184|gb|ACJ08175.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori P12]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|207092309|ref|ZP_03240096.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|317177807|dbj|BAJ55596.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F16]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|314936177|ref|ZP_07843524.1| phosphoglycerate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
 gi|313654796|gb|EFS18541.1| phosphoglycerate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 531

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I + + D           + D+ G+V   G +LG++ INIA   LGRS     A+ 
Sbjct: 440 RIVRINDYSVDFKPNTYQFISYHKDLPGMVGLTGQLLGKHDINIASMSLGRSSEGGQAMM 499

Query: 68  FLCIDGSILNSVLEKL 83
            L ID  I   V+++L
Sbjct: 500 ILSIDQPITQQVIKEL 515


>gi|261838390|gb|ACX98156.1| 3-phosphoglycerate dehydrogenase [Helicobacter pylori 51]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|254779611|ref|YP_003057717.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori B38]
 gi|254001523|emb|CAX29541.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Helicobacter pylori B38]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|15612049|ref|NP_223701.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori J99]
 gi|4155559|gb|AAD06553.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Helicobacter pylori J99]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|317012830|gb|ADU83438.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           Lithuania75]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|308184795|ref|YP_003928928.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori SJM180]
 gi|308060715|gb|ADO02611.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori SJM180]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|291279254|ref|YP_003496089.1| D-3-phosphoglycerate dehydrogenase [Deferribacter desulfuricans
           SSM1]
 gi|290753956|dbj|BAI80333.1| D-3-phosphoglycerate dehydrogenase [Deferribacter desulfuricans
           SSM1]
          Length = 540

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 44/84 (52%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R +   +   D+      +   N D  G++  VG ILGE  INIA F L R +
Sbjct: 445 VFNNKEGRIVLFDDFRIDIIPEGTFLYFRNIDRPGVIGKVGTILGENNINIAGFELARQK 504

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
             E AI+F+ +D  I  SVL ++ 
Sbjct: 505 GGE-AIAFVSVDNEIPESVLSEIK 527


>gi|168002445|ref|XP_001753924.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162694900|gb|EDQ81246.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 523

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+ +   DV +   +I     D  G++  VG+ILG+  +NI+   +GR    +
Sbjct: 430 DGVPYLSKVGDFGVDVSLEDSIILCRQVDQPGMIGKVGSILGQENVNISFMSVGRKSPRQ 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           HA+  + +D       L+KL     I  V++F F
Sbjct: 490 HAVMAIGVDEEPSKVTLQKLG---DIPAVEEFVF 520


>gi|118474999|ref|YP_892404.1| D-3-phosphoglycerate dehydrogenase [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118414225|gb|ABK82645.1| D-3-phosphoglycerate dehydrogenase [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 525

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + +     D      MI   N D+ G++  + +IL E  INIA F LGR  
Sbjct: 430 VFGETEQRIVNVNGFKTDFKPKGRMIVFKNTDVPGVISSISSILAEEKINIADFRLGRDD 489

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
           +   A++ + +D  I   +L KL+
Sbjct: 490 NG-FALAVILVDDDIKKDILAKLN 512


>gi|108563420|ref|YP_627736.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori HPAG1]
 gi|107837193|gb|ABF85062.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori HPAG1]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|317009666|gb|ADU80246.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori India7]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|188527838|ref|YP_001910525.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Shi470]
 gi|188144078|gb|ACD48495.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Shi470]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|308183160|ref|YP_003927287.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori PeCan4]
 gi|308065345|gb|ADO07237.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori PeCan4]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|254458447|ref|ZP_05071872.1| phosphoglycerate dehydrogenase [Campylobacterales bacterium GD 1]
 gi|207084755|gb|EDZ62042.1| phosphoglycerate dehydrogenase [Campylobacterales bacterium GD 1]
          Length = 528

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 46/84 (54%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F DG  R + I   + +V +   MI   N+D+ G++  +G+ L    +NI+ F L R++
Sbjct: 433 IFDDGVKRIVAIDGFDIEVALKGDMILFKNSDVPGVIGSIGSTLARNNVNISDFSLARNK 492

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
             E A++ + +D ++  + L  L+
Sbjct: 493 DAE-ALAVILVDNAVNEATLNALA 515


>gi|315586946|gb|ADU41327.1| possible phosphoglycerate dehydrogenase [Helicobacter pylori 35A]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|308062332|gb|ADO04220.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Cuz20]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|294501109|ref|YP_003564809.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium QM B1551]
 gi|294351046|gb|ADE71375.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium QM B1551]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 44/91 (48%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR I I   + D      ++ I ++D  G++  VG +LG+  INIA   +GR Q    AI
Sbjct: 434 PRIINIDSFDIDFYPEGHLLYIRHSDQPGVIGNVGKVLGDLRINIATMQVGRKQKGGEAI 493

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             L  D  + +SV+  L     I  +++ E 
Sbjct: 494 MMLTFDKLLDDSVISSLKQTSEIVTIQRIEL 524


>gi|217032273|ref|ZP_03437770.1| hypothetical protein HPB128_142g21 [Helicobacter pylori B128]
 gi|298735944|ref|YP_003728469.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori B8]
 gi|216946039|gb|EEC24652.1| hypothetical protein HPB128_142g21 [Helicobacter pylori B128]
 gi|298355133|emb|CBI66005.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori B8]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|261839790|gb|ACX99555.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 52]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|317180143|dbj|BAJ57929.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F32]
          Length = 524

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|95928509|ref|ZP_01311256.1| D-3-phosphoglycerate dehydrogenase [Desulfuromonas acetoxidans DSM
           684]
 gi|95135299|gb|EAT16951.1| D-3-phosphoglycerate dehydrogenase [Desulfuromonas acetoxidans DSM
           684]
          Length = 528

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 45/83 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F++ + R I + +   +      ++ + N D  G++  +G +L E  IN+A  +L R +
Sbjct: 431 IFNNRECRIIGVDDYAIETIPSGHLLVVRNLDRPGVIALLGRLLAEAEINVAMMNLSRQK 490

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           ST  A+S + +D  I   V+E+L
Sbjct: 491 STGDAMSLVTVDHKIPEQVMEEL 513


>gi|78777073|ref|YP_393388.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas denitrificans DSM
           1251]
 gi|78497613|gb|ABB44153.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas denitrificans DSM
           1251]
          Length = 529

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F D   R + I   + +V +   MI + N D+ G++  +G+ L ++ +NIA F L R+ 
Sbjct: 434 IFDDNVFRIVSIDGFDIEVALKGDMIILKNQDVPGVIGNIGSTLAKHNVNIADFSLARND 493

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
             + A++ + +D  I +  LE+L
Sbjct: 494 K-KQALAVILVDNVISDDTLEEL 515


>gi|153952246|ref|YP_001398036.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939692|gb|ABS44433.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 527

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKIDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRD- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           S  +A++ + ID  +   VL++L       FV+  E
Sbjct: 491 SFGYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|90399366|emb|CAH68268.1| H0212B02.14 [Oryza sativa Indica Group]
 gi|116311962|emb|CAJ86321.1| OSIGBa0113E10.4 [Oryza sativa Indica Group]
          Length = 613

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG P   K+     DV + G L++C    D  G++  VG++LGE  +N++   +GR    
Sbjct: 520 DGIPHLTKVGSFQVDVSLEGSLILC-RQVDQPGMIGAVGSVLGEENVNVSFMSVGRIAPR 578

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +HA+  + +D     S L K+     I  +++F F
Sbjct: 579 KHAVMAIGVDEEPKKSTLTKIG---EIPAIEEFVF 610


>gi|115460988|ref|NP_001054094.1| Os04g0650800 [Oryza sativa Japonica Group]
 gi|32488924|emb|CAE04505.1| OSJNBb0059K02.15 [Oryza sativa Japonica Group]
 gi|113565665|dbj|BAF16008.1| Os04g0650800 [Oryza sativa Japonica Group]
 gi|125550010|gb|EAY95832.1| hypothetical protein OsI_17701 [Oryza sativa Indica Group]
 gi|215768007|dbj|BAH00236.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 613

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG P   K+     DV + G L++C    D  G++  VG++LGE  +N++   +GR    
Sbjct: 520 DGIPHLTKVGSFQVDVSLEGSLILC-RQVDQPGMIGAVGSVLGEENVNVSFMSVGRIAPR 578

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +HA+  + +D     S L K+     I  +++F F
Sbjct: 579 KHAVMAIGVDEEPKKSTLTKIG---EIPAIEEFVF 610


>gi|300709559|ref|YP_003735373.1| D-3-phosphoglycerate dehydrogenase [Halalkalicoccus jeotgali B3]
 gi|299123242|gb|ADJ13581.1| D-3-phosphoglycerate dehydrogenase [Halalkalicoccus jeotgali B3]
          Length = 537

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 40/83 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+D  PR ++I +   D      M+   N D  G + F+G +LGE GINIA     R  
Sbjct: 431 LFADDDPRIVRIDDYRVDAIPHGHMLVARNYDEPGTIGFIGTVLGENGINIAGMFNAREA 490

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               AI+   +D  +   +L +L
Sbjct: 491 IGGEAITVYDLDEEVGEELLAQL 513


>gi|323359647|ref|YP_004226043.1| phosphoglycerate dehydrogenase [Microbacterium testaceum StLB037]
 gi|323276018|dbj|BAJ76163.1| phosphoglycerate dehydrogenase [Microbacterium testaceum StLB037]
          Length = 534

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 43/90 (47%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           P+ + I   + +V I +  + +  AD  GIV   G  LGE GINIA   +    +T  A+
Sbjct: 441 PKVVAINGYDIEVPIEQHHLVMRYADRPGIVAIYGQKLGEAGINIAGLQVAAPDATGRAL 500

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           S L +D  + + +L  +   V     +Q +
Sbjct: 501 SVLTVDSPVPDEILGAMREAVGADLFRQID 530


>gi|320170533|gb|EFW47432.1| D-3-phosphoglycerate dehydrogenase [Capsaspora owczarzaki ATCC
           30864]
          Length = 552

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 42/93 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF     RF +I +  F+V     ++   N D  G++  +G  L +  INIA   LGR  
Sbjct: 456 VFGTNNLRFTRIDQFAFEVRPAGHLMFYRNEDKPGVIAAIGTHLAQASINIADLTLGRDD 515

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
           S   A+  +  D  I   VL+++     I + +
Sbjct: 516 SKREALCIVNTDQPIPADVLQRIQQTSFITYAR 548


>gi|222629679|gb|EEE61811.1| hypothetical protein OsJ_16432 [Oryza sativa Japonica Group]
          Length = 544

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 48/95 (50%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG P   K+     DV + G L++C    D  G++  VG++LGE  +N++   +GR    
Sbjct: 451 DGIPHLTKVGSFQVDVSLEGSLILC-RQVDQPGMIGAVGSVLGEENVNVSFMSVGRIAPR 509

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +HA+  + +D     S L K+     I  +++F F
Sbjct: 510 KHAVMAIGVDEEPKKSTLTKIG---EIPAIEEFVF 541


>gi|222445984|ref|ZP_03608499.1| hypothetical protein METSMIALI_01632 [Methanobrevibacter smithii
           DSM 2375]
 gi|261349477|ref|ZP_05974894.1| phosphoglycerate dehydrogenase [Methanobrevibacter smithii DSM
           2374]
 gi|222435549|gb|EEE42714.1| hypothetical protein METSMIALI_01632 [Methanobrevibacter smithii
           DSM 2375]
 gi|288861840|gb|EFC94138.1| phosphoglycerate dehydrogenase [Methanobrevibacter smithii DSM
           2374]
          Length = 524

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 38/77 (49%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           P+ +K+ +   DV     M      D+ G +  +G  LGEYGINI    +GR +    AI
Sbjct: 434 PKILKVNDYWVDVKPEGHMFIAKYEDVPGSIGKIGTALGEYGINIGIMQVGRDEKGGRAI 493

Query: 67  SFLCIDGSILNSVLEKL 83
             L +D  I   V++K+
Sbjct: 494 MILTLDKEIPKEVIKKI 510


>gi|292657076|ref|YP_003536973.1| D-3-phosphoglycerate dehydrogenase [Haloferax volcanii DS2]
 gi|291370333|gb|ADE02560.1| D-3-phosphoglycerate dehydrogenase [Haloferax volcanii DS2]
          Length = 525

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 1/90 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIA-HFHLGRS 59
           +F+   PR ++I     D      M+   N D  G++ F+G +LGE  +NIA  F+  R+
Sbjct: 428 LFTGEDPRIVRINGYRLDAIPYGQMLVARNYDKPGVIGFIGTVLGENDVNIAGMFNARRA 487

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTI 89
           ++   A++   +D  +  SV EKL  +  I
Sbjct: 488 KAGGEALTVYNLDDDVPESVREKLLADARI 517


>gi|21223871|ref|NP_629650.1| D-3-phosphoglycerate dehydrogenase [Streptomyces coelicolor A3(2)]
 gi|256785031|ref|ZP_05523462.1| D-3-phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
 gi|289768924|ref|ZP_06528302.1| phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
 gi|4467266|emb|CAB37591.1| probable D-3-phosphoglycerate dehydrogenase [Streptomyces
           coelicolor A3(2)]
 gi|289699123|gb|EFD66552.1| phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
          Length = 529

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 44/80 (55%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG I+GE G+NIA   + R+     A++
Sbjct: 439 KIVAIGEYDVDLALADHMVVLRYEDRPGVVGTVGRIIGEAGLNIAGMQVARATVGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNV 87
            L +D ++ + VL +++  +
Sbjct: 499 VLTVDDTVPSGVLAEVAAEI 518


>gi|16330470|ref|NP_441198.1| D-3-phosphoglycerate dehydrogenase [Synechocystis sp. PCC 6803]
 gi|3122863|sp|P73821|SERA_SYNY3 RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|1652961|dbj|BAA17878.1| phosphoglycerate dehydrogenase [Synechocystis sp. PCC 6803]
          Length = 554

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 47/90 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S+G+ R   + E   +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 458 LLSNGEIRITDVDEFPINVPPNNYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 517

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               AI  L +D  + + +L +++    IR
Sbjct: 518 VRGDAIMALSLDDPLPDGLLSEITKVAGIR 547


>gi|254444984|ref|ZP_05058460.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobiae bacterium
           DG1235]
 gi|198259292|gb|EDY83600.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobiae bacterium
           DG1235]
          Length = 545

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 46/87 (52%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR + I     +V+    M+ I N+D LGIV  +G I+G+ G+NIA   L R++    A+
Sbjct: 455 PRIVSINGREVEVEPHGSMLVIANSDELGIVGKIGEIIGKDGVNIAAMSLSRNEVGGVAL 514

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVK 93
           +   +D  + ++ + ++     I+  K
Sbjct: 515 NIASLDSDLSDAAMAEIKAIEAIKQAK 541


>gi|237749847|ref|ZP_04580327.1| d-3-phosphoglycerate dehydrogenase [Helicobacter bilis ATCC 43879]
 gi|229374597|gb|EEO24988.1| d-3-phosphoglycerate dehydrogenase [Helicobacter bilis ATCC 43879]
          Length = 535

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS--QSTEHA 65
           RF  I     D++    MI + N D+ G++  +G+ + ++ +NIA F LGR    S  +A
Sbjct: 444 RFNNINGFGMDLEPNGNMILVRNTDVPGVIGSIGHTIAKHKVNIADFRLGRKTDSSERNA 503

Query: 66  ISFLCIDGSILNSVLEKL 83
           ++ + +D ++   +L+ L
Sbjct: 504 LALILVDSAVSTQLLDDL 521


>gi|295706456|ref|YP_003599531.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium DSM 319]
 gi|294804115|gb|ADF41181.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium DSM 319]
          Length = 524

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 6/94 (6%)

Query: 7   PRFIKIQEINFDVDI---GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           PR + I   +FD+D    G L+  I ++D  G++  VG +LG+  INIA   +GR Q   
Sbjct: 434 PRIVNID--SFDIDFYPEGHLLY-IRHSDQPGVIGNVGKVLGDLRINIATMQVGRKQKGG 490

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            AI  L  D  + +SV+  L     I  +++ E 
Sbjct: 491 EAIMMLTFDKLLDDSVIASLKQTSEIVTIQRIEL 524


>gi|56752495|ref|YP_173196.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           6301]
 gi|81300310|ref|YP_400518.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           7942]
 gi|56687454|dbj|BAD80676.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           6301]
 gi|81169191|gb|ABB57531.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           7942]
          Length = 546

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 43/84 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  DG+ R   + E   +V   R M+   + D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 450 LLGDGEIRITNVDEFPVNVPPSRYMLFTRHRDMPGIIGKIGSLLGSFNVNIASMQVGRRI 509

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               A+  L +D  +   +L +++
Sbjct: 510 VRGDAVMVLSLDDPLPEGILAEIT 533


>gi|239982472|ref|ZP_04704996.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
 gi|291454320|ref|ZP_06593710.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
 gi|291357269|gb|EFE84171.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
          Length = 533

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 42/77 (54%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG +LGE G+NI    + R+     A++
Sbjct: 442 KIVAIGEHDVDLSLADHMVVLRYEDRPGVVGTVGRVLGESGVNIGGMQVSRATVGGEALA 501

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D ++  +VL +L+
Sbjct: 502 VLTVDDTVSQAVLTELA 518


>gi|226312009|ref|YP_002771903.1| D-3-phosphoglycerate dehydrogenase [Brevibacillus brevis NBRC
           100599]
 gi|226094957|dbj|BAH43399.1| D-3-phosphoglycerate dehydrogenase [Brevibacillus brevis NBRC
           100599]
          Length = 527

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +KI +   DV     ++ I + D  G++  VG+ILGE  +NIA   +GR      AI 
Sbjct: 438 RIVKIDDFAIDVAPEGYLLYIHHNDRPGVIGRVGSILGENSVNIATMQVGRRDIGGDAIM 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  +   +L+ +     ++ V Q E 
Sbjct: 498 MLSVDKPLTPELLDTMGELAEVKSVTQIEL 527


>gi|220928617|ref|YP_002505526.1| D-3-phosphoglycerate dehydrogenase [Clostridium cellulolyticum H10]
 gi|219998945|gb|ACL75546.1| D-3-phosphoglycerate dehydrogenase [Clostridium cellulolyticum H10]
          Length = 535

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 42/83 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+  + R +       D +    ++ I N D+ GI+  +G ILG   INIA     R+ 
Sbjct: 439 VFAIQEIRVVDFFGYKLDFEPTPYVLAIQNVDVPGIIGQIGTILGASDINIAAMQWSRNH 498

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
             E A++F+ +D  +  +VLE L
Sbjct: 499 KGEKAVAFVSVDCEVPANVLELL 521


>gi|212638896|ref|YP_002315416.1| D-3-phosphoglycerate dehydrogenase [Anoxybacillus flavithermus WK1]
 gi|212560376|gb|ACJ33431.1| Phosphoglycerate dehydrogenase [Anoxybacillus flavithermus WK1]
          Length = 549

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 43/73 (58%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           ++ I + D  G++  VGNILG++ +NIA   +GR ++   AI  L +D  + ++++E L 
Sbjct: 452 LLYIQHHDKPGMIGKVGNILGDHQVNIATMQVGRQEAGGKAIMMLSLDKPLDDALVETLE 511

Query: 85  VNVTIRFVKQFEF 97
               I  VK+ E+
Sbjct: 512 QISDIDVVKRLEY 524


>gi|208434953|ref|YP_002266619.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori G27]
 gi|208432882|gb|ACI27753.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori G27]
          Length = 524

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEYILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|308063839|gb|ADO05726.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Sat464]
          Length = 524

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEYILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCID 72
             E A++ + +D
Sbjct: 489 QKE-ALALIIVD 499


>gi|329936828|ref|ZP_08286507.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoaurantiacus
           M045]
 gi|329303753|gb|EGG47637.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoaurantiacus
           M045]
          Length = 529

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 44/77 (57%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +  AD  G+V  +G +LGE GINIA   + R+ +   A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLRYADRPGVVGTLGRVLGEAGINIAGMQVSRAVAGGEALA 498

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D ++   V+ +L+
Sbjct: 499 VLTVDDTVPPHVVAELA 515


>gi|302558214|ref|ZP_07310556.1| phosphoglycerate dehydrogenase [Streptomyces griseoflavus Tu4000]
 gi|302475832|gb|EFL38925.1| phosphoglycerate dehydrogenase [Streptomyces griseoflavus Tu4000]
          Length = 529

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 42/77 (54%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG +LGE GINIA   + R+     A++
Sbjct: 439 KIVAIGEYDVDLALADHMVVLRYEDRPGVVGTVGRVLGEAGINIAGMQVARATVGGEALA 498

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D ++   V+ +L+
Sbjct: 499 VLTVDDTVSAGVIGELA 515


>gi|307705811|ref|ZP_07642654.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis SK597]
 gi|307620643|gb|EFN99736.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis SK597]
          Length = 223

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAGEKAI 193

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D    +  +EK+
Sbjct: 194 MIIEVDSRNCDEAIEKI 210


>gi|124026487|ref|YP_001015602.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL1A]
 gi|123961555|gb|ABM76338.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. NATL1A]
          Length = 528

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 4/90 (4%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DG      I E   +    R M+   + D+ GI+  +G++LG+Y +NIA   +GR  
Sbjct: 432 VFGDGDLGITSIDEYPINFVPSRHMLFTRHRDMPGIIGQIGSLLGKYNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSI----LNSVLEKLSVN 86
               A+  L ID  I    L S+L    +N
Sbjct: 492 VRGEAVMVLSIDDPIPSELLGSILSMQGIN 521


>gi|163784160|ref|ZP_02179098.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880568|gb|EDP74134.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 288

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR + I +   D++   +++   N D+ G++  VG +L  + INIA F LGR +  + A+
Sbjct: 198 PRIMLIDKYWIDIEPEGVILVFENKDVPGVIAKVGEVLARHSINIAGFRLGRIEKGKIAL 257

Query: 67  SFLCIDGSILNSV 79
             L +D   LN V
Sbjct: 258 GALQLDDK-LNKV 269


>gi|167998190|ref|XP_001751801.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162696899|gb|EDQ83236.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 630

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 41/81 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+   N DV +   +I     D  G++  VG+ILGE  +NIA   +GR+    
Sbjct: 537 DGVPHLSKVGNFNVDVSLEGSIIFYRQVDQPGMIGKVGSILGEENVNIAFMSVGRTLRGL 596

Query: 64  HAISFLCIDGSILNSVLEKLS 84
            AI  +  D  +  + ++KL+
Sbjct: 597 DAIVAIGTDEDLSKATIQKLA 617


>gi|149193714|ref|ZP_01870812.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Caminibacter mediatlanticus
           TB-2]
 gi|149135667|gb|EDM24145.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Caminibacter mediatlanticus
           TB-2]
          Length = 522

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +  PR ++ +  + + +    MI   N D+ G++  VG  L ++ INIA F LGR++  +
Sbjct: 430 ENHPRVVEFKGFDLEFEPKGKMIFFKNTDVPGVIGEVGMTLAKHNINIADFRLGRNKEGQ 489

Query: 64  HAISFLCIDGSILNSVLEKL 83
            A++ + +D  +   VL +L
Sbjct: 490 -AMAVIIVDNDVNEEVLNEL 508


>gi|298706859|emb|CBJ25823.1| Phosphoglycerate dehydrogenase / Phosphoserine aminotransferase
           [Ectocarpus siliculosus]
          Length = 965

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 29/87 (33%), Positives = 44/87 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R + +  +  D +    M+   N D  G++  V  ILG+ GINIA F LGR ++   A+S
Sbjct: 480 RVVDVDGLEIDFNPSGHMLMFNNPDSPGMLRAVAAILGDQGINIASFALGRVRTGGVAMS 539

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQ 94
            L +D      +LE++     IR V Q
Sbjct: 540 CLNLDTPCTEGMLEEIRKIPDIRNVVQ 566


>gi|72382765|ref|YP_292120.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL2A]
 gi|72002615|gb|AAZ58417.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL2A]
          Length = 528

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 4/90 (4%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DG      I E   +    R M+   + D+ GI+  +G++LG+Y +NIA   +GR  
Sbjct: 432 VFGDGDLGITSIDEYPINFVPSRHMLFTRHRDMPGIIGQIGSLLGKYNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSI----LNSVLEKLSVN 86
               A+  L ID  I    L S+L    +N
Sbjct: 492 VRGEAVMVLSIDDPIPSELLGSILSMQGIN 521


>gi|254412600|ref|ZP_05026373.1| D-3-phosphoglycerate dehydrogenase [Microcoleus chthonoplastes PCC
           7420]
 gi|196180335|gb|EDX75326.1| D-3-phosphoglycerate dehydrogenase [Microcoleus chthonoplastes PCC
           7420]
          Length = 527

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 45/90 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+     I E   +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 LLSDGEIHITSIDEFPINVPPSHHMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A+  L ID  +   +L +++    IR
Sbjct: 491 VRGDAVMVLSIDDPLPEGILTEITKVPGIR 520


>gi|147823108|emb|CAN68604.1| hypothetical protein VITISV_036580 [Vitis vinifera]
          Length = 610

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG PR   +   + DV + G L++C    D  G++  VGNILGE  +N++   +GR+   
Sbjct: 517 DGIPRLTCVGSFSVDVSLEGNLILC-RQVDQPGMIGRVGNILGECNVNVSFMSVGRTVKR 575

Query: 63  EHAISFLCIDGSILNSVLEKL 83
             AI  + +D       L+K+
Sbjct: 576 TRAIMAIGVDEEPXKDTLKKI 596


>gi|57167923|ref|ZP_00367063.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
 gi|57021045|gb|EAL57709.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
          Length = 527

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFQTDFKPKGKMIIFKNKDIPGVIAKISSVLASKNINIADFRLGRD- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VLE+L       FV+  E
Sbjct: 491 GFGYALAVVLIDEKVQKEVLEELRQLEACIFVQYVE 526


>gi|305432051|ref|ZP_07401218.1| phosphoglycerate dehydrogenase [Campylobacter coli JV20]
 gi|304445135|gb|EFM37781.1| phosphoglycerate dehydrogenase [Campylobacter coli JV20]
          Length = 527

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFQTDFKPKGKMIIFKNKDIPGVIAKISSVLASKNINIADFRLGRD- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VLE+L       FV+  E
Sbjct: 491 GFGYALAVVLIDEKVQKEVLEELRQLEACIFVQYVE 526


>gi|224100535|ref|XP_002311914.1| predicted protein [Populus trichocarpa]
 gi|222851734|gb|EEE89281.1| predicted protein [Populus trichocarpa]
          Length = 637

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           GKP   ++   + DV + G L++C    D  G++  VGNILGE  +N++   +GR+    
Sbjct: 545 GKPHLTRVGSFSVDVSLEGNLILC-RQVDQPGMIGQVGNILGEQNVNVSFMSVGRTVQRR 603

Query: 64  HAISFLCIDGSILNSVLEKL 83
            AI  + +D       L+K+
Sbjct: 604 KAIMAIGVDEEPNQETLKKI 623


>gi|315658015|ref|ZP_07910888.1| phosphoglycerate dehydrogenase [Staphylococcus lugdunensis M23590]
 gi|315496905|gb|EFU85227.1| phosphoglycerate dehydrogenase [Staphylococcus lugdunensis M23590]
          Length = 539

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 38/77 (49%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR I+I + + D       +   + D+ GIV   G +LG   INIA   LGR+     A+
Sbjct: 440 PRIIRINDFSVDFQPNAYQLITYHNDVPGIVGRTGALLGREQINIASMSLGRNTEGGQAM 499

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D  I + V++ L
Sbjct: 500 MIIAVDQPITDKVIQHL 516


>gi|331270622|ref|YP_004397114.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           BKT015925]
 gi|329127172|gb|AEB77117.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           BKT015925]
          Length = 530

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 40/81 (49%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           S+ + + ++IQ    DV     M+ + N D+ G++  VG I+G   IN+A   +GR    
Sbjct: 436 SNHEGKLVEIQGYEVDVKPSTHMLFVQNKDVPGVIGQVGTIIGMENINVATMQVGRKAKG 495

Query: 63  EHAISFLCIDGSILNSVLEKL 83
           E A+  L +D  +    L K 
Sbjct: 496 EIALMILNVDSEVAKESLNKF 516


>gi|289550521|ref|YP_003471425.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus lugdunensis
           HKU09-01]
 gi|289180053|gb|ADC87298.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus lugdunensis
           HKU09-01]
          Length = 539

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 38/77 (49%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR I+I + + D       +   + D+ GIV   G +LG   INIA   LGR+     A+
Sbjct: 440 PRIIRINDFSVDFQPNAYQLITYHNDVPGIVGRTGALLGREQINIASMSLGRNTEGGQAM 499

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D  I + V++ L
Sbjct: 500 MIIAVDQPITDKVIQHL 516


>gi|189219266|ref|YP_001939907.1| D-3-phosphoglycerate dehydrogenase [Methylacidiphilum infernorum
           V4]
 gi|189186124|gb|ACD83309.1| Phosphoglycerate dehydrogenase and ACT domains [Methylacidiphilum
           infernorum V4]
          Length = 531

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 25/65 (38%), Positives = 40/65 (61%), Gaps = 3/65 (4%)

Query: 11  KIQEINF---DVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           ++ ++NF   +  +  +++ + N D  GIV  VG ILGE+ INIA   L R+++ E AIS
Sbjct: 442 RLVQLNFNPIEASMEGILLLLENKDRPGIVGKVGTILGEHSINIAAMSLARAKAGEKAIS 501

Query: 68  FLCID 72
            L +D
Sbjct: 502 ILNLD 506


>gi|150391963|ref|YP_001322012.1| D-3-phosphoglycerate dehydrogenase [Alkaliphilus metalliredigens
           QYMF]
 gi|149951825|gb|ABR50353.1| D-3-phosphoglycerate dehydrogenase [Alkaliphilus metalliredigens
           QYMF]
          Length = 526

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 3/96 (3%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+    R + +    FDV     M+   N D  G++  +G++LGE  +NIA   + R  
Sbjct: 430 VFAKKDMRIVDVNGFVFDVTPTPYMLVANNTDKPGMIGKMGSLLGENNVNIATMQVSRKH 489

Query: 61  STEHAISFLCIDGSILN---SVLEKLSVNVTIRFVK 93
             + A+ FL +D  +     +++ K    + I+FVK
Sbjct: 490 KDKEAMMFLAVDSEVNKETLNIINKAEGILQIKFVK 525


>gi|15806309|ref|NP_295015.1| D-3-phosphoglycerate dehydrogenase [Deinococcus radiodurans R1]
 gi|6459038|gb|AAF10861.1|AE001976_4 D-3-phosphoglycerate dehydrogenase [Deinococcus radiodurans R1]
          Length = 544

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR  ++++   +++    ++   N D  G V  + N+LG +GINIA   LGRS+    A+
Sbjct: 454 PRLTRLRDYRVELEPEGFILIASNLDKPGAVAKLSNLLGTWGINIAGMALGRSEKGGQAL 513

Query: 67  SFLCIDGSILNSVLEKL 83
             L +D S+    L+ +
Sbjct: 514 FTLTLDDSLTPEQLQAI 530


>gi|28210417|ref|NP_781361.1| D-3-phosphoglycerate dehydrogenase [Clostridium tetani E88]
 gi|28202854|gb|AAO35298.1| D-3-phosphoglycerate dehydrogenase [Clostridium tetani E88]
          Length = 533

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 41/86 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I E   DV     M+ + N D+ G++  VG  LG  G+N+A   +GR    + A+ 
Sbjct: 444 KLVEIMEYEVDVKPTECMVFLQNYDVPGVIGHVGTFLGTNGVNVATMQVGRKLKGDKALM 503

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVK 93
            L +D  +    L  L  +  I + K
Sbjct: 504 LLNVDDKVTQDTLLGLQKHDDILWAK 529


>gi|218441675|ref|YP_002380004.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7424]
 gi|218174403|gb|ACK73136.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7424]
          Length = 527

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 46/90 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S+G+ R   + E   +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSNGEIRITDLDEFPINVPPSNYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A+  L +D  +   +L +++    IR
Sbjct: 489 VRGDAVMALSLDDPLPEGILSEITKVAGIR 518


>gi|224372944|ref|YP_002607316.1| D-3-phosphoglycerate dehydrogenase [Nautilia profundicola AmH]
 gi|223588899|gb|ACM92635.1| D-3-phosphoglycerate dehydrogenase [Nautilia profundicola AmH]
          Length = 522

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 1/77 (1%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++ ++ + + +    MI   N D+ G++  VG  L +  INIA F LGR++  + A+
Sbjct: 433 PRIVEFKDFDLEFEPKGKMIFFKNTDVPGVIGEVGMTLAKNNINIADFRLGRNKEGQ-AM 491

Query: 67  SFLCIDGSILNSVLEKL 83
           + + +D  +   VL +L
Sbjct: 492 AVIIVDNEVNEDVLNEL 508


>gi|170077862|ref|YP_001734500.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7002]
 gi|169885531|gb|ACA99244.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7002]
          Length = 525

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 44/90 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG  R   I     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGDIRITSINGFPINVPPTGYMLFTLHRDVPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A+  L +D  +   VL +++    IR
Sbjct: 489 VRGDAVMVLSLDDPLPEGVLSEITKVTGIR 518


>gi|229543101|ref|ZP_04432161.1| D-3-phosphoglycerate dehydrogenase [Bacillus coagulans 36D1]
 gi|229327521|gb|EEN93196.1| D-3-phosphoglycerate dehydrogenase [Bacillus coagulans 36D1]
          Length = 541

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 46/90 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +K+ +   D+   + ++ I + DI G++  VG+ILG    NI    +GR +    AI 
Sbjct: 438 RIVKLNDYRVDLRPEQHLLYIRHLDIPGMIGQVGSILGSNDTNIGTMQVGRKEIGGEAIM 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D +    VL++L   + I+ V+  E 
Sbjct: 498 VLTLDKTASRQVLDQLKEVIGIKAVQTLEL 527


>gi|257052425|ref|YP_003130258.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
 gi|256691188|gb|ACV11525.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
          Length = 520

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 45/98 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F D +PR ++I     D      M+   N D  G++  +G++ GEY +NIA     R  
Sbjct: 423 LFGDNEPRLVEIDGFRVDATPYGHMLISRNRDEPGVIGALGSVFGEYDVNIAGMANARES 482

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A+S   +D  +   +LE+L  +  +  V   + +
Sbjct: 483 IDGEAMSVYNLDDPVTPELLEELESDTRVTGVTAIDLD 520


>gi|297191887|ref|ZP_06909285.1| D-3-phosphoglycerate dehydrogenase [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197721137|gb|EDY65045.1| D-3-phosphoglycerate dehydrogenase [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 530

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 42/77 (54%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M  +   D  G+V  VG ILGE G+NIA   + R++    A+ 
Sbjct: 439 KIVAIGEHDVDLALADHMAVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRAEEGGEALV 498

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D ++  +VL ++S
Sbjct: 499 VLTVDDTVPPAVLAEIS 515


>gi|330466217|ref|YP_004403960.1| D-3-phosphoglycerate dehydrogenase [Verrucosispora maris AB-18-032]
 gi|328809188|gb|AEB43360.1| D-3-phosphoglycerate dehydrogenase [Verrucosispora maris AB-18-032]
          Length = 532

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 5   GKPRFIKIQEIN-FDVDIGR--LMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           G    IK+ E++ FDV+IG   +++ +  AD  G+V  VG +LGE GINIA   + R ++
Sbjct: 434 GTRDIIKLTEVDGFDVEIGAEGILLFLRYADRPGVVGTVGTLLGEAGINIAAMQVARREA 493

Query: 62  TEHAISFLCIDGSI 75
               +  L +D ++
Sbjct: 494 GGETLMTLTVDQAL 507


>gi|163839793|ref|YP_001624198.1| D-3-phosphoglycerate dehydrogenase [Renibacterium salmoninarum ATCC
           33209]
 gi|162953269|gb|ABY22784.1| D-3-phosphoglycerate dehydrogenase [Renibacterium salmoninarum ATCC
           33209]
          Length = 530

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 39/76 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + +   + ++ +   +I +V  D  G+V  VG ILGE GINIA   + R+      + 
Sbjct: 439 KLVGVNGYDVEIPMSEHLIVLVYQDRPGVVGTVGGILGEKGINIAGMQVSRADDGNQVLC 498

Query: 68  FLCIDGSILNSVLEKL 83
            L +D ++   VL+ +
Sbjct: 499 LLTVDSAVPQDVLDSV 514


>gi|312137068|ref|YP_004004405.1| d-3-phosphoglycerate dehydrogenase [Methanothermus fervidus DSM
           2088]
 gi|311224787|gb|ADP77643.1| D-3-phosphoglycerate dehydrogenase [Methanothermus fervidus DSM
           2088]
          Length = 526

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 40/78 (51%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           KP+ I I     DV+    M+ +   D+ G +  +G  LGE+ INIA   +GR +    A
Sbjct: 433 KPKIININGYKVDVEPKGNMMIVKYRDLPGTIGAIGTKLGEHDINIAIMQVGREKPGGEA 492

Query: 66  ISFLCIDGSILNSVLEKL 83
           +  L +D  +   VLE++
Sbjct: 493 VMVLKVDQKVPEDVLEEV 510


>gi|85859018|ref|YP_461220.1| D-3-phosphoglycerate dehydrogenase [Syntrophus aciditrophicus SB]
 gi|85722109|gb|ABC77052.1| D-3-phosphoglycerate dehydrogenase [Syntrophus aciditrophicus SB]
          Length = 527

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 45/96 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I +   DV     ++ + N D  G++  +G  +G   INIA  H  R Q
Sbjct: 431 LFGRRDPRIVRINQFTVDVIPEGHLLMLYNHDKPGVIGNIGTAIGSANINIARMHWSRLQ 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + + A+     D  +   +L+KL     +  V++ +
Sbjct: 491 AEQKAMVVFSTDTPVDAQLLKKLKETPNVISVQELD 526


>gi|257125820|ref|YP_003163934.1| D-3-phosphoglycerate dehydrogenase [Leptotrichia buccalis C-1013-b]
 gi|257049759|gb|ACV38943.1| D-3-phosphoglycerate dehydrogenase [Leptotrichia buccalis C-1013-b]
          Length = 530

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 49/96 (51%), Gaps = 2/96 (2%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I I+  + D+ I   MI + N D+ G++  VG  LG+  INIA  ++GR +++ 
Sbjct: 437 NNEERIISIKNHDVDMAISDNMIYLGNDDVPGVIGAVGATLGKENINIATMNVGRRENS- 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            AI  L +D  +    L KL     I++    +  +
Sbjct: 496 -AIMLLTVDSEVGRKSLNKLKGLSQIKWAHYLDLTI 530


>gi|134297895|ref|YP_001111391.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum reducens MI-1]
 gi|134050595|gb|ABO48566.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum reducens MI-1]
          Length = 526

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 42/84 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR + I     +      M+ + + D  GIV  VG ++G+  INIA   +GR +
Sbjct: 430 LFQGNDPRIVNIDGFRINAATQGHMLVVPHIDKPGIVGKVGTVVGDMAINIAGMQVGRIE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               AI  + +D ++  + LE+L+
Sbjct: 490 LGGKAIMVMMVDNTLPTNALEQLA 513


>gi|315122754|ref|YP_004063243.1| hypothetical protein CKC_05030 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496156|gb|ADR52755.1| hypothetical protein CKC_05030 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 33

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 25/33 (75%)

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            LC+DG + + +LE+LS N  IR +KQFEFNV+
Sbjct: 1   MLCVDGCVSSDILEELSSNSAIRSIKQFEFNVE 33


>gi|242074584|ref|XP_002447228.1| hypothetical protein SORBIDRAFT_06g030920 [Sorghum bicolor]
 gi|241938411|gb|EES11556.1| hypothetical protein SORBIDRAFT_06g030920 [Sorghum bicolor]
          Length = 620

 Score = 43.1 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 48/95 (50%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG P   K+     DV + G L++C    D  G++  VG++LGE  +N++   +GR    
Sbjct: 527 DGVPHLTKVGAFQVDVSLEGSLILC-RQVDQPGMIGSVGSVLGEENVNVSFMSVGRIAPR 585

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +HA+  + +D     + L K+     I  +++F F
Sbjct: 586 KHAVMAIGVDEEPSKATLTKIG---EIPAIEEFVF 617


>gi|220913021|ref|YP_002488330.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter chlorophenolicus
           A6]
 gi|219859899|gb|ACL40241.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter chlorophenolicus
           A6]
          Length = 529

 Score = 43.1 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I     ++ I   ++ +  AD  G++  +G+ILG   INIA   + R       ++
Sbjct: 438 KLVGINGFEVEIPISEHLVVVAYADRPGVIGTIGHILGMNNINIAGMQVARHDEGGQVLA 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L ID S+   VL+ +   +    V++ + 
Sbjct: 498 LLTIDSSVPQQVLDAIKAGIGAEMVREVDL 527


>gi|325290387|ref|YP_004266568.1| D-3-phosphoglycerate dehydrogenase [Syntrophobotulus glycolicus DSM
           8271]
 gi|324965788|gb|ADY56567.1| D-3-phosphoglycerate dehydrogenase [Syntrophobotulus glycolicus DSM
           8271]
          Length = 527

 Score = 42.7 bits (99), Expect = 0.014,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 50/99 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   + R ++I +   D+D    +I I + D  G+V  VG ILGEY INI    + +++
Sbjct: 429 LFGKKEGRIVQIDKHRVDIDPQGWLIIIPHEDYPGMVGKVGTILGEYSININSMQVEKTE 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
                I  + +   I + V+ K+     I+ VK+  F++
Sbjct: 489 DIGMNIMIVGVQSDIGSEVMNKIKQLNGIQNVKKVYFDL 527


>gi|302537104|ref|ZP_07289446.1| phosphoglycerate dehydrogenase [Streptomyces sp. C]
 gi|302445999|gb|EFL17815.1| phosphoglycerate dehydrogenase [Streptomyces sp. C]
          Length = 529

 Score = 42.7 bits (99), Expect = 0.014,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   MI +   D  G+V  VG +LGE G+NIA   + R++    A+ 
Sbjct: 439 KIVGVGEYDVDLALADHMIVLRYTDRPGVVGKVGQLLGEAGLNIAGMQVARAEEGGEALV 498

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D  +   VL  +S
Sbjct: 499 VLTVDAEVPVDVLAAIS 515


>gi|284032768|ref|YP_003382699.1| D-3-phosphoglycerate dehydrogenase [Kribbella flavida DSM 17836]
 gi|283812061|gb|ADB33900.1| D-3-phosphoglycerate dehydrogenase [Kribbella flavida DSM 17836]
          Length = 536

 Score = 42.7 bits (99), Expect = 0.014,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 42/80 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   + +V++   +  +   D  GIV  VG ILGE  INIA   + R +    A+ 
Sbjct: 445 RLVEIDGFDLEVELAEHLAFLSYEDRPGIVGQVGRILGESDINIAGMQVSRDRKGGKALV 504

Query: 68  FLCIDGSILNSVLEKLSVNV 87
            L +D SI  ++L+ ++  V
Sbjct: 505 ALSVDSSITPALLDDIATAV 524


>gi|154686553|ref|YP_001421714.1| D-3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens
           FZB42]
 gi|154352404|gb|ABS74483.1| SerA [Bacillus amyloliquefaciens FZB42]
          Length = 525

 Score = 42.7 bits (99), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++   N D++    ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVELNGFNIDLNPAGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLS 84
            L  D  + + V+ +L+
Sbjct: 495 MLSFDKHLDDKVVNELT 511


>gi|157165087|ref|YP_001466441.1| D-3-phosphoglycerate dehydrogenase [Campylobacter concisus 13826]
 gi|112801635|gb|EAT98979.1| phosphoglycerate dehydrogenase [Campylobacter concisus 13826]
          Length = 525

 Score = 42.7 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + +     D      MI   N D+ G++  +  IL +  INIA F LGR  
Sbjct: 430 VFGENQQRIVTVNGFKTDFKPKGKMIIFKNHDVPGVIAQISKILADEKINIADFRLGRD- 488

Query: 61  STEH--AISFLCIDGSILNSVLEKLS 84
             EH  A++ + +D  I    LE+L+
Sbjct: 489 --EHGMALAVILVDEHIKTETLERLN 512


>gi|307720842|ref|YP_003891982.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas autotrophica DSM
           16294]
 gi|306978935|gb|ADN08970.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas autotrophica DSM
           16294]
          Length = 528

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F DG  R +     + +  +   +I   N+D+ G++  VG IL    +NI+ F L R++
Sbjct: 433 IFEDGLQRIVATDGFDIEFPVKGDIIFFKNSDVPGVIGSVGTILANNNVNISDFSLARNE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
            +E A++ + +D ++ ++ L +L+
Sbjct: 493 QSE-ALAVILVDNAVNDTTLSELA 515


>gi|224155926|ref|XP_002337654.1| predicted protein [Populus trichocarpa]
 gi|222869505|gb|EEF06636.1| predicted protein [Populus trichocarpa]
          Length = 138

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           D KP   K+     DV + G L++C    D  G++  VGNILGE  +N++   +G+    
Sbjct: 45  DRKPHLTKVDSFGVDVSMEGSLILC-SQVDQPGMIGSVGNILGEETVNVSFMSIGKIAPQ 103

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + A+  + +D       L+++     I  V++F F
Sbjct: 104 KQAVMTVSVDEKPSKEALKRIG---EIPAVEEFVF 135


>gi|297584460|ref|YP_003700240.1| D-3-phosphoglycerate dehydrogenase [Bacillus selenitireducens
           MLS10]
 gi|297142917|gb|ADH99674.1| D-3-phosphoglycerate dehydrogenase [Bacillus selenitireducens
           MLS10]
          Length = 536

 Score = 42.7 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 42/91 (46%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I E +F+   G+  + + + D  G++  VG +LG + +NIA   +GR      AI
Sbjct: 446 PRIVRINEFSFEFQPGKHTLFVQHNDRPGVIGKVGQLLGTHDVNIATMQVGRHSEGGKAI 505

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             L  D +    V+        +  V+  E 
Sbjct: 506 MLLGTDKACNGDVITAFETFDEVESVQTIEL 536


>gi|29829272|ref|NP_823906.1| D-3-phosphoglycerate dehydrogenase [Streptomyces avermitilis
           MA-4680]
 gi|29606379|dbj|BAC70441.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces
           avermitilis MA-4680]
          Length = 529

 Score = 42.7 bits (99), Expect = 0.015,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 43/77 (55%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +   D  G+V  +G ILG  GINIA   + R+ +   A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLKYTDRPGVVGTLGRILGGAGINIAGMQVSRAVAGGEALA 498

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D ++  +VL +L+
Sbjct: 499 VLTVDDTVSQNVLTELA 515


>gi|255322493|ref|ZP_05363638.1| phosphoglycerate dehydrogenase [Campylobacter showae RM3277]
 gi|255300401|gb|EET79673.1| phosphoglycerate dehydrogenase [Campylobacter showae RM3277]
          Length = 525

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + I     D      MI   N D+ G++  + +IL E  INIA F LGR  
Sbjct: 430 VFGENQQRIVTINGFKTDFKPKGKMIIFKNNDVPGVIAKISSILAEEKINIADFRLGRDD 489

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               A++ + +D  I    L KL+
Sbjct: 490 HG-MALAVVLVDEKITKETLAKLN 512


>gi|225428898|ref|XP_002285358.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 595

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N++   +GR    +
Sbjct: 502 DGIPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGSILGEENVNVSFMSVGRVAPRK 561

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           HA+  + +D       L+K+     I  V++F F
Sbjct: 562 HAVMAIGVDEQPSKVTLKKIG---EIPAVEEFVF 592


>gi|119963300|ref|YP_948230.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter aurescens TC1]
 gi|119950159|gb|ABM09070.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter aurescens TC1]
          Length = 539

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + +   + ++ I   ++ +  AD  G++  +G+ILG   INI    + R       ++
Sbjct: 448 KLVGVNGYDVEIPISEHLVVVAYADRPGVIGTIGHILGMNNINIGGMQVARQTEGGQVLA 507

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L ID S+   VLE +   +    V++ + 
Sbjct: 508 LLTIDSSVPQQVLEAIKAGIGAEMVREVDL 537


>gi|223940712|ref|ZP_03632551.1| D-3-phosphoglycerate dehydrogenase [bacterium Ellin514]
 gi|223890639|gb|EEF57161.1| D-3-phosphoglycerate dehydrogenase [bacterium Ellin514]
          Length = 526

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 46/88 (52%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +PR +++     +V    ++  + N D  GIV ++G ++G + +NIA   L R  +  HA
Sbjct: 435 QPRIVRVNGQPVEVVPEGVLFLMTNKDRPGIVGYLGTLMGRHNVNIASMSLSRDIAGGHA 494

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVK 93
           ++ L +D     + LE++  +  I  V+
Sbjct: 495 LTVLNLDSVPSETALEEIRKDPDISNVR 522


>gi|308081353|ref|NP_001183055.1| hypothetical protein LOC100501398 [Zea mays]
 gi|238009062|gb|ACR35566.1| unknown [Zea mays]
          Length = 598

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG P   K+     DV + G L++C    D  G++  VG++LGE  IN++   +GR    
Sbjct: 505 DGVPHLTKVGAFQVDVSLEGSLILC-RQVDQPGMIGSVGSVLGEENINVSFMSVGRIAPR 563

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +HA+  + +D       L K+     I  +++F F
Sbjct: 564 KHAVMAIGVDEEPSKVTLRKIG---EIPAIEEFVF 595


>gi|224034059|gb|ACN36105.1| unknown [Zea mays]
          Length = 612

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG P   K+     DV + G L++C    D  G++  VG++LGE  IN++   +GR    
Sbjct: 519 DGVPHLTKVGAFQVDVSLEGSLILC-RQVDQPGMIGSVGSVLGEENINVSFMSVGRIAPR 577

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +HA+  + +D       L K+     I  +++F F
Sbjct: 578 KHAVMAIGVDEEPSKVTLRKIG---EIPAIEEFVF 609


>gi|226498082|ref|NP_001147127.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
 gi|195607486|gb|ACG25573.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 612

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG P   K+     DV + G L++C    D  G++  VG++LGE  IN++   +GR    
Sbjct: 519 DGVPHLTKVGAFQVDVSLEGSLILC-RQVDQPGMIGSVGSVLGEENINVSFMSVGRIAPR 577

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +HA+  + +D       L K+     I  +++F F
Sbjct: 578 KHAVMAIGVDEEPSKVTLRKIG---EIPAIEEFVF 609


>gi|91202994|emb|CAJ72633.1| similar to D-3-phosphoglycerate dehydrogenase (PGDH) [Candidatus
           Kuenenia stuttgartiensis]
          Length = 535

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 35/73 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   +PR + I     +  +   ++ +   D  G +  VG++LG   INIAH   GR +
Sbjct: 439 VFGKNEPRLVDINGYGVEAILNEQILVLFGRDKPGFIGQVGSLLGNKNINIAHMTFGRKE 498

Query: 61  STEHAISFLCIDG 73
              + IS L ID 
Sbjct: 499 VGGNTISILNIDA 511


>gi|315651163|ref|ZP_07904194.1| L-serine dehydratase [Eubacterium saburreum DSM 3986]
 gi|315486561|gb|EFU76912.1| L-serine dehydratase [Eubacterium saburreum DSM 3986]
          Length = 221

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK R +KI E++ D       + +V+ D  G++ ++  IL E+ INIA   L R      
Sbjct: 130 GKVRIVKIGEVDIDFSGEYSALILVHKDRPGMIAYITKILCEHSINIAFMKLYRESKGNK 189

Query: 65  AISFLCIDGSILNSVLEKLSVN 86
           A + +  D  I N+V + L  N
Sbjct: 190 AYTIIESDEPIQNTVKDDLYKN 211


>gi|294056127|ref|YP_003549785.1| D-3-phosphoglycerate dehydrogenase [Coraliomargarita akajimensis
           DSM 45221]
 gi|293615460|gb|ADE55615.1| D-3-phosphoglycerate dehydrogenase [Coraliomargarita akajimensis
           DSM 45221]
          Length = 528

 Score = 42.7 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 35/66 (53%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR + I     +V+    ++ + N D+ GIV F+G  LGE  +NIA+  L R +    A+
Sbjct: 438 PRIVTIDGHGVEVNTDATLLVLKNKDVPGIVGFIGVTLGEDEVNIANMSLSRDKGEGFAV 497

Query: 67  SFLCID 72
           S   +D
Sbjct: 498 SVFELD 503


>gi|297202558|ref|ZP_06919955.1| phosphoglycerate dehydrogenase [Streptomyces sviceus ATCC 29083]
 gi|197709915|gb|EDY53949.1| phosphoglycerate dehydrogenase [Streptomyces sviceus ATCC 29083]
          Length = 529

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 42/77 (54%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +   D  G+V  VG I GE GINIA   + R+ +   A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLKYEDRPGVVGTVGRIFGEAGINIAGMQVSRAIAGGEALA 498

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D ++   VL +++
Sbjct: 499 VLTVDDTVPAGVLTEVA 515


>gi|224152572|ref|XP_002337253.1| predicted protein [Populus trichocarpa]
 gi|222838623|gb|EEE76988.1| predicted protein [Populus trichocarpa]
          Length = 139

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           D KP   K+     DV + G L++C    D  G++  VGNILGE  +N++   +G+    
Sbjct: 46  DRKPHLTKVDSFGVDVSMEGSLILC-SQVDQPGMIGSVGNILGEENVNVSFMSVGKIAPQ 104

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + A+  + +D       L+++     I  V++F F
Sbjct: 105 KQAVMTIGVDEKPSKEALKRIG---EIPAVEEFVF 136


>gi|292669667|ref|ZP_06603093.1| phosphoglycerate dehydrogenase [Selenomonas noxia ATCC 43541]
 gi|292648464|gb|EFF66436.1| phosphoglycerate dehydrogenase [Selenomonas noxia ATCC 43541]
          Length = 526

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 8   RFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           R ++I     DVD   R++IC  + +  G++  +G+I+GE GINI+   +G+S      I
Sbjct: 434 RIVRINRFRVDVDPHARILIC-PHINRPGVIGMIGSIMGEAGINISSMQVGKSDREGMNI 492

Query: 67  SFLCIDGSILNSVLEKL 83
             L ID  I +  L ++
Sbjct: 493 MVLTIDHDIPDDTLARV 509


>gi|296090450|emb|CBI40269.3| unnamed protein product [Vitis vinifera]
          Length = 432

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N++   +GR    +
Sbjct: 339 DGIPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGSILGEENVNVSFMSVGRVAPRK 398

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           HA+  + +D       L+K+     I  V++F F
Sbjct: 399 HAVMAIGVDEQPSKVTLKKIG---EIPAVEEFVF 429


>gi|225443272|ref|XP_002273552.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 624

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG PR   +   + DV + G L++C    D  G++  VGNILGE  +N++   +GR+   
Sbjct: 531 DGIPRLTCVGSFSVDVSLEGNLILC-RQVDQPGMIGRVGNILGECNVNVSFMSVGRTVKR 589

Query: 63  EHAISFLCIDGSILNSVLEKL 83
             AI  + +D       L+K+
Sbjct: 590 TRAIMAIGVDEEPDKDTLKKI 610


>gi|87312269|ref|ZP_01094368.1| phosphoglycerate dehydrogenase [Blastopirellula marina DSM 3645]
 gi|87285007|gb|EAQ76942.1| phosphoglycerate dehydrogenase [Blastopirellula marina DSM 3645]
          Length = 539

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +  PR I +     +  +   +    + D+ GI+  VG I G + +NIA   +GRS 
Sbjct: 433 LFGNDMPRLILVDGQRLEAYLDGTLFLFAHNDVPGIIGRVGTIFGNHNVNIAQMAVGRS- 491

Query: 61  STEHAISFLCIDGSILNSVLEKL--SVNVT 88
           ST  A+  L +DG+   S ++++  S ++T
Sbjct: 492 STGGAVGVLNLDGAPPQSAVDEVLKSADIT 521


>gi|116671082|ref|YP_832015.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter sp. FB24]
 gi|116611191|gb|ABK03915.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter sp. FB24]
          Length = 529

 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + +     ++ I   ++ +  AD  G++  +G+ILG   INIA   + R       ++
Sbjct: 438 KLVGVNGYEVEIPISEHLVVVAYADRPGVIGTIGHILGMNNINIAGMQVARQAEGGQVLA 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L ID S+   VL+ +   +    V++ + 
Sbjct: 498 LLTIDSSVPQQVLDAIKAGIGAEMVREVDL 527


>gi|222824187|ref|YP_002575761.1| D-3-phosphoglycerate dehydrogenase [Campylobacter lari RM2100]
 gi|222539409|gb|ACM64510.1| D-3-phosphoglycerate dehydrogenase [Campylobacter lari RM2100]
          Length = 526

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + + R +++   + D      MI + N DI G++  V  IL +  +NIA F LGR+ 
Sbjct: 431 IFGENEQRIVELNGFDVDFKPKGKMIILNNNDIPGVIANVSGILAKNNVNIADFRLGRN- 489

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A++ + +D  I  ++LE+L
Sbjct: 490 GFGKALAVILLDAKISKALLEEL 512


>gi|281491318|ref|YP_003353298.1| L-serine dehydratase subunit beta [Lactococcus lactis subsp. lactis
           KF147]
 gi|281375059|gb|ADA64577.1| L-serine dehydratase, beta subunit [Lactococcus lactis subsp.
           lactis KF147]
          Length = 223

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 3/80 (3%)

Query: 9   FIKIQEIN-FDVDI--GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
            I++ E+N FD+ I  G     +++ D+ G++  V ++L E+ INIA  ++ R    E A
Sbjct: 133 MIQVTELNGFDIAISAGVPTFVVIHEDVPGMIARVSSVLSEHQINIAQMNVTREAKGEKA 192

Query: 66  ISFLCIDGSILNSVLEKLSV 85
           I  L +D   +  V+E++ +
Sbjct: 193 IMILEVDTPNVKEVIEEMKL 212


>gi|172037049|ref|YP_001803550.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. ATCC 51142]
 gi|171698503|gb|ACB51484.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. ATCC 51142]
          Length = 525

 Score = 42.4 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 45/90 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+ R   +     +V     M+  V+ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGEIRITDVDGFPINVPPSNYMLFTVHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A+  L +D  +   +L +++    IR
Sbjct: 489 VRGDAVMALSLDDPLPEGLLTEITKVSGIR 518


>gi|224153962|ref|XP_002337418.1| predicted protein [Populus trichocarpa]
 gi|222839162|gb|EEE77513.1| predicted protein [Populus trichocarpa]
          Length = 139

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           D KP   K+     DV + G L++C    D  G++  VGNILGE  +N++   +G+    
Sbjct: 46  DRKPHLTKVDSFGVDVSMEGSLILC-SQVDQPGMIGSVGNILGEENVNVSFMSVGKIAPQ 104

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + A+  + +D       L+++     I  V++F F
Sbjct: 105 KQAVMTIGVDEKPSKEALKRIG---EIPAVEEFVF 136


>gi|15672812|ref|NP_266986.1| beta-subunit of L-serine dehydratase [Lactococcus lactis subsp.
           lactis Il1403]
 gi|12723754|gb|AAK04928.1|AE006316_9 beta-subunit of L-serine dehydratase [Lactococcus lactis subsp.
           lactis Il1403]
 gi|326406375|gb|ADZ63446.1| L-serine dehydratase subunit beta [Lactococcus lactis subsp. lactis
           CV56]
          Length = 223

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 3/80 (3%)

Query: 9   FIKIQEIN-FDVDI--GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
            I++ E+N FD+ I  G     +++ D+ G++  V ++L E+ INIA  ++ R    E A
Sbjct: 133 MIQVTELNGFDIAISAGVPTFVVIHEDVPGMIARVSSVLSEHQINIAQMNVTREAKGEKA 192

Query: 66  ISFLCIDGSILNSVLEKLSV 85
           I  L +D   +  V+E++ +
Sbjct: 193 IMILEVDTPNVKEVIEEMKL 212


>gi|196248716|ref|ZP_03147416.1| amino acid-binding ACT domain protein [Geobacillus sp. G11MC16]
 gi|196211592|gb|EDY06351.1| amino acid-binding ACT domain protein [Geobacillus sp. G11MC16]
          Length = 310

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 42/72 (58%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           ++ I + D  G++  VGNILG + +NIA   +GR ++   A+  L +D  + ++VL+ L+
Sbjct: 238 LLYIQHQDRPGMIGKVGNILGAHDVNIATMQVGRQEAGGKAMMILSLDKPVDDAVLKTLA 297

Query: 85  VNVTIRFVKQFE 96
               I  VK+ E
Sbjct: 298 QIDDIETVKRLE 309


>gi|126657695|ref|ZP_01728849.1| phosphoglycerate dehydrogenase [Cyanothece sp. CCY0110]
 gi|126620912|gb|EAZ91627.1| phosphoglycerate dehydrogenase [Cyanothece sp. CCY0110]
          Length = 525

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 45/90 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+ R   +     +V     M+  V+ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGEIRITDVDGFPINVPPSNYMLFTVHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A+  L +D  +   +L +++    IR
Sbjct: 489 VRGDAVMALSLDDPLPEGLLTEITKVSGIR 518


>gi|88604291|ref|YP_504469.1| D-3-phosphoglycerate dehydrogenase [Methanospirillum hungatei JF-1]
 gi|88189753|gb|ABD42750.1| D-3-phosphoglycerate dehydrogenase [Methanospirillum hungatei JF-1]
          Length = 528

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 27/83 (32%), Positives = 39/83 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V   G  R + I     D+     +I   + D  G++     ILGE+ INIA   +GR Q
Sbjct: 432 VLYKGGARIVSIAGYTMDMVPEGAVIISRHLDRPGVIGRASTILGEHQINIAGMQVGRFQ 491

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
             E AI  L +DG +   V+E +
Sbjct: 492 PGEEAIMVLNVDGDVPEEVMEAI 514


>gi|86606026|ref|YP_474789.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. JA-3-3Ab]
 gi|86554568|gb|ABC99526.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. JA-3-3Ab]
          Length = 527

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 42/83 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R  +I E   +V     M+  ++ D+ GI+  +G +LG Y +NIA   +GR      A+ 
Sbjct: 438 RITQIDEFPVNVPPSANMLMTLHRDMPGIIGRIGTLLGAYNVNIASMQVGRKIIRGDAVM 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIR 90
            L +D  + + +LE++     IR
Sbjct: 498 VLSLDDPLPDGILEEVLKQPGIR 520


>gi|239944498|ref|ZP_04696435.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|239990958|ref|ZP_04711622.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           11379]
 gi|291447964|ref|ZP_06587354.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|291350911|gb|EFE77815.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
          Length = 530

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R+     A+ 
Sbjct: 439 KIVAIGEHDVDLALADHMVVLRYQDRPGVVGAVGKILGEAGLNIAGMQVSRAAEGGEALV 498

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D ++   VL +++
Sbjct: 499 VLTVDETVPQPVLTEIA 515


>gi|188996207|ref|YP_001930458.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931274|gb|ACD65904.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 529

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 44/80 (55%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           D  PR + +     D++   +++   N D+ G++  +G +L ++ +NIA F LGR +  +
Sbjct: 436 DKFPRIMMVDNYWIDIEPQGVILMFENKDVPGVIGKLGTLLAKHNVNIAGFRLGRLEKGK 495

Query: 64  HAISFLCIDGSILNSVLEKL 83
            A+  L +D  +   VLE++
Sbjct: 496 IALGALQLDDRLNEEVLEEI 515


>gi|328885238|emb|CCA58477.1| D-3-phosphoglycerate dehydrogenase [Streptomyces venezuelae ATCC
           10712]
          Length = 529

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 43/80 (53%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + + + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R++    A+ 
Sbjct: 439 KIVAVGDYDVDLALADHMVVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRAEEGGEALV 498

Query: 68  FLCIDGSILNSVLEKLSVNV 87
            L +D ++   VL +++  +
Sbjct: 499 VLTVDDTLPAPVLAEIAAEI 518


>gi|168014318|ref|XP_001759699.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162689238|gb|EDQ75611.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 575

 Score = 42.4 bits (98), Expect = 0.024,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 42/80 (52%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+   + DV +   +I     D  G++  VG+ILGE  +NI+   +GR+   +
Sbjct: 482 DGVPHLSKVGNFSVDVSLDGNVILYRQVDQPGMIGKVGSILGEDNVNISFMSVGRTLRGQ 541

Query: 64  HAISFLCIDGSILNSVLEKL 83
            AI  +  D  + ++ ++KL
Sbjct: 542 AAIVAIGTDEDVSDATIQKL 561


>gi|86608852|ref|YP_477614.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557394|gb|ABD02351.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 526

 Score = 42.0 bits (97), Expect = 0.025,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 42/83 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R  +I E   +V     M+  ++ D+ GI+  +G +LG Y +NIA   +GR      A+ 
Sbjct: 437 RITQIDEFPVNVPPSANMLMTLHRDMPGIIGRIGTLLGAYNVNIASMQVGRKIIRGDAVM 496

Query: 68  FLCIDGSILNSVLEKLSVNVTIR 90
            L +D  + + +LE++     IR
Sbjct: 497 VLSLDDPLPDGILEEVLKQPGIR 519


>gi|15900049|ref|NP_344653.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae TIGR4]
 gi|15902139|ref|NP_357689.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae R6]
 gi|111656936|ref|ZP_01407755.1| hypothetical protein SpneT_02001824 [Streptococcus pneumoniae
           TIGR4]
 gi|116516124|ref|YP_815593.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae D39]
 gi|148985451|ref|ZP_01818656.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP3-BS71]
 gi|148987836|ref|ZP_01819299.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP6-BS73]
 gi|148994301|ref|ZP_01823565.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP9-BS68]
 gi|148996513|ref|ZP_01824231.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP11-BS70]
 gi|149001808|ref|ZP_01826781.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP14-BS69]
 gi|149007919|ref|ZP_01831497.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP18-BS74]
 gi|149010968|ref|ZP_01832273.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP19-BS75]
 gi|149017779|ref|ZP_01834238.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP23-BS72]
 gi|168483590|ref|ZP_02708542.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC1873-00]
 gi|168489423|ref|ZP_02713622.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP195]
 gi|168492418|ref|ZP_02716561.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC0288-04]
 gi|168493808|ref|ZP_02717951.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC3059-06]
 gi|168577059|ref|ZP_02722888.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae MLV-016]
 gi|182683072|ref|YP_001834819.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CGSP14]
 gi|194397086|ref|YP_002036818.1| L-serine dehydratase subunit alpha [Streptococcus pneumoniae G54]
 gi|221231041|ref|YP_002510193.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           ATCC 700669]
 gi|225853731|ref|YP_002735243.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae JJA]
 gi|225855886|ref|YP_002737397.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae P1031]
 gi|225860141|ref|YP_002741650.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae Taiwan19F-14]
 gi|237650917|ref|ZP_04525169.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CCRI 1974]
 gi|237821344|ref|ZP_04597189.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CCRI 1974M2]
 gi|298229649|ref|ZP_06963330.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae str. Canada MDR_19F]
 gi|298254962|ref|ZP_06978548.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae str. Canada MDR_19A]
 gi|298501897|ref|YP_003723837.1| L-serine ammonia-lyase [Streptococcus pneumoniae TCH8431/19A]
 gi|303254802|ref|ZP_07340902.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           BS455]
 gi|303259148|ref|ZP_07345126.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP-BS293]
 gi|303260905|ref|ZP_07346854.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP14-BS292]
 gi|303263232|ref|ZP_07349155.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae BS397]
 gi|303267675|ref|ZP_07353505.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae BS457]
 gi|303270023|ref|ZP_07355749.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae BS458]
 gi|307066778|ref|YP_003875744.1| L-serine deaminase [Streptococcus pneumoniae AP200]
 gi|307126328|ref|YP_003878359.1| L-serine dehydratase, iron-sulfur-dependent subunit beta
           [Streptococcus pneumoniae 670-6B]
 gi|307707808|ref|ZP_07644285.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis NCTC 12261]
 gi|307710252|ref|ZP_07646695.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis SK564]
 gi|14971573|gb|AAK74293.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae TIGR4]
 gi|15457631|gb|AAK98899.1| L-serine dehydratase beta subunit [Streptococcus pneumoniae R6]
 gi|116076700|gb|ABJ54420.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae D39]
 gi|147757088|gb|EDK64127.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP11-BS70]
 gi|147760266|gb|EDK67255.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP14-BS69]
 gi|147760542|gb|EDK67517.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP18-BS74]
 gi|147764604|gb|EDK71534.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP19-BS75]
 gi|147922409|gb|EDK73529.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP3-BS71]
 gi|147926300|gb|EDK77373.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP6-BS73]
 gi|147927331|gb|EDK78363.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP9-BS68]
 gi|147931343|gb|EDK82321.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP23-BS72]
 gi|172042964|gb|EDT51010.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC1873-00]
 gi|182628406|gb|ACB89354.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CGSP14]
 gi|183572127|gb|EDT92655.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP195]
 gi|183573438|gb|EDT93966.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC0288-04]
 gi|183576188|gb|EDT96716.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC3059-06]
 gi|183577289|gb|EDT97817.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae MLV-016]
 gi|194356753|gb|ACF55201.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae G54]
 gi|220673501|emb|CAR67976.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           ATCC 700669]
 gi|225722246|gb|ACO18099.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae JJA]
 gi|225724697|gb|ACO20549.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae P1031]
 gi|225727062|gb|ACO22913.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae Taiwan19F-14]
 gi|298237492|gb|ADI68623.1| L-serine ammonia-lyase [Streptococcus pneumoniae TCH8431/19A]
 gi|301793403|emb|CBW35769.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           INV104]
 gi|301799272|emb|CBW31795.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           OXC141]
 gi|301801063|emb|CBW33730.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           INV200]
 gi|302598239|gb|EFL65285.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           BS455]
 gi|302637742|gb|EFL68228.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP14-BS292]
 gi|302639566|gb|EFL70023.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP-BS293]
 gi|302640444|gb|EFL70865.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae BS458]
 gi|302642791|gb|EFL73108.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae BS457]
 gi|302647005|gb|EFL77229.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae BS397]
 gi|306408315|gb|ADM83742.1| L-serine deaminase [Streptococcus pneumoniae AP200]
 gi|306483390|gb|ADM90259.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae 670-6B]
 gi|307616068|gb|EFN95264.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis NCTC 12261]
 gi|307619014|gb|EFN98147.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis SK564]
 gi|327390514|gb|EGE88854.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae GA04375]
 gi|332075775|gb|EGI86242.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae GA17570]
 gi|332076564|gb|EGI87026.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae GA17545]
 gi|332077409|gb|EGI87870.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae GA41301]
          Length = 223

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAGEKAI 193

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D    +  +E++
Sbjct: 194 MIIEVDSRNCDEAIEEI 210


>gi|211906486|gb|ACJ11736.1| phosphoglycerate dehydrogenase [Gossypium hirsutum]
          Length = 602

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 39/80 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N++   +GR    +
Sbjct: 509 DGIPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGTVGSILGEENVNVSFMSVGRVAPRK 568

Query: 64  HAISFLCIDGSILNSVLEKL 83
           HA+  + +D       L+++
Sbjct: 569 HAVMAIGVDEQPSKETLKRI 588


>gi|224370615|ref|YP_002604779.1| D-3-phosphoglycerate dehydrogenase [Desulfobacterium autotrophicum
           HRM2]
 gi|223693332|gb|ACN16615.1| SerA1 [Desulfobacterium autotrophicum HRM2]
          Length = 526

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 44/95 (46%), Gaps = 4/95 (4%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR I+I +   +V     +  I N D  G +  +G  LG++ INIA   +GR  
Sbjct: 430 IFGKDDPRIIRINKFRLEVIPDGHLALIHNIDKPGSIGNIGTCLGKHDINIAKMMVGRED 489

Query: 61  STEHAISFLCIDGSILNSVLEKLS----VNVTIRF 91
             +  I FL  D  I   + E++S    VN  + F
Sbjct: 490 DGDRNIIFLQTDTPISAEIAEEISGLGLVNSMVTF 524


>gi|138895825|ref|YP_001126278.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermodenitrificans
           NG80-2]
 gi|134267338|gb|ABO67533.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermodenitrificans
           NG80-2]
          Length = 465

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 42/72 (58%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           ++ I + D  G++  VGNILG + +NIA   +GR ++   A+  L +D  + ++VL+ L+
Sbjct: 393 LLYIQHQDRPGMIGKVGNILGAHDVNIATMQVGRQEAGGKAMMILSLDKPVDDAVLKTLA 452

Query: 85  VNVTIRFVKQFE 96
               I  VK+ E
Sbjct: 453 QIDDIETVKRLE 464


>gi|225857971|ref|YP_002739481.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae 70585]
 gi|225721396|gb|ACO17250.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae 70585]
          Length = 223

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAGEKAI 193

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D    +  +E++
Sbjct: 194 MIIEVDSRNCDEAIEEI 210


>gi|307711111|ref|ZP_07647533.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis SK321]
 gi|307617073|gb|EFN96251.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis SK321]
          Length = 223

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAGEKAI 193

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D    +  +E++
Sbjct: 194 MIIEVDSRNCDEAIEEI 210


>gi|169834395|ref|YP_001693626.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae Hungary19A-6]
 gi|168996897|gb|ACA37509.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae Hungary19A-6]
          Length = 223

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAGEKAI 193

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D    +  +E++
Sbjct: 194 MIIEVDSRNCDEAIEEI 210


>gi|168487053|ref|ZP_02711561.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC1087-00]
 gi|183570010|gb|EDT90538.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC1087-00]
          Length = 223

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAGEKAI 193

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D    +  +E++
Sbjct: 194 MIIEVDSRNCDEAIEEI 210


>gi|308069541|ref|YP_003871146.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Paenibacillus polymyxa
           E681]
 gi|305858820|gb|ADM70608.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Paenibacillus polymyxa
           E681]
          Length = 530

 Score = 42.0 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 39/76 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++ +   DV      + I + D  GI+  VG +LGE G+NIA   +GR      AI 
Sbjct: 440 RIVRLNQFPVDVAPEAHFLLISHNDKPGIIGRVGTLLGENGVNIASMQVGRKIVGGEAIM 499

Query: 68  FLCIDGSILNSVLEKL 83
            L +D ++   VL +L
Sbjct: 500 ILTVDKAVPKDVLIQL 515


>gi|220931993|ref|YP_002508901.1| D-3-phosphoglycerate dehydrogenase [Halothermothrix orenii H 168]
 gi|219993303|gb|ACL69906.1| D-3-phosphoglycerate dehydrogenase [Halothermothrix orenii H 168]
          Length = 527

 Score = 42.0 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 42/82 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I+I +   D+++    + I   D  G++  VG+ILG+  +NIA   +GR      AI 
Sbjct: 438 RIIEINDFRIDLNLEGKFLVISYQDKPGVIGKVGSILGQDNVNIASMQVGRKSYGGQAIM 497

Query: 68  FLCIDGSILNSVLEKLSVNVTI 89
            +  D     + +EK++ N+ +
Sbjct: 498 IIQTDNKPSKATMEKINKNIEL 519


>gi|298204781|emb|CBI25279.3| unnamed protein product [Vitis vinifera]
          Length = 432

 Score = 42.0 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG PR   +   + DV + G L++C    D  G++  VGNILGE  +N++   +GR+   
Sbjct: 339 DGIPRLTCVGSFSVDVSLEGNLILC-RQVDQPGMIGRVGNILGECNVNVSFMSVGRTVKR 397

Query: 63  EHAISFLCIDGSILNSVLEKL 83
             AI  + +D       L+K+
Sbjct: 398 TRAIMAIGVDEEPDKDTLKKI 418


>gi|307747791|gb|ADN91061.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni M1]
          Length = 527

 Score = 42.0 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRD- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 491 GFGYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|67920676|ref|ZP_00514196.1| D-3-phosphoglycerate dehydrogenase [Crocosphaera watsonii WH 8501]
 gi|67858160|gb|EAM53399.1| D-3-phosphoglycerate dehydrogenase [Crocosphaera watsonii WH 8501]
          Length = 525

 Score = 42.0 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 43/84 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+ R   +     +V     M+  V+ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGEIRITDVDGFPINVPPSNYMLFTVHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               A+  L +D  +   +L +++
Sbjct: 489 VRGDAVMALSLDDPLPEGLLNEIT 512


>gi|308174098|ref|YP_003920803.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens DSM 7]
 gi|307606962|emb|CBI43333.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens DSM 7]
          Length = 525

 Score = 42.0 bits (97), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++   N D+     ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVELNGFNIDLHPAGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLS 84
            L  D  + + V+ +L+
Sbjct: 495 MLSFDKHLDDKVVNELA 511


>gi|205356376|ref|ZP_03223141.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|205345761|gb|EDZ32399.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8421]
          Length = 489

 Score = 42.0 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 394 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRD- 452

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 453 GFGYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 488


>gi|86152140|ref|ZP_01070352.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315124387|ref|YP_004066391.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85840925|gb|EAQ58175.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315018109|gb|ADT66202.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 527

 Score = 42.0 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRD- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 491 GFGYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|283954452|ref|ZP_06371972.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794069|gb|EFC32818.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 521

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 426 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRD- 484

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 485 GFGYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 520


>gi|157415148|ref|YP_001482404.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|157386112|gb|ABV52427.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81116]
          Length = 527

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRD- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 491 GFGYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|57237720|ref|YP_178968.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni RM1221]
 gi|86150274|ref|ZP_01068501.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88597554|ref|ZP_01100788.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|218562511|ref|YP_002344290.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|57166524|gb|AAW35303.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni RM1221]
 gi|85839390|gb|EAQ56652.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88190146|gb|EAQ94121.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360217|emb|CAL35012.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|284926125|gb|ADC28477.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|315058331|gb|ADT72660.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni S3]
 gi|315927558|gb|EFV06891.1| phosphoglycerate dehydrogenase [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 527

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRD- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 491 GFGYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|315932626|gb|EFV11557.1| phosphoglycerate dehydrogenase [Campylobacter jejuni subsp. jejuni
           327]
          Length = 527

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRD- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 491 GFGYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|283956236|ref|ZP_06373716.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283791956|gb|EFC30745.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 527

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRD- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 491 GFGYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|315929501|gb|EFV08695.1| ACT domain protein [Campylobacter jejuni subsp. jejuni 305]
          Length = 330

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 235 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRD- 293

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 294 GFGYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 329


>gi|148926576|ref|ZP_01810258.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|145845270|gb|EDK22364.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8486]
          Length = 529

 Score = 42.0 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 434 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLATKNINIADFRLGRD- 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 493 GFGYALAVVLIDEKVQKEVLDELKQLEVCVFVQYVE 528


>gi|237756137|ref|ZP_04584709.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237691701|gb|EEP60737.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 529

 Score = 41.6 bits (96), Expect = 0.032,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 44/80 (55%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           D  PR + +     D++   +++   N D+ G++  +G +L ++ +NIA F LGR +  +
Sbjct: 436 DKFPRIMMVDNYWIDIEPQGVILMFENKDVPGVIGKLGTLLAKHNVNIAGFRLGRLEKGK 495

Query: 64  HAISFLCIDGSILNSVLEKL 83
            A+  L +D  +   +LE++
Sbjct: 496 IALGALQLDDRLNEEILEEI 515


>gi|171909940|ref|ZP_02925410.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobium spinosum DSM
           4136]
          Length = 534

 Score = 41.6 bits (96), Expect = 0.033,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 43/82 (52%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F  G PR +KI     +      ++ + N D  G++   G ILG++ +NIA+  L R++ 
Sbjct: 437 FFGGDPRIVKINGRRVEAKPEGTLLLLENDDRPGMIGAYGTILGQHQVNIANMSLSRNEE 496

Query: 62  TEHAISFLCIDGSILNSVLEKL 83
              A++ L +D +  + V++ L
Sbjct: 497 GGTAMTLLTLDTAPADVVIKDL 518


>gi|148642517|ref|YP_001273030.1| D-3-phosphoglycerate dehydrogenase [Methanobrevibacter smithii ATCC
           35061]
 gi|148551534|gb|ABQ86662.1| D-3-phosphoglycerate dehydrogenase, SerA [Methanobrevibacter
           smithii ATCC 35061]
          Length = 524

 Score = 41.6 bits (96), Expect = 0.034,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 36/75 (48%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           P+ +K+ +   DV     M      D+ G +  +G  LGEYGINI    +GR +    AI
Sbjct: 434 PKILKVNDYWVDVKPEGHMFIAKYEDVPGSIGKIGTALGEYGINIGIMQVGRDEKGGRAI 493

Query: 67  SFLCIDGSILNSVLE 81
             L +D  I   V++
Sbjct: 494 MILTLDKEIPKEVIK 508


>gi|328552773|gb|AEB23265.1| D-3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens
           TA208]
 gi|328912429|gb|AEB64025.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens LL3]
          Length = 525

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++   N D+     ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVELNGFNIDLHPAGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLS 84
            L  D  + + V+ +L+
Sbjct: 495 MLSFDKHLDDKVVNELA 511


>gi|256255567|ref|ZP_05461103.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti B1/94]
 gi|261222771|ref|ZP_05937052.1| predicted protein [Brucella ceti B1/94]
 gi|260921355|gb|EEX88008.1| predicted protein [Brucella ceti B1/94]
          Length = 54

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%)

Query: 49 INIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
          +NIA+F LGR      AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 1  VNIANFALGRDHPGGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 51


>gi|302390824|ref|YP_003826644.1| D-3-phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM
           5501]
 gi|302202901|gb|ADL11579.1| D-3-phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM
           5501]
          Length = 527

 Score = 41.6 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 1   VFSDGKPRFIKIQEINFD-VDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           VF D   R ++I     + +  G L+I   + D  G+V  +G +LGE  INIA+  LGR 
Sbjct: 431 VFDDTDLRIVEINGYRVNAISEGNLLI-TNHTDKPGVVGKIGTLLGENDINIANMQLGRH 489

Query: 60  QSTEHAISFLCIDGSILNSVLEKL 83
            +   A+  + ID  + + V EKL
Sbjct: 490 DAGGEAVMVMGIDNELNSEVKEKL 513


>gi|260889453|ref|ZP_05900716.1| phosphoglycerate dehydrogenase [Leptotrichia hofstadii F0254]
 gi|260860864|gb|EEX75364.1| phosphoglycerate dehydrogenase [Leptotrichia hofstadii F0254]
          Length = 530

 Score = 41.6 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I I+  + D+ I   MI + N D+ G++  VG  LG+  INIA  ++GR +++ 
Sbjct: 437 NNEERIISIKNHDVDMAISDNMIYLGNEDVPGVIGAVGATLGKGNINIATMNVGRRENS- 495

Query: 64  HAISFLCIDGSILNSVLEKL 83
            AI  L +D  +    L++L
Sbjct: 496 -AIMLLTVDSEVGRRSLKEL 514


>gi|121535994|ref|ZP_01667786.1| D-3-phosphoglycerate dehydrogenase [Thermosinus carboxydivorans
           Nor1]
 gi|121305430|gb|EAX46380.1| D-3-phosphoglycerate dehydrogenase [Thermosinus carboxydivorans
           Nor1]
          Length = 528

 Score = 41.6 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 45/98 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   + R + I     DVD    ++   + D  G+V  VG ILGE+ INIA   +GR++
Sbjct: 429 LFGKTEGRIVMIDGYRVDVDPQGWLLIGPHIDKPGMVGKVGTILGEHNINIAGMQVGRTE 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
                I  + ++  I   V+ K+     I   K   FN
Sbjct: 489 QAGTNIMVMAVESDIPTPVMLKIKAVDGILGAKLVNFN 526


>gi|56420782|ref|YP_148100.1| D-3-phosphoglycerate dehydrogenase [Geobacillus kaustophilus
           HTA426]
 gi|56380624|dbj|BAD76532.1| phosphoglycerate dehydrogenase [Geobacillus kaustophilus HTA426]
          Length = 510

 Score = 41.6 bits (96), Expect = 0.036,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 41/72 (56%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           ++ I + D  G++  VGN+LG + +NIA   +GR ++   A+  L +D  + + VL+ L+
Sbjct: 438 LLYIQHQDRPGMIGKVGNVLGAHDVNIATMQVGRQEAGGKAMMILSLDKPVDDEVLQALA 497

Query: 85  VNVTIRFVKQFE 96
               I  VK+ E
Sbjct: 498 QIDDIETVKRLE 509


>gi|238063230|ref|ZP_04607939.1| D-3-phosphoglycerate dehydrogenase [Micromonospora sp. ATCC 39149]
 gi|237885041|gb|EEP73869.1| D-3-phosphoglycerate dehydrogenase [Micromonospora sp. ATCC 39149]
          Length = 532

 Score = 41.6 bits (96), Expect = 0.036,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 3/78 (3%)

Query: 1   VFSDGKPRFIKIQEIN-FDVDIGR--LMICIVNADILGIVVFVGNILGEYGINIAHFHLG 57
           V S G    +K+ E++ FDV+IG   +++ +   D  G+V  VG +LGE GINIA   + 
Sbjct: 430 VASAGARDVLKLTEVDGFDVEIGAEGILLFLRYVDRPGVVGTVGTLLGEAGINIAAMQVA 489

Query: 58  RSQSTEHAISFLCIDGSI 75
           R ++    +  L +D ++
Sbjct: 490 RREAGGETLMTLTVDQAL 507


>gi|150400998|ref|YP_001324764.1| D-3-phosphoglycerate dehydrogenase [Methanococcus aeolicus
           Nankai-3]
 gi|150013701|gb|ABR56152.1| D-3-phosphoglycerate dehydrogenase [Methanococcus aeolicus
           Nankai-3]
          Length = 523

 Score = 41.6 bits (96), Expect = 0.036,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 39/80 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G P   +I     D+    ++  I + D  GI+     +LG+YG+NIA   +GR +   
Sbjct: 430 EGAPVLKEINNYKIDIKPEGIVCVIKHMDKPGIIGKASTLLGDYGVNIAGMQVGRQEPGG 489

Query: 64  HAISFLCIDGSILNSVLEKL 83
            ++  L +D  I   V+ KL
Sbjct: 490 ESVMVLNLDHVITEEVISKL 509


>gi|207110944|ref|ZP_03245106.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
          HPKX_438_CA4C1]
          Length = 75

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%)

Query: 1  VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
          VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 9  VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 68

Query: 61 STE 63
            E
Sbjct: 69 QKE 71


>gi|116750521|ref|YP_847208.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116699585|gb|ABK18773.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 525

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 1/90 (1%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I+I +   + ++  + + I N D  G +  +G  LG + +NIA+ HL R+   + AI+
Sbjct: 437 RLIRINDYRLEAELEGINLLIQNYDKPGTIGLIGTTLGSHQVNIANMHLSRT-PRDKAIA 495

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            + +D       +E L  + +I  V+Q + 
Sbjct: 496 IIRLDNEAPPEAIETLRRHPSIISVQQVKL 525


>gi|288556042|ref|YP_003427977.1| D-3-phosphoglycerate dehydrogenase [Bacillus pseudofirmus OF4]
 gi|288547202|gb|ADC51085.1| D-3-phosphoglycerate dehydrogenase [Bacillus pseudofirmus OF4]
          Length = 540

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 43/89 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R + I   N D      ++ I + D  G++  +G +L E+ +NIA   +GR Q    AI 
Sbjct: 451 RIVSINGFNVDFVPQGHLLYIQHNDKPGVIGRIGQLLAEHDVNIATMQVGRKQEGGEAIM 510

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            + +D ++   VL+ +     I+F  + E
Sbjct: 511 MITVDKTVEEDVLKAVRKIEDIQFADKIE 539


>gi|15678988|ref|NP_276105.1| D-3-phosphoglycerate dehydrogenase [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|3122860|sp|O27051|SERA_METTH RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|2622068|gb|AAB85466.1| phosphoglycerate dehydrogenase [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 525

 Score = 41.6 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 25/78 (32%), Positives = 39/78 (50%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +P  I I     DV     MI     D+ G +  +G  LG++GINIA   +GR +    A
Sbjct: 434 EPTIIGINGYRVDVKPEGTMIIARYRDLPGTIGAIGTKLGQHGINIATMQVGRKEIGGEA 493

Query: 66  ISFLCIDGSILNSVLEKL 83
           +  L +D S+   V+E++
Sbjct: 494 VMVLKVDQSVPAEVIEEV 511


>gi|307152719|ref|YP_003888103.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7822]
 gi|306982947|gb|ADN14828.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7822]
          Length = 525

 Score = 41.6 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 45/90 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  +G+ R   + E   +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLGNGEIRITDLDEFPINVPPSNYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A+  L +D  +   +L +++    IR
Sbjct: 489 VRGDAVMALSLDDPLPEGILSEITKVAGIR 518


>gi|145593787|ref|YP_001158084.1| D-3-phosphoglycerate dehydrogenase [Salinispora tropica CNB-440]
 gi|145303124|gb|ABP53706.1| D-3-phosphoglycerate dehydrogenase [Salinispora tropica CNB-440]
          Length = 531

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 47/80 (58%), Gaps = 3/80 (3%)

Query: 11  KIQEIN-FDVDIGR--LMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           K+ E++ FDV+IG   +++ +  AD  G+V  VG +LGE G+NIA   + R ++    + 
Sbjct: 439 KLTEVDGFDVEIGAEGILVFLRYADRPGVVGAVGTLLGEAGVNIAAMQVARREAGGETLM 498

Query: 68  FLCIDGSILNSVLEKLSVNV 87
            L +D ++   +L  ++ +V
Sbjct: 499 TLTVDQALGADLLTSVADSV 518


>gi|302524967|ref|ZP_07277309.1| phosphoglycerate dehydrogenase [Streptomyces sp. AA4]
 gi|302433862|gb|EFL05678.1| phosphoglycerate dehydrogenase [Streptomyces sp. AA4]
          Length = 532

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 3/97 (3%)

Query: 5   GKPRFIKIQEI---NFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           GK    KI EI   +FD+     ++ I   D  G++  VG +LGE GINI    + +S  
Sbjct: 436 GKDEVEKIVEIKGRHFDLRAEGDVLVIEYPDRPGVMGRVGTLLGEAGINIEAAQISQSTD 495

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
              +I  L +D  +  +VLE +   V    ++  +FN
Sbjct: 496 GSDSIMLLRVDRHVDANVLEPIGATVGAHTIRAVDFN 532


>gi|261417914|ref|YP_003251596.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC61]
 gi|297529583|ref|YP_003670858.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. C56-T3]
 gi|319767274|ref|YP_004132775.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC52]
 gi|261374371|gb|ACX77114.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC61]
 gi|297252835|gb|ADI26281.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. C56-T3]
 gi|317112140|gb|ADU94632.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC52]
          Length = 524

 Score = 41.2 bits (95), Expect = 0.042,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 41/72 (56%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           ++ I + D  G++  VGN+LG + +NIA   +GR ++   A+  L +D  + + VL+ L+
Sbjct: 452 LLYIQHQDRPGMIGKVGNVLGAHDVNIATMQVGRQEAGGKAMMILSLDKPVDDEVLQALA 511

Query: 85  VNVTIRFVKQFE 96
               I  VK+ E
Sbjct: 512 QIDDIETVKRLE 523


>gi|261406015|ref|YP_003242256.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. Y412MC10]
 gi|261282478|gb|ACX64449.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. Y412MC10]
          Length = 530

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++ +   D+     +I I + D  GI+  VG +LGE  +NIA   +GR      AI 
Sbjct: 440 RIVRLDKFPVDISPEGHLILISHNDKPGIIGRVGTLLGENDVNIASMQVGRKVIGGEAIM 499

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D  +   VL KL+
Sbjct: 500 LLTVDKDVPKDVLIKLT 516


>gi|121612205|ref|YP_001000566.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167005499|ref|ZP_02271257.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|87249339|gb|EAQ72299.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
          Length = 527

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      M+   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMVIFKNKDIPGVIAKISSVLAAKNINIADFRLGRD- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 491 GFGYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|329929876|ref|ZP_08283552.1| phosphoglycerate dehydrogenase [Paenibacillus sp. HGF5]
 gi|328935854|gb|EGG32315.1| phosphoglycerate dehydrogenase [Paenibacillus sp. HGF5]
          Length = 530

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++ +   D+     +I I + D  GI+  VG +LGE  +NIA   +GR      AI 
Sbjct: 440 RIVRLDKFPVDISPEGHLILISHNDKPGIIGRVGTLLGENDVNIASMQVGRKVIGGEAIM 499

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D  +   VL KL+
Sbjct: 500 LLTVDKDVPKDVLIKLT 516


>gi|315646394|ref|ZP_07899512.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus vortex V453]
 gi|315278037|gb|EFU41357.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus vortex V453]
          Length = 530

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++ +   D+     +I I + D  GI+  VG +LGE  +NIA   +GR      AI 
Sbjct: 440 RIVRLDKFPVDISPEGHLILISHNDKPGIIGRVGTLLGENDVNIASMQVGRKVIGGEAIM 499

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D  +   VL KL+
Sbjct: 500 LLTVDKDVPKDVLIKLT 516


>gi|282163065|ref|YP_003355450.1| D-3-phosphoglycerate dehydrogenase [Methanocella paludicola SANAE]
 gi|282155379|dbj|BAI60467.1| D-3-phosphoglycerate dehydrogenase [Methanocella paludicola SANAE]
          Length = 526

 Score = 41.2 bits (95), Expect = 0.045,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 41/83 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +   R + I     + +    MI  ++ D  G++  VG ILG+  INIA   +GR  
Sbjct: 430 IFGNKDARIVGIDNYRIEANPAGYMIVTMHKDRPGVIGNVGTILGKNDINIAGMVVGREA 489

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               AI  L +D ++   VL+++
Sbjct: 490 VRGEAIMILNVDDAVPQPVLKEM 512


>gi|86153461|ref|ZP_01071665.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|85843187|gb|EAQ60398.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni HB93-13]
          Length = 527

 Score = 41.2 bits (95), Expect = 0.045,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      M+   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMVIFKNKDIPGVIAKISSVLAAKNINIADFRLGRD- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 491 GFGYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|209523822|ref|ZP_03272375.1| D-3-phosphoglycerate dehydrogenase [Arthrospira maxima CS-328]
 gi|209495854|gb|EDZ96156.1| D-3-phosphoglycerate dehydrogenase [Arthrospira maxima CS-328]
          Length = 527

 Score = 41.2 bits (95), Expect = 0.046,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 45/90 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D + R   I +   +V   R M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 LLGDREIRVTNIDDFPINVPPTRYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A+  L +D  + + +L ++     IR
Sbjct: 491 VRGEAVMVLSLDDPLPDGLLSEIMKVAGIR 520


>gi|297559156|ref|YP_003678130.1| D-3-phosphoglycerate dehydrogenase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296843604|gb|ADH65624.1| D-3-phosphoglycerate dehydrogenase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 529

 Score = 41.2 bits (95), Expect = 0.047,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 43/90 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I     ++ +   M+ +   D  G+V  VG +LG+ G+NIA   + R Q    A+ 
Sbjct: 438 KLVEINNYTMEIGLAEHMVFLSYEDRPGVVGTVGALLGDAGVNIAGMQVIRDQEGGKALI 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++ +  L  +S  +     +Q + 
Sbjct: 498 ALTVDSAVPDETLASISAEIDADISRQVDL 527


>gi|323489160|ref|ZP_08094392.1| D-3-phosphoglycerate dehydrogenase [Planococcus donghaensis MPA1U2]
 gi|323397047|gb|EGA89861.1| D-3-phosphoglycerate dehydrogenase [Planococcus donghaensis MPA1U2]
          Length = 528

 Score = 41.2 bits (95), Expect = 0.048,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 41/77 (53%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +K+ +   DV     ++ + + D  G++  VG +LG+  +NIA   +GRS     AI 
Sbjct: 439 RIVKVDDYLVDVVPEGHLLYVSHNDRPGVIGRVGTLLGQENVNIATMQVGRSIVGGSAIM 498

Query: 68  FLCIDGSILNSVLEKLS 84
            L ID S   S LE+L+
Sbjct: 499 MLSIDKSAETSSLEQLA 515


>gi|288553103|ref|YP_003425038.1| L-serine dehydratase subunit beta [Bacillus pseudofirmus OF4]
 gi|288544263|gb|ADC48146.1| L-serine dehydratase beta subunit [Bacillus pseudofirmus OF4]
          Length = 220

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 42/80 (52%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK   I++      +      I +V+ D  G++  V N+L ++ INI H  + R +  + 
Sbjct: 128 GKIEIIELNGFQLKLSGNHPAILVVHNDRYGVIAGVSNVLAKHEINIGHMEVSRKEKGKE 187

Query: 65  AISFLCIDGSILNSVLEKLS 84
           A+  + +D ++ N++L++L 
Sbjct: 188 ALMVIEVDQNVPNTILKELE 207


>gi|220908749|ref|YP_002484060.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7425]
 gi|219865360|gb|ACL45699.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7425]
          Length = 652

 Score = 41.2 bits (95), Expect = 0.048,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 43/83 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R   I +   +V   R M+  ++ D+ GI+  +G++LG + +NIA   +GR     +A+ 
Sbjct: 563 RITDIDDFPINVPPTRHMLLTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKMVRGNAVM 622

Query: 68  FLCIDGSILNSVLEKLSVNVTIR 90
            L +D  +   +L +++    IR
Sbjct: 623 VLSLDDPLPEGLLTEITKVSGIR 645


>gi|284052483|ref|ZP_06382693.1| D-3-phosphoglycerate dehydrogenase [Arthrospira platensis str.
           Paraca]
 gi|291569633|dbj|BAI91905.1| D-3-phosphoglycerate dehydrogenase [Arthrospira platensis NIES-39]
          Length = 527

 Score = 41.2 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 45/90 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D + R   I +   +V   R M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 LLGDREIRVTNIDDFPINVPPTRYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A+  L +D  + + +L ++     IR
Sbjct: 491 VRGEAVMVLSLDDPLPDGLLSEIMKVAGIR 520


>gi|304437357|ref|ZP_07397316.1| phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369613|gb|EFM23279.1| phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 563

 Score = 41.2 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 8   RFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           R ++I     DVD   R++IC  + +  G++  +G+I+G  GINI+   +G+S      I
Sbjct: 471 RIVRINRFRVDVDPHARILIC-PHINRPGVIGTIGSIMGAAGINISSMQVGKSDRKGMNI 529

Query: 67  SFLCIDGSILNSVLEKL 83
             L ID  I + VL ++
Sbjct: 530 MVLTIDHDISDDVLARV 546


>gi|253576381|ref|ZP_04853711.1| phosphoglycerate dehydrogenase [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844274|gb|EES72292.1| phosphoglycerate dehydrogenase [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 529

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I +   DV     +I I + D  GI+  VG +LG+  +NIA   +GR      AI 
Sbjct: 439 RIVQIDKFPVDVAPEGHLIFISHNDKPGIIGHVGTLLGKNVVNIASMQVGRKLVGGEAIM 498

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D ++   VL++L+
Sbjct: 499 VLTVDKAVTKEVLDELT 515


>gi|238927354|ref|ZP_04659114.1| phosphoglycerate dehydrogenase [Selenomonas flueggei ATCC 43531]
 gi|238884636|gb|EEQ48274.1| phosphoglycerate dehydrogenase [Selenomonas flueggei ATCC 43531]
          Length = 565

 Score = 41.2 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 8   RFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           R ++I     DVD   R++IC  + +  G++  +G+I+G  GINI+   +G+S      I
Sbjct: 473 RIVRINRFRVDVDPHARILIC-PHINRPGVIGTIGSIMGAAGINISSMQVGKSDRKGMNI 531

Query: 67  SFLCIDGSILNSVLEKL 83
             L ID  I + VL ++
Sbjct: 532 MVLTIDHDISDDVLARV 548


>gi|410116|gb|AAA67502.1| phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 419

 Score = 40.8 bits (94), Expect = 0.056,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 40/77 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 329 RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 388

Query: 68  FLCIDGSILNSVLEKLS 84
            L  D  + + ++++L+
Sbjct: 389 MLSFDRHLEDKIVKELT 405


>gi|157692807|ref|YP_001487269.1| D-3-phosphoglycerate dehydrogenase [Bacillus pumilus SAFR-032]
 gi|157681565|gb|ABV62709.1| phosphoglycerate dehydrogenase [Bacillus pumilus SAFR-032]
          Length = 524

 Score = 40.8 bits (94), Expect = 0.057,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R + I   N D      ++ I + D  G++  VG ILG++ +NIA   +GR +    AI 
Sbjct: 435 RVVSINGFNIDFYPDGHLVYIQHTDAPGVIGKVGQILGDHDVNIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLS 84
            L  D  + + ++++L+
Sbjct: 495 MLSFDKHLEDEIVKELT 511


>gi|304406983|ref|ZP_07388637.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus curdlanolyticus
           YK9]
 gi|304343970|gb|EFM09810.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus curdlanolyticus
           YK9]
          Length = 530

 Score = 40.8 bits (94), Expect = 0.058,   Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 39/78 (50%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I     DV     +I I + D  GI+  VG +LG   +NIA   +GR      AI
Sbjct: 439 PRIVQIDSYPVDVAPEGNLILISHNDKPGIIGRVGTLLGSNDVNIAAMQVGRKLVGGAAI 498

Query: 67  SFLCIDGSILNSVLEKLS 84
             L +D     SV+E+++
Sbjct: 499 MVLTVDKGAAKSVIEEVA 516


>gi|302865806|ref|YP_003834443.1| D-3-phosphoglycerate dehydrogenase [Micromonospora aurantiaca ATCC
           27029]
 gi|315502351|ref|YP_004081238.1| d-3-phosphoglycerate dehydrogenase [Micromonospora sp. L5]
 gi|302568665|gb|ADL44867.1| D-3-phosphoglycerate dehydrogenase [Micromonospora aurantiaca ATCC
           27029]
 gi|315408970|gb|ADU07087.1| D-3-phosphoglycerate dehydrogenase [Micromonospora sp. L5]
          Length = 532

 Score = 40.8 bits (94), Expect = 0.058,   Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 42/74 (56%), Gaps = 3/74 (4%)

Query: 5   GKPRFIKIQEIN-FDVDIGR--LMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           G     K+ E++ FDV+IG   +++ +  AD  G+V  VG +LGE G+NIA   + R ++
Sbjct: 434 GTRDVFKLTEVDGFDVEIGAEGILVFLRYADRPGVVGTVGTLLGEAGVNIAAMQVARREA 493

Query: 62  TEHAISFLCIDGSI 75
               +  L +D ++
Sbjct: 494 GGETLMTLTVDQAL 507


>gi|194016714|ref|ZP_03055327.1| phosphoglycerate dehydrogenase [Bacillus pumilus ATCC 7061]
 gi|194011320|gb|EDW20889.1| phosphoglycerate dehydrogenase [Bacillus pumilus ATCC 7061]
          Length = 524

 Score = 40.8 bits (94), Expect = 0.058,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R + I   N D      ++ I + D  G++  VG ILG++ +NIA   +GR +    AI 
Sbjct: 435 RVVSINGFNIDFYPDGHLVYIQHTDAPGVIGKVGQILGDHDVNIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLS 84
            L  D  + + ++++L+
Sbjct: 495 MLSFDKHLEDEIVKELT 511


>gi|158334453|ref|YP_001515625.1| D-3-phosphoglycerate dehydrogenase [Acaryochloris marina MBIC11017]
 gi|158304694|gb|ABW26311.1| D-3-phosphoglycerate dehydrogenase [Acaryochloris marina MBIC11017]
          Length = 527

 Score = 40.8 bits (94), Expect = 0.058,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 42/84 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  + + R   I +   +V   R M+  V+ D+ GI+  +G+ LG + +NIA   +GR  
Sbjct: 430 ILGEDELRITNIDDFPINVVPTRHMLLTVHRDMPGIIGQIGSQLGSFNVNIASMQVGRKM 489

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               A+  L +D  +   VL +++
Sbjct: 490 VRGSAVMVLSLDDPLPEGVLSEIT 513


>gi|125624524|ref|YP_001033007.1| L-serine dehydratase beta subunit [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|124493332|emb|CAL98305.1| L-serine dehydratase beta subunit [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300071318|gb|ADJ60718.1| L-serine dehydratase beta subunit [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 223

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 3/80 (3%)

Query: 9   FIKIQEIN-FDVDI--GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
            I++ E+N FD+ I  G     +++ D+ G++  V ++L E+ INIA  ++ R    E A
Sbjct: 133 MIQVTELNGFDIAISAGVPTFVVIHEDVPGMIARVSSVLSEHQINIAQMNVTREAKGEKA 192

Query: 66  ISFLCIDGSILNSVLEKLSV 85
           I  L +D   +  V+E++ +
Sbjct: 193 IMILEVDIPNVKEVIEEMKL 212


>gi|32474150|ref|NP_867144.1| D-3-phosphoglycerate dehydrogenase [Rhodopirellula baltica SH 1]
 gi|32444687|emb|CAD74689.1| phosphoglycerate dehydrogenase [Rhodopirellula baltica SH 1]
 gi|327541027|gb|EGF27580.1| D-3-phosphoglycerate dehydrogenase [Rhodopirellula baltica WH47]
          Length = 540

 Score = 40.8 bits (94), Expect = 0.058,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE--H 64
           PR I +     +  +   ++  V+ D+ GI+  VG   G +G+NIA   +GR        
Sbjct: 437 PRLILVNGYRLESFLDGKLLVFVHKDVPGIIGRVGTTFGSHGVNIAQMAVGREGDAPGGA 496

Query: 65  AISFLCIDGSILNSVLEKL 83
           AI  L +DG +  + L+ L
Sbjct: 497 AIGVLSLDGEVPTAALDDL 515


>gi|320529979|ref|ZP_08031055.1| phosphoglycerate dehydrogenase [Selenomonas artemidis F0399]
 gi|320137776|gb|EFW29682.1| phosphoglycerate dehydrogenase [Selenomonas artemidis F0399]
          Length = 534

 Score = 40.8 bits (94), Expect = 0.059,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 8   RFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           R ++I     DVD   R++IC  + +  G++  +G+I+GE G+NI+   +G+S      I
Sbjct: 442 RIVRINRFRVDVDPHARILIC-PHINRPGVIGTIGSIMGEAGVNISAMQVGKSDRAGTNI 500

Query: 67  SFLCIDGSILNSVLEKL 83
             L +D  I +  L ++
Sbjct: 501 MVLTVDHDISDETLARV 517


>gi|167998192|ref|XP_001751802.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162696900|gb|EDQ83237.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 122

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%)

Query: 7  PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
          P  +K+   N D+ +   +I   + D  G++  VG+ILGE  +NIA   +GR    + AI
Sbjct: 4  PHLLKVGNFNVDMSLEGSIILYRHVDQSGMIEKVGSILGEENVNIAFMSVGRMVRGQDAI 63

Query: 67 SFLCIDGSILNSVLEK 82
               D  +  S+L+K
Sbjct: 64 VAFGTDEELSKSILQK 79


>gi|37521708|ref|NP_925085.1| D-3-phosphoglycerate dehydrogenase [Gloeobacter violaceus PCC 7421]
 gi|35212706|dbj|BAC90080.1| D-3-phosphoglycerate dehydrogenase [Gloeobacter violaceus PCC 7421]
          Length = 526

 Score = 40.8 bits (94), Expect = 0.060,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 43/90 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + ++ + R   I E    V   R M+  ++ D+ GI+  VG+ LG Y +NIA   +GR  
Sbjct: 430 LLAEDELRITNIDEFPISVAPSRYMLITLHRDMPGIIGKVGSFLGSYNVNIAGMQVGRKL 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A+  + +D  +   +L ++     IR
Sbjct: 490 VRGDAVMMVSLDDPLPEGLLGEIESVPGIR 519


>gi|308274573|emb|CBX31172.1| D-3-phosphoglycerate dehydrogenase [uncultured Desulfobacterium
           sp.]
          Length = 526

 Score = 40.8 bits (94), Expect = 0.061,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 41/97 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I     ++     +  + N D  G +  +G +LG   INI    +G+ +
Sbjct: 430 IFGKKDPRIVRINNFRLEMHPSGHLALVHNLDKPGAIGSIGTVLGRNSINIGRMQVGQEE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E  I  L  D  I   VLE+L     ++ V   E 
Sbjct: 490 EGERNIILLKTDLPIPEPVLEELKALPLVKTVTLLEL 526


>gi|159897613|ref|YP_001543860.1| D-3-phosphoglycerate dehydrogenase [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890652|gb|ABX03732.1| D-3-phosphoglycerate dehydrogenase [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 524

 Score = 40.8 bits (94), Expect = 0.061,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 41/85 (48%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+   ++I E   D+     M+   + D  G +  +G +LG   INI+  H+GRS     
Sbjct: 432 GEAHIVQINEFWLDLVPTSSMLFTFHQDRPGFIGRIGTLLGTADINISAMHVGRSSPRGT 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTI 89
           AI  L +D +I +  L  ++  V I
Sbjct: 492 AIMVLTVDEAIPSETLTDINNQVDI 516


>gi|294815271|ref|ZP_06773914.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
 gi|294327870|gb|EFG09513.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 538

 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 42/80 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I + + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R +    A+ 
Sbjct: 447 KIVAIGDHDVDLALADHMLVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRHEEGGEALV 506

Query: 68  FLCIDGSILNSVLEKLSVNV 87
            L +D ++   V+ ++S  +
Sbjct: 507 VLTVDDTVPVPVIAEISAEI 526


>gi|326443626|ref|ZP_08218360.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 525

 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 42/80 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I + + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R +    A+ 
Sbjct: 434 KIVAIGDHDVDLALADHMLVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRHEEGGEALV 493

Query: 68  FLCIDGSILNSVLEKLSVNV 87
            L +D ++   V+ ++S  +
Sbjct: 494 VLTVDDTVPVPVIAEISAEI 513


>gi|254392671|ref|ZP_05007846.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
 gi|197706333|gb|EDY52145.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 532

 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 42/80 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I + + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R +    A+ 
Sbjct: 441 KIVAIGDHDVDLALADHMLVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRHEEGGEALV 500

Query: 68  FLCIDGSILNSVLEKLSVNV 87
            L +D ++   V+ ++S  +
Sbjct: 501 VLTVDDTVPVPVIAEISAEI 520


>gi|254422032|ref|ZP_05035750.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7335]
 gi|196189521|gb|EDX84485.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7335]
          Length = 526

 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 42/83 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR      A+ 
Sbjct: 437 RIIDMDGFPINVPPTQYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKIVRGDAVM 496

Query: 68  FLCIDGSILNSVLEKLSVNVTIR 90
            L ID  +   +LE++     IR
Sbjct: 497 VLSIDDPLPAGILEEIKKEQGIR 519


>gi|154174389|ref|YP_001407860.1| D-3-phosphoglycerate dehydrogenase [Campylobacter curvus 525.92]
 gi|112803368|gb|EAU00712.1| phosphoglycerate dehydrogenase [Campylobacter curvus 525.92]
          Length = 525

 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + I     D      MI   N D+ G++  +  IL +  INIA F LGR  
Sbjct: 430 VFGETEQRIVGINGFKTDFKPKGKMIIFKNHDVPGVIAQISKILADEKINIADFRLGRGD 489

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
           +   A++ + +D +I    L KL+
Sbjct: 490 NG-MALAVILVDENISKETLTKLN 512


>gi|51891147|ref|YP_073838.1| D-3-phosphoglycerate dehydrogenase [Symbiobacterium thermophilum
           IAM 14863]
 gi|51854836|dbj|BAD38994.1| phosphoglycerate dehydrogenase [Symbiobacterium thermophilum IAM
           14863]
          Length = 540

 Score = 40.8 bits (94), Expect = 0.062,   Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 34/69 (49%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG  RF+ +  ++ D+   R M+   + D  G+V   G  L    INIA  HLGR Q   
Sbjct: 441 DGGMRFVAVDGLHIDMAPSRHMLVSQHRDQPGMVGRFGMALAARDINIAGLHLGRHQPRG 500

Query: 64  HAISFLCID 72
            A+  L ID
Sbjct: 501 MALMLLQID 509


>gi|254478955|ref|ZP_05092315.1| ACT domain protein [Carboxydibrachium pacificum DSM 12653]
 gi|214035101|gb|EEB75815.1| ACT domain protein [Carboxydibrachium pacificum DSM 12653]
          Length = 256

 Score = 40.8 bits (94), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 13  QEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCID 72
            ++NF+      M+ + N D+ G++  +GN+LG++GINI+   +  +++   A+  +  D
Sbjct: 172 HKVNFEPT--EYMLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDGTALMLVSTD 229

Query: 73  GSILNSVLEKLS 84
             I    +E L+
Sbjct: 230 KEIPEEAVESLN 241


>gi|55379323|ref|YP_137173.1| D-3-phosphoglycerate dehydrogenase [Haloarcula marismortui ATCC
           43049]
 gi|55232048|gb|AAV47467.1| D-3-phosphoglycerate dehydrogenase [Haloarcula marismortui ATCC
           43049]
          Length = 528

 Score = 40.8 bits (94), Expect = 0.065,   Method: Composition-based stats.
 Identities = 24/83 (28%), Positives = 40/83 (48%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F   +PR ++I +   +      M+ + N D  G + F+G +LGE  INIA    GR   
Sbjct: 430 FGGEEPRIVRIDDHRIEAVPHGHMLVVRNRDEPGTIGFIGTVLGEADINIAGMFNGRETI 489

Query: 62  TEHAISFLCIDGSILNSVLEKLS 84
              A+S   +D      ++E+L+
Sbjct: 490 GGEALSVYNLDEQPPQDIIERLN 512


>gi|296270774|ref|YP_003653406.1| D-3-phosphoglycerate dehydrogenase [Thermobispora bispora DSM
           43833]
 gi|296093561|gb|ADG89513.1| D-3-phosphoglycerate dehydrogenase [Thermobispora bispora DSM
           43833]
          Length = 529

 Score = 40.8 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 3/82 (3%)

Query: 5   GKPRFIKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           G  + +KI E+N    +++    +      D  GIV  VG ILGE+GINIA   + R+  
Sbjct: 432 GPRQIMKIVEVNGFAMEIEPTDHLAFFTYIDRPGIVGVVGRILGEHGINIASMQVSRNVK 491

Query: 62  TEHAISFLCIDGSILNSVLEKL 83
              A+  L +D +I + ++E++
Sbjct: 492 GGKALIALTVDSAIPSELVEEI 513


>gi|289168806|ref|YP_003447075.1| L-serine dehydratase, beta subunit [Streptococcus mitis B6]
 gi|288908373|emb|CBJ23215.1| L-serine dehydratase, beta subunit [Streptococcus mitis B6]
          Length = 223

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAGEKAI 193

Query: 67  SFLCID 72
             + +D
Sbjct: 194 MIIEVD 199


>gi|312144313|ref|YP_003995759.1| D-3-phosphoglycerate dehydrogenase [Halanaerobium sp.
           'sapolanicus']
 gi|311904964|gb|ADQ15405.1| D-3-phosphoglycerate dehydrogenase [Halanaerobium sp.
           'sapolanicus']
          Length = 534

 Score = 40.8 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 38/76 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I+I  +  D+D+    I +   D  G++  +G  LGE  INIA+  +GR  +   A+ 
Sbjct: 440 RVIEINGLRIDLDLSGEFIIVTYQDKPGVIGKIGTSLGEENINIANMQVGRQTAGGEAVM 499

Query: 68  FLCIDGSILNSVLEKL 83
            + ID       ++K+
Sbjct: 500 LMQIDSKPSPETMKKI 515


>gi|257386858|ref|YP_003176631.1| D-3-phosphoglycerate dehydrogenase [Halomicrobium mukohataei DSM
           12286]
 gi|257169165|gb|ACV46924.1| D-3-phosphoglycerate dehydrogenase [Halomicrobium mukohataei DSM
           12286]
          Length = 529

 Score = 40.8 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 40/83 (48%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F+   PR ++I +   D      M+   N D  G + F+G +LGE  INIA    GR   
Sbjct: 430 FAGEDPRIVRIDDHRVDAVPHGHMLVARNRDEPGTIGFIGTVLGESDINIAGMFNGREVI 489

Query: 62  TEHAISFLCIDGSILNSVLEKLS 84
              A+S   +D    + VL++L+
Sbjct: 490 GGEALSVYNLDEPPTSDVLDRLN 512


>gi|313896711|ref|ZP_07830259.1| putative phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312974628|gb|EFR40095.1| putative phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 366

 Score = 40.4 bits (93), Expect = 0.071,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 8   RFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           R ++I     DVD   R++IC  + +  G++  +G+I+GE G+NI+   +G+S      I
Sbjct: 274 RIVRINRFRVDVDPHARILIC-PHINRPGVIGTIGSIMGEAGVNISAMQVGKSDRAGTNI 332

Query: 67  SFLCIDGSILNSVLEKL 83
             L +D  I +  L ++
Sbjct: 333 MVLTVDHDISDETLARV 349


>gi|55821319|ref|YP_139761.1| L-serine dehydratase subunit beta [Streptococcus thermophilus LMG
           18311]
 gi|55823231|ref|YP_141672.1| L-serine dehydratase subunit beta [Streptococcus thermophilus
           CNRZ1066]
 gi|55737304|gb|AAV60946.1| L-serine dehydratase beta subunit [Streptococcus thermophilus LMG
           18311]
 gi|55739216|gb|AAV62857.1| L-serine dehydratase beta subunit [Streptococcus thermophilus
           CNRZ1066]
          Length = 237

 Score = 40.4 bits (93), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N    ++ +    + IV+ D+ G+V  V +IL  YGINIA   + R  + E AI
Sbjct: 148 IQVTELNGFAVNLKMNTPTLIIVHQDVPGMVALVTDILSRYGINIAQMTVTRENAGEKAI 207

Query: 67  SFLCID 72
             + +D
Sbjct: 208 MIIEVD 213


>gi|94984817|ref|YP_604181.1| D-3-phosphoglycerate dehydrogenase [Deinococcus geothermalis DSM
           11300]
 gi|94555098|gb|ABF45012.1| D-3-phosphoglycerate dehydrogenase [Deinococcus geothermalis DSM
           11300]
          Length = 542

 Score = 40.4 bits (93), Expect = 0.073,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR  ++++   ++     ++   N D  G V  + N+LG +GINIA   LGR+Q    A+
Sbjct: 452 PRLTRLRDYRVELAPEGFILIASNQDRPGAVAKLSNLLGTWGINIAGMALGRAQKGGQAL 511

Query: 67  SFLCIDGSILNSVLEKL 83
             L +D  +    L+ +
Sbjct: 512 FTLTLDDGLTPEQLQAI 528


>gi|297568578|ref|YP_003689922.1| D-3-phosphoglycerate dehydrogenase [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924493|gb|ADH85303.1| D-3-phosphoglycerate dehydrogenase [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 528

 Score = 40.4 bits (93), Expect = 0.075,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 41/83 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   +PR ++      +      M+ + N D+ G++  + + +G+ G+NIA   +GR Q
Sbjct: 431 VFGKKEPRLVRFNTFRLEALPEGPMLFVHNNDVPGVIGKLASTIGDAGVNIARMTVGREQ 490

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
            +   I  L  D  +   +L+K+
Sbjct: 491 DSGRNIILLNTDSLLDRELLKKV 513


>gi|224113315|ref|XP_002316453.1| predicted protein [Populus trichocarpa]
 gi|222865493|gb|EEF02624.1| predicted protein [Populus trichocarpa]
          Length = 633

 Score = 40.4 bits (93), Expect = 0.079,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 2/70 (2%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +G P   ++   + DV + G L++C    D  G++  VGNILGE  +N++   +GR+   
Sbjct: 540 NGIPHLTQVGSFSVDVSLEGNLILC-RQVDQPGMIGQVGNILGEQNVNVSFMSVGRTARR 598

Query: 63  EHAISFLCID 72
            +AI  + +D
Sbjct: 599 RNAIMAIGVD 608


>gi|284992450|ref|YP_003411004.1| D-3-phosphoglycerate dehydrogenase [Geodermatophilus obscurus DSM
           43160]
 gi|284065695|gb|ADB76633.1| D-3-phosphoglycerate dehydrogenase [Geodermatophilus obscurus DSM
           43160]
          Length = 533

 Score = 40.4 bits (93), Expect = 0.081,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 41/84 (48%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           P+ +++   + D+D    ++  V  D  G+V  VG  LGE GINIA   + R+     A+
Sbjct: 440 PKLVEVNGFDMDLDAAGYLLFFVYTDRPGVVGTVGAALGEAGINIAGAQVSRTTRGGEAL 499

Query: 67  SFLCIDGSILNSVLEKLSVNVTIR 90
             + +D  +   +L  ++  +  R
Sbjct: 500 MAVTVDSPVPAELLGDIAGRIGAR 523


>gi|218247173|ref|YP_002372544.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8801]
 gi|257060245|ref|YP_003138133.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8802]
 gi|218167651|gb|ACK66388.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8801]
 gi|256590411|gb|ACV01298.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8802]
          Length = 525

 Score = 40.4 bits (93), Expect = 0.081,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 44/90 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  DG+ R   +     +V     M+  V+ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLGDGEIRITDVDGFPINVPPSNYMLFTVHRDMPGIIGKIGSLLGGFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A+  L +D  +   +L +++    IR
Sbjct: 489 VRGDAVMALSLDDPLPEGLLSEITKVAGIR 518


>gi|228477732|ref|ZP_04062361.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus salivarius SK126]
 gi|228250621|gb|EEK09832.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus salivarius SK126]
          Length = 223

 Score = 40.4 bits (93), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N    ++ +    + IV+ D+ G++  V +IL  YGINIA   + R  + E AI
Sbjct: 134 IQVTELNGFAVNLKMNTPTLIIVHQDVPGMIALVTDILSRYGINIAQMTVTRENAGEKAI 193

Query: 67  SFLCID 72
             + ID
Sbjct: 194 MIIEID 199


>gi|224137644|ref|XP_002327177.1| predicted protein [Populus trichocarpa]
 gi|222835492|gb|EEE73927.1| predicted protein [Populus trichocarpa]
          Length = 597

 Score = 40.4 bits (93), Expect = 0.083,   Method: Composition-based stats.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DGKP    +     DV + G L++C    D  G+V  VG+ILGE  +N++   +GR    
Sbjct: 504 DGKPHLTMVGSFGVDVSMEGSLILC-RQVDQPGMVGSVGSILGEENVNVSFMSVGRIAPR 562

Query: 63  EHAISFLCIDGSILNSVLEKL 83
           + A+  + +D       L+++
Sbjct: 563 KQAVMTIGVDEEPSKEALKRI 583


>gi|325963764|ref|YP_004241670.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469851|gb|ADX73536.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 529

 Score = 40.4 bits (93), Expect = 0.083,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I     ++ I   ++ +   D  G++  +G+ILG   INIA   + RS      ++
Sbjct: 438 KLVGINGFEVEIPISEHLVVVGYTDRPGVIGTIGHILGMNNINIAGMQVARSDEGGQVLA 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L ID ++   VL+ +   +    V++ + 
Sbjct: 498 LLTIDSAVPQQVLDAIKAGIGADMVREVDL 527


>gi|221310225|ref|ZP_03592072.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221319470|ref|ZP_03600764.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323746|ref|ZP_03605040.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. SMY]
          Length = 525

 Score = 40.4 bits (93), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLS 84
            L  D  + + ++++L+
Sbjct: 495 MLSFDRHLEDKIVKELT 511


>gi|220917793|ref|YP_002493097.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955647|gb|ACL66031.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 528

 Score = 40.4 bits (93), Expect = 0.084,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 1   VFSDGKPRFIKIQEINFD-VDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           V+   + R +++     + V  G +++C  N D  G+V  +G  LG  G+NIA   L R 
Sbjct: 432 VYGKREARLVRVDGFRLEAVPEGHVILC-ENDDAPGVVGNLGTALGAAGVNIARISLSRL 490

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
                A +FL +D +    VLE++     +R V+
Sbjct: 491 DDHSRAFAFLNVDSAPAPGVLEQVRRLPHVRTVR 524


>gi|300866531|ref|ZP_07111221.1| D-3-phosphoglycerate dehydrogenase [Oscillatoria sp. PCC 6506]
 gi|300335488|emb|CBN56381.1| D-3-phosphoglycerate dehydrogenase [Oscillatoria sp. PCC 6506]
          Length = 527

 Score = 40.4 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 42/83 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  + + R   + E   +V   R M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 VLGEDEIRITSVDEFPVNVSPSRHMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRRI 490

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+  L +D  +   +L ++
Sbjct: 491 VRGDAVMVLSLDDPLPEGILAEI 513


>gi|116628041|ref|YP_820660.1| L-serine dehydratase beta subunit [Streptococcus thermophilus
           LMD-9]
 gi|116101318|gb|ABJ66464.1| L-serine ammonia-lyase [Streptococcus thermophilus LMD-9]
          Length = 223

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N    ++ +    + IV+ D+ G+V  V +IL  YGINIA   + R  + E AI
Sbjct: 134 IQVTELNGFAVNLKMNTPTLIIVHQDVPGMVALVTDILSRYGINIAQMTVTRENAGEKAI 193

Query: 67  SFLCID 72
             + +D
Sbjct: 194 MIIEVD 199


>gi|1146196|gb|AAC83943.1| phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 525

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLS 84
            L  D  + + ++++L+
Sbjct: 495 MLSFDRHLEDKIVKELT 511


>gi|197123004|ref|YP_002134955.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. K]
 gi|196172853|gb|ACG73826.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. K]
          Length = 528

 Score = 40.4 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 1   VFSDGKPRFIKIQEINFD-VDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           V+   + R +++     + V  G +++C  N D  G+V  +G  LG  G+NIA   L R 
Sbjct: 432 VYGKREARLVRVDGFRLEAVPEGHVILC-ENDDAPGVVGNLGTALGAAGVNIARISLSRL 490

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
                A +FL +D +    VLE++     +R V+
Sbjct: 491 DDHSRAFAFLNVDSAPAPGVLEQVRRLPHVRAVR 524


>gi|86157688|ref|YP_464473.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774199|gb|ABC81036.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 528

 Score = 40.4 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 2/94 (2%)

Query: 1   VFSDGKPRFIKIQEINFD-VDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           V+   + R +++     + V  G +++C  N D  G+V  +G  LG  G+NIA   L R 
Sbjct: 432 VYGKREARLVRVDGFRLEAVPEGHVILC-ENDDAPGVVGNLGTALGAAGVNIARISLSRL 490

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
                A +FL +D +    VLE++     +R V+
Sbjct: 491 DDHSRAFAFLNVDSAPAPGVLEQVRRLPHVRAVR 524


>gi|312863760|ref|ZP_07723998.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus vestibularis F0396]
 gi|322516529|ref|ZP_08069445.1| L-serine ammonia-lyase beta subunit [Streptococcus vestibularis
           ATCC 49124]
 gi|311101296|gb|EFQ59501.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus vestibularis F0396]
 gi|322124917|gb|EFX96337.1| L-serine ammonia-lyase beta subunit [Streptococcus vestibularis
           ATCC 49124]
          Length = 223

 Score = 40.4 bits (93), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N    ++ +    + IV+ D+ G++  V +IL  YGINIA   + R  + E AI
Sbjct: 134 IQVTELNGFAVNLKMNTPTLIIVHQDVPGMIALVTDILSRYGINIAQMTVTRENAGEKAI 193

Query: 67  SFLCID 72
             + ID
Sbjct: 194 MIIEID 199


>gi|221314548|ref|ZP_03596353.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|255767495|ref|NP_390188.2| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|321311779|ref|YP_004204066.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis BSn5]
 gi|251757445|sp|P35136|SERA_BACSU RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|225185123|emb|CAB14239.2| 3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291484735|dbj|BAI85810.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp. natto
           BEST195]
 gi|320018053|gb|ADV93039.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis BSn5]
          Length = 525

 Score = 40.4 bits (93), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLS 84
            L  D  + + ++++L+
Sbjct: 495 MLSFDRHLEDKIVKELT 511


>gi|22297868|ref|NP_681115.1| D-3-phosphoglycerate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
 gi|22294046|dbj|BAC07877.1| D-3-phosphoglycerate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
          Length = 527

 Score = 40.4 bits (93), Expect = 0.089,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 41/83 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S  + R   I +    V   R M+  ++ D+ GI+  +G  LG + +NIA   +GR  
Sbjct: 431 LLSHNELRITSIDDFPISVAPTRYMLLTLHRDMPGIIGKIGTQLGSFNVNIASMQVGRKM 490

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
              +A+  + +D  +   +LE++
Sbjct: 491 VRGNAVMVISLDDPLPEGLLEEI 513


>gi|223039567|ref|ZP_03609854.1| phosphoglycerate dehydrogenase [Campylobacter rectus RM3267]
 gi|222879138|gb|EEF14232.1| phosphoglycerate dehydrogenase [Campylobacter rectus RM3267]
          Length = 525

 Score = 40.4 bits (93), Expect = 0.091,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 1/84 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + I     D      MI   N D+ G++  +  IL    INIA F LGR  
Sbjct: 430 VFGENQQRIVTINGFKTDFKPKGKMIIFKNNDVPGVIAQISTILAAEKINIADFRLGRDD 489

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               A++ + +D  I    L KL+
Sbjct: 490 HG-MALAVVLVDEKITKETLAKLN 512


>gi|257054946|ref|YP_003132778.1| D-3-phosphoglycerate dehydrogenase [Saccharomonospora viridis DSM
           43017]
 gi|256584818|gb|ACU95951.1| D-3-phosphoglycerate dehydrogenase [Saccharomonospora viridis DSM
           43017]
          Length = 531

 Score = 40.0 bits (92), Expect = 0.092,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 3/97 (3%)

Query: 5   GKPRFIKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           GK    K+ E+N   FD+     M+ +   D  GI+  VG +LGE GINI    + ++ +
Sbjct: 435 GKDDVHKLIEVNGRHFDIRAEGHMLLLEYPDRPGIMGRVGTLLGEAGINIEAAQISQTTN 494

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
              A+  L +D ++   +L+ +   V  + ++   F+
Sbjct: 495 RADAVMLLRVDRAVNAHMLDPIGATVDAKMIRAVNFD 531


>gi|305674943|ref|YP_003866615.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|305413187|gb|ADM38306.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 525

 Score = 40.0 bits (92), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLS 84
            L  D  + + ++++L+
Sbjct: 495 MLSFDRHLEDKIVKELT 511


>gi|297832018|ref|XP_002883891.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297329731|gb|EFH60150.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 602

 Score = 40.0 bits (92), Expect = 0.094,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 3/94 (3%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG ILGE  +N++   +GR    +
Sbjct: 509 DGVPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGTVGRILGESNVNVSFMSVGRIAPRK 568

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  + +D       L+K+     I  V++F F
Sbjct: 569 QAVMAIGVDDMPSKETLKKIG---EIPAVEEFVF 599


>gi|296332953|ref|ZP_06875410.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|296149804|gb|EFG90696.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
          Length = 517

 Score = 40.0 bits (92), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLS 84
            L  D  + + ++++L+
Sbjct: 495 MLSFDRHLEDKIVKELT 511


>gi|168700983|ref|ZP_02733260.1| phosphoglycerate dehydrogenase [Gemmata obscuriglobus UQM 2246]
          Length = 539

 Score = 40.0 bits (92), Expect = 0.096,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 38/72 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F D   R +++     +  +  +++   + D+ G++ FVG I G++ +NIA   +GR+ 
Sbjct: 432 LFGDQYVRLVQLGPFRMEGYLDGVLLVFRHHDVPGLIGFVGTIFGKHKVNIAQMTVGRTS 491

Query: 61  STEHAISFLCID 72
               AI  L +D
Sbjct: 492 PGGEAIGILNLD 503


>gi|196233471|ref|ZP_03132314.1| D-3-phosphoglycerate dehydrogenase [Chthoniobacter flavus Ellin428]
 gi|196222467|gb|EDY16994.1| D-3-phosphoglycerate dehydrogenase [Chthoniobacter flavus Ellin428]
          Length = 530

 Score = 40.0 bits (92), Expect = 0.099,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 46/92 (50%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F    PR +K+   + +     ++    N D  G+V  VG +LG++ +NIA   L R++ 
Sbjct: 435 FFGTTPRIVKVNGRHVEAKPEGVLFLFENRDRPGVVGHVGTLLGKHKVNIAGMSLSRNEE 494

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
              A++ L +D     +++++L+    I  V+
Sbjct: 495 GGEALTLLNLDSVPSEAIIKELTAGGDIHSVQ 526


>gi|322373174|ref|ZP_08047710.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus sp. C150]
 gi|321278216|gb|EFX55285.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus sp. C150]
          Length = 223

 Score = 40.0 bits (92), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N    ++ +    + IV+ D+ G++  V +IL  YGINIA   + R  + E AI
Sbjct: 134 IQVTELNGFAVNLKMNTPTLIIVHQDVPGMIALVTDILSRYGINIAQMTVTRENAGEKAI 193

Query: 67  SFLCID 72
             + ID
Sbjct: 194 MIIEID 199


>gi|242096578|ref|XP_002438779.1| hypothetical protein SORBIDRAFT_10g026070 [Sorghum bicolor]
 gi|241917002|gb|EER90146.1| hypothetical protein SORBIDRAFT_10g026070 [Sorghum bicolor]
          Length = 613

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 4   DGKPRFIKIQEINFDVD-IGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG P    +     DV  +G L++C    D  GI+  VG+ILG+  +N++   +GR+   
Sbjct: 520 DGAPHLTLVGSFRVDVSLVGNLILC-CQVDQPGIIGKVGSILGKMNVNVSFMSVGRTAPG 578

Query: 63  EHAISFLCID 72
           + AI  + +D
Sbjct: 579 KQAIMAIGVD 588


>gi|125598081|gb|EAZ37861.1| hypothetical protein OsJ_22207 [Oryza sativa Japonica Group]
          Length = 613

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DGKP    +   + DV + G L++C    D  GI+  VG+ILG+  +N+    +GR+   
Sbjct: 520 DGKPHLTLVGPFSVDVSLEGNLILC-RQVDQPGIIGKVGSILGKMNVNVNFMSVGRTAPG 578

Query: 63  EHAISFLCID 72
           + AI  + +D
Sbjct: 579 KQAIMAIGVD 588


>gi|125556326|gb|EAZ01932.1| hypothetical protein OsI_23958 [Oryza sativa Indica Group]
          Length = 613

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DGKP    +   + DV + G L++C    D  GI+  VG+ILG+  +N+    +GR+   
Sbjct: 520 DGKPHLTLVGPFSVDVSLEGNLILC-RQVDQPGIIGKVGSILGKMNVNVNFMSVGRTAPG 578

Query: 63  EHAISFLCID 72
           + AI  + +D
Sbjct: 579 KQAIMAIGVD 588


>gi|115469298|ref|NP_001058248.1| Os06g0655100 [Oryza sativa Japonica Group]
 gi|113596288|dbj|BAF20162.1| Os06g0655100 [Oryza sativa Japonica Group]
          Length = 629

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DGKP    +   + DV + G L++C    D  GI+  VG+ILG+  +N+    +GR+   
Sbjct: 536 DGKPHLTLVGPFSVDVSLEGNLILC-RQVDQPGIIGKVGSILGKMNVNVNFMSVGRTAPG 594

Query: 63  EHAISFLCID 72
           + AI  + +D
Sbjct: 595 KQAIMAIGVD 604


>gi|51535610|dbj|BAD37553.1| putative D-3 [Oryza sativa Japonica Group]
 gi|51536377|dbj|BAD37570.1| putative D-3 [Oryza sativa Japonica Group]
          Length = 625

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DGKP    +   + DV + G L++C    D  GI+  VG+ILG+  +N+    +GR+   
Sbjct: 532 DGKPHLTLVGPFSVDVSLEGNLILC-RQVDQPGIIGKVGSILGKMNVNVNFMSVGRTAPG 590

Query: 63  EHAISFLCID 72
           + AI  + +D
Sbjct: 591 KQAIMAIGVD 600


>gi|212639604|ref|YP_002316124.1| L-serine dehydratase subunit beta [Anoxybacillus flavithermus WK1]
 gi|212561084|gb|ACJ34139.1| L-serine dehydratase (beta chain) [Anoxybacillus flavithermus WK1]
          Length = 245

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 35/60 (58%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSV 85
           + I++ D  G +  V N+L +Y INI H  + R +  + A+  + +D +I ++++E+L  
Sbjct: 174 LLIMHNDRYGAIAGVANVLAKYAINIGHMEVSRKEKGKQALMTIEVDQNIDDAIVEQLKA 233


>gi|159031923|dbj|BAF91727.1| 3-phosphoglycerate dehydrogenase [Aphanothece halophytica]
          Length = 526

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 42/83 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SD + R   +     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLSDQEMRITNVDGFPINVPPNNYMLFTLHRDMPGIIGKIGSLLGGFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+  L ID  +   VL+++
Sbjct: 490 VRGDAVMVLSIDDPLPEGVLDEI 512


>gi|302781158|ref|XP_002972353.1| hypothetical protein SELMODRAFT_413029 [Selaginella moellendorffii]
 gi|300159820|gb|EFJ26439.1| hypothetical protein SELMODRAFT_413029 [Selaginella moellendorffii]
          Length = 627

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   ++ + + DV +   +I     D  GI+  VG +LG+  +N++   +GR+   +
Sbjct: 534 DGLPHLSQVGQFSMDVSLEGSVILCKQVDQPGIIGKVGGLLGDGNVNVSFMSVGRTSPRK 593

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  + +D      VL ++     I  V++F F
Sbjct: 594 QAVMAIGVDEEPSKEVLHRIG---AIPAVEEFVF 624


>gi|323704756|ref|ZP_08116333.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535682|gb|EGB25456.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 533

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 36/60 (60%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           M+ + N D+ G++  +GN+LG++GINI+  H+  +++   A+  +  D  I    +E L+
Sbjct: 459 MLFVKNKDVPGVIGHIGNVLGDFGINISSMHVSPNKNDGTALMIVNTDREIPIEAVESLN 518


>gi|295696411|ref|YP_003589649.1| D-3-phosphoglycerate dehydrogenase [Bacillus tusciae DSM 2912]
 gi|295412013|gb|ADG06505.1| D-3-phosphoglycerate dehydrogenase [Bacillus tusciae DSM 2912]
          Length = 527

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 39/75 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR ++I   + DV     ++   + D  GI+  VG++LG  G+NIA   +GR +
Sbjct: 431 LFNGLGPRIVQIDGYSVDVAPQGTLLITRHIDQPGIIGQVGSLLGAAGVNIAAMQVGRKE 490

Query: 61  STEHAISFLCIDGSI 75
               A+  L +D  +
Sbjct: 491 LGGQAVMVLAVDKPV 505


>gi|255568067|ref|XP_002525010.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223535718|gb|EEF37382.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 633

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G P   ++     DV + G L++C    D  G++  VGNILGE+ +N++   +GR+    
Sbjct: 541 GIPHLTRVGSFAVDVSLEGNLILC-RQVDQPGMIGRVGNILGEHNVNVSFMSVGRTVRRN 599

Query: 64  HAISFLCID 72
            AI  + +D
Sbjct: 600 QAIMAIGVD 608


>gi|311068824|ref|YP_003973747.1| D-3-phosphoglycerate dehydrogenase [Bacillus atrophaeus 1942]
 gi|310869341|gb|ADP32816.1| D-3-phosphoglycerate dehydrogenase [Bacillus atrophaeus 1942]
          Length = 525

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVELNGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLS 84
            L  D  +   V+ +LS
Sbjct: 495 MLSFDRHLEEKVVNELS 511


>gi|302786926|ref|XP_002975234.1| hypothetical protein SELMODRAFT_102593 [Selaginella moellendorffii]
 gi|300157393|gb|EFJ24019.1| hypothetical protein SELMODRAFT_102593 [Selaginella moellendorffii]
          Length = 629

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 40/80 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   ++   + DV +   +I     D  G++  VG +LG+  +NI+   +GR+   +
Sbjct: 536 DGVPHLSQVGSFSIDVSLEGSVILCRQVDQPGMIGKVGGLLGDENVNISFMSVGRTSPRQ 595

Query: 64  HAISFLCIDGSILNSVLEKL 83
            A+  + +D      VL+K+
Sbjct: 596 KAVMAIGVDDEPSKEVLQKI 615


>gi|284049355|ref|YP_003399694.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus fermentans DSM
           20731]
 gi|283953576|gb|ADB48379.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus fermentans DSM
           20731]
          Length = 529

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 42/84 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  D  P   ++Q  ++D+     MI   N D  G++  +G +LG   +NIA+  + R  
Sbjct: 433 VAPDETPHITEVQGYHYDLVPEHYMILAKNDDKPGMIGQMGTLLGAAHVNIANMQVARKP 492

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
            T +A+  + +D  +  + L+ ++
Sbjct: 493 KTGNAMMIMTVDSPVEKATLQMIA 516


>gi|166367810|ref|YP_001660083.1| D-3-phosphoglycerate dehydrogenase [Microcystis aeruginosa
           NIES-843]
 gi|166090183|dbj|BAG04891.1| D-3-phosphoglycerate dehydrogenase [Microcystis aeruginosa
           NIES-843]
          Length = 525

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 45/90 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S+G+ R   + E   +V     M+  ++ D+ GI+  +G +LG + +NIA   +GR  
Sbjct: 429 LLSNGEIRITDLDEFPINVPPSNHMLFTLHQDMPGIIGKIGALLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A+  L +D  +   +L +++    IR
Sbjct: 489 IRGDAVMALSLDDPLPEGLLSEITKVPGIR 518


>gi|284929797|ref|YP_003422319.1| D-3-phosphoglycerate dehydrogenase [cyanobacterium UCYN-A]
 gi|284810241|gb|ADB95938.1| D-3-phosphoglycerate dehydrogenase [cyanobacterium UCYN-A]
          Length = 525

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 46/90 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+ R   +     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGEIRITNVDLFPINVPPSNHMLFTIHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A+  + +D  + +S+L ++     IR
Sbjct: 489 VRGDAVMAVSLDDPLPDSLLLEIMKVTGIR 518


>gi|302785179|ref|XP_002974361.1| hypothetical protein SELMODRAFT_149626 [Selaginella moellendorffii]
 gi|300157959|gb|EFJ24583.1| hypothetical protein SELMODRAFT_149626 [Selaginella moellendorffii]
          Length = 545

 Score = 39.7 bits (91), Expect = 0.12,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 40/80 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   ++   + DV +   +I     D  G++  VG +LG+  +NI+   +GR+   +
Sbjct: 452 DGVPHLSQVGSFSIDVSLEGSVILCRQVDQPGMIGKVGGLLGDENVNISFMSVGRTSPRQ 511

Query: 64  HAISFLCIDGSILNSVLEKL 83
            A+  + +D      VL+K+
Sbjct: 512 KAVMAIGVDDEPSKEVLQKI 531


>gi|289193097|ref|YP_003459038.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus sp.
           FS406-22]
 gi|288939547|gb|ADC70302.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus sp.
           FS406-22]
          Length = 524

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 27/82 (32%), Positives = 48/82 (58%), Gaps = 4/82 (4%)

Query: 4   DGKPRFIKIQ--EINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           + KP  +++   E++F +  G L I + + D  GI+  VG  LG+YGINIA   +GR + 
Sbjct: 431 NNKPVILEVDGYEVSF-IPEGVLAI-VKHIDRPGIIGRVGVTLGDYGINIAGMQVGRKEP 488

Query: 62  TEHAISFLCIDGSILNSVLEKL 83
              ++  + +D ++ + V+EKL
Sbjct: 489 GGDSVMLINLDHTVPDEVVEKL 510


>gi|88856753|ref|ZP_01131408.1| D-3-phosphoglycerate dehydrogenase [marine actinobacterium
           PHSC20C1]
 gi|88814050|gb|EAR23917.1| D-3-phosphoglycerate dehydrogenase [marine actinobacterium
           PHSC20C1]
          Length = 530

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 3/91 (3%)

Query: 5   GKPRFIKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           G  +  KI EIN    +V +   +I ++  D  GIV   G   G+  INIA   + R   
Sbjct: 432 GNKQLEKIVEINGYDIEVPLADHLIVMMYEDRTGIVAVFGKEFGDAEINIAGMQIARESE 491

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             +A+S L +D      VL  ++  +  R+V
Sbjct: 492 GGNALSVLTVDSQASAEVLATVAERIDARYV 522


>gi|332191510|gb|AEE29631.1| D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 651

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G P    +     DV + G L++C    D  G++  VGNILGE  +N+    +GR+   +
Sbjct: 559 GVPHLTCVGSFGVDVSLEGNLILC-RQVDQPGMIGQVGNILGEQNVNVNFMSVGRTVLRK 617

Query: 64  HAISFLCIDGSILNSVLEKL 83
            AI  + +D    N  LE++
Sbjct: 618 QAIMAIGVDEEPDNKTLERI 637


>gi|254518005|ref|ZP_05130061.1| L-serine dehydratase beta subunit [Clostridium sp. 7_2_43FAA]
 gi|226911754|gb|EEH96955.1| L-serine dehydratase beta subunit [Clostridium sp. 7_2_43FAA]
          Length = 226

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%)

Query: 32  DILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKL 83
           DI G V  V NIL +  +NIA  +LGRSQ  ++A     +D  I N ++EK+
Sbjct: 156 DIPGTVAKVTNILYDNKVNIAFLNLGRSQRGKNATMTFEVDSKISNELIEKI 207


>gi|317050372|ref|YP_004111488.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
 gi|316945456|gb|ADU64932.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
          Length = 520

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +D  PR +++ E   +      M+   N D  G++  +G +LGE  IN+A+  LG  +
Sbjct: 424 LLADKFPRIVEVNEYKIEAVPQGTMLFFRNYDRPGVIGSLGRLLGEKNINVANMRLG-FR 482

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + AI+ + ID ++  + L++++    I    Q EF
Sbjct: 483 GDDEAIAMVNIDTAVDAATLQEITRLDNIIDCFQLEF 519


>gi|170781815|ref|YP_001710147.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169156383|emb|CAQ01531.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 529

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 38/76 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   + +V   R +I +   D  GIV   G   G+  +NIA   + R ++   A+S
Sbjct: 438 KLVEIDGYDVEVPFSRHLIVMKYEDRPGIVAVYGKEFGDAEVNIAGMQIARQEAGGRALS 497

Query: 68  FLCIDGSILNSVLEKL 83
            L +D  + + VLE +
Sbjct: 498 VLSVDSPVPDGVLENV 513


>gi|18394525|ref|NP_564034.1| PGDH (3-PHOSPHOGLYCERATE DEHYDROGENASE); phosphoglycerate
           dehydrogenase [Arabidopsis thaliana]
 gi|3122858|sp|O04130|SERA_ARATH RecName: Full=D-3-phosphoglycerate dehydrogenase, chloroplastic;
           Short=3-PGDH; Flags: Precursor
 gi|9802747|gb|AAF99816.1|AC034257_8 D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|2189964|dbj|BAA20405.1| Phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|2804258|dbj|BAA24440.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|15215740|gb|AAK91415.1| At1g17740/F11A6_16 [Arabidopsis thaliana]
 gi|20466083|gb|AAM19963.1| At1g17740/F11A6_16 [Arabidopsis thaliana]
 gi|21554130|gb|AAM63210.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|332191509|gb|AEE29630.1| D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 624

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G P    +     DV + G L++C    D  G++  VGNILGE  +N+    +GR+   +
Sbjct: 532 GVPHLTCVGSFGVDVSLEGNLILC-RQVDQPGMIGQVGNILGEQNVNVNFMSVGRTVLRK 590

Query: 64  HAISFLCIDGSILNSVLEKL 83
            AI  + +D    N  LE++
Sbjct: 591 QAIMAIGVDEEPDNKTLERI 610


>gi|326390875|ref|ZP_08212427.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325993134|gb|EGD51574.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 533

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 36/60 (60%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           M+ + N DI G++  +GN+LG++GINI+   +  +++   A+  +  D  I +  +E L+
Sbjct: 459 MLFVKNKDIPGVIGHIGNVLGDFGINISTMQVSPNKNDGTALMIVSTDKEIPDEAVESLN 518


>gi|310642598|ref|YP_003947356.1| d-3-phosphoglycerate dehydrogenase [Paenibacillus polymyxa SC2]
 gi|309247548|gb|ADO57115.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus polymyxa SC2]
          Length = 530

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 38/76 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++ +   DV      + I + D  GI+  VG +LGE  +NIA   +GR      AI 
Sbjct: 440 RIVRLNQFPVDVAPEAHFLLISHNDKPGIIGRVGTLLGENSVNIASMQVGRKIVGGEAIM 499

Query: 68  FLCIDGSILNSVLEKL 83
            L +D ++   VL +L
Sbjct: 500 ILTVDKAVPKDVLIQL 515


>gi|225001262|gb|ACN78491.1| putative phosphoglycerate dehydrogenase [Arachis hypogaea]
          Length = 223

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 9/97 (9%)

Query: 4   DGKPRFIKIQEINFDVDI---GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           DG P   K+   +FDVD+   G +++C    D  G++  VG++LG+  +N++   +GR  
Sbjct: 130 DGIPHLTKVG--SFDVDVSLEGSIILC-RQVDQPGMIGKVGSVLGQENVNVSFMSVGRIA 186

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A+  + +D       L+K+     I  V++F F
Sbjct: 187 PRKQAVMAIGVDEQPSKETLKKIG---EIPAVEEFVF 220


>gi|148272280|ref|YP_001221841.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|147830210|emb|CAN01143.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
          Length = 529

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 38/76 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   + +V   R +I +   D  GIV   G   G+  +NIA   + R ++   A+S
Sbjct: 438 KLVEIDGYDVEVPFSRHLIVMKYEDRPGIVAVYGKEFGDAEVNIAGMQIARQEAGGRALS 497

Query: 68  FLCIDGSILNSVLEKL 83
            L +D  + + VLE +
Sbjct: 498 VLSVDSPVPDGVLENV 513


>gi|57242228|ref|ZP_00370167.1| D-3-phosphoglycerate dehydrogenase [Campylobacter upsaliensis
           RM3195]
 gi|57016908|gb|EAL53690.1| D-3-phosphoglycerate dehydrogenase [Campylobacter upsaliensis
           RM3195]
          Length = 527

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 4/96 (4%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      M+   N DI G++  + + L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMLIFKNKDIPGVISKISSTLAAQNINIADFRLGRD- 490

Query: 61  STEHAISFLCIDGSILNSVLE---KLSVNVTIRFVK 93
              +A++ + +D  I   VL+   KL V V +++V+
Sbjct: 491 GFGYALAVVLVDEVISKEVLDELNKLEVCVFVQYVE 526


>gi|294500972|ref|YP_003564672.1| L-serine dehydratase, iron-sulfur-dependent subunit beta [Bacillus
           megaterium QM B1551]
 gi|294350909|gb|ADE71238.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           megaterium QM B1551]
          Length = 220

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query: 10  IKIQEIN-FDVDIGRL--MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N F++++  +   I +V+ D  G +  V NIL ++ INI H  + R +  E A+
Sbjct: 130 IQITELNGFELNLSGMNPAILVVHNDRFGAIATVTNILMKHSINIGHMEVSRKERGEVAL 189

Query: 67  SFLCIDGSILNSVLEKLSV 85
             + +D +I + V+E+L  
Sbjct: 190 MAIEMDTNIEDDVIEELKT 208


>gi|257457493|ref|ZP_05622661.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Treponema vincentii ATCC 35580]
 gi|257445116|gb|EEV20191.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Treponema vincentii ATCC 35580]
          Length = 220

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 4/74 (5%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSI----LNSVLE 81
           I +V+ DI G++  V  ++ +Y +N+  F+L R +    AI  L IDG      L++ +E
Sbjct: 147 IIVVHNDIPGMIAAVTALMAQYKLNVYKFNLARDKKGGTAIMTLQIDGRSLGEDLHAAIE 206

Query: 82  KLSVNVTIRFVKQF 95
           K+   + + FV+ F
Sbjct: 207 KIPGVIKVIFVRPF 220


>gi|315638687|ref|ZP_07893861.1| phosphoglycerate dehydrogenase [Campylobacter upsaliensis JV21]
 gi|315481311|gb|EFU71941.1| phosphoglycerate dehydrogenase [Campylobacter upsaliensis JV21]
          Length = 527

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 4/96 (4%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      M+   N DI G++  + + L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMLIFKNKDIPGVISKISSTLAAQNINIADFRLGRD- 490

Query: 61  STEHAISFLCIDGSILNSVLE---KLSVNVTIRFVK 93
              +A++ + +D  I   VL+   KL V V +++V+
Sbjct: 491 GFGYALAVVLVDEVISKEVLDELNKLEVCVFVQYVE 526


>gi|239826577|ref|YP_002949201.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Geobacillus sp. WCH70]
 gi|239806870|gb|ACS23935.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Geobacillus sp. WCH70]
          Length = 220

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 34/60 (56%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSV 85
           + I++ D  G +  V N+L +Y INI H  + R +  + A+  + ID  I  +V+++L+ 
Sbjct: 149 LLIMHNDRYGAIASVANVLAKYAINIGHMEVSRKEKGKEALMTIEIDQPIDQTVIDELTA 208


>gi|76800791|ref|YP_325799.1| D-3-phosphoglycerate dehydrogenase [Natronomonas pharaonis DSM
           2160]
 gi|76556656|emb|CAI48227.1| phosphoglycerate dehydrogenase [Natronomonas pharaonis DSM 2160]
          Length = 526

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 42/98 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+D   R +++     D   G  M+   N D  G++  +G ++G Y +NIA     R  
Sbjct: 428 LFADDDARIVRVDGYRVDAIPGGKMMVARNTDEPGVIGHIGTVMGTYDVNIAGMFNARET 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D  + +   E+L  +  I   K    N
Sbjct: 488 HGGEALTVYNVDQEVPDEAREELESDDRIIETKYISLN 525


>gi|70726201|ref|YP_253115.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus haemolyticus
           JCSC1435]
 gi|68446925|dbj|BAE04509.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus haemolyticus
           JCSC1435]
          Length = 532

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I + + D       +   + D  G+V   G +LG + INIA   LGR+     A+ 
Sbjct: 440 RIVRINDYSVDFKPNAYQLVSYHGDKPGMVGLTGQLLGRHNINIASMSLGRNIQGGQAMM 499

Query: 68  FLCIDGSILNSVLEKL 83
            L ID  +   ++ +L
Sbjct: 500 VLSIDQPVTEDIINEL 515


>gi|297622551|ref|YP_003703985.1| D-3-phosphoglycerate dehydrogenase [Truepera radiovictrix DSM
           17093]
 gi|297163731|gb|ADI13442.1| D-3-phosphoglycerate dehydrogenase [Truepera radiovictrix DSM
           17093]
          Length = 524

 Score = 39.3 bits (90), Expect = 0.16,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 48/93 (51%), Gaps = 6/93 (6%)

Query: 6   KPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           +PR + + E   ++   G ++IC  N D  G V  VG +LG+ G+NI+   L R      
Sbjct: 432 EPRIVSVDEYPIELRPEGTMLIC-TNYDRPGAVGKVGTVLGDAGVNISGMQLSRVGENGL 490

Query: 65  AISFLCIDGSILNSVLEKL----SVNVTIRFVK 93
           A+  L +D     SVLE L    +V V+++ V+
Sbjct: 491 ALFALGLDQEPPESVLEVLRSLPNVLVSLKLVR 523


>gi|295706319|ref|YP_003599394.1| L-serine dehydratase, iron-sulfur-dependent subunit beta [Bacillus
           megaterium DSM 319]
 gi|294803978|gb|ADF41044.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           megaterium DSM 319]
          Length = 220

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 3/79 (3%)

Query: 10  IKIQEIN-FDVDIGRL--MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N F++++  +   I +V+ D  G +  V NIL ++ INI H  + R +  E A+
Sbjct: 130 IQITELNGFELNLSGMNPAILVVHNDRFGAIATVTNILMKHSINIGHMEVSRKERGEVAL 189

Query: 67  SFLCIDGSILNSVLEKLSV 85
             + +D +I + V+E+L  
Sbjct: 190 MAIEMDTNIEDDVIEELKT 208


>gi|326505978|dbj|BAJ91228.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326514850|dbj|BAJ99786.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 617

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG P   K+     DV + G L++C    D  G++  VG++LGE  +N++   +GR    
Sbjct: 524 DGIPHLTKVGAFEVDVSMEGSLILC-RQVDQPGMIGSVGSVLGEENVNVSFMSVGRIAPR 582

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + AI  + +D     + L K+     I  +++F F
Sbjct: 583 KTAIMAIGVDEEPSKTTLTKIG---EIPAIEEFVF 614


>gi|15235282|ref|NP_195146.1| EDA9 (embryo sac development arrest 9); ATP binding [Arabidopsis
           thaliana]
 gi|2911042|emb|CAA17552.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|7270370|emb|CAB80137.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|17380672|gb|AAL36166.1| putative phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|23297595|gb|AAN12903.1| putative phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 603

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 3/94 (3%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N+    +GR    +
Sbjct: 510 DGVPHLTKVGSFEVDVTLEGSIILCRQVDQPGMIGTVGSILGESNVNVNFMSVGRIAPRK 569

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            AI  + +D       L+K+     I  V++F F
Sbjct: 570 QAIMAIGVDDIPSKETLKKIG---EIPAVEEFVF 600


>gi|167036576|ref|YP_001664154.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320115004|ref|YP_004185163.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166855410|gb|ABY93818.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319928095|gb|ADV78780.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 531

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 13  QEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCID 72
            ++NF+      M+ + N D+ G++  +GN+LG++GINI+   +  +++   A+  +  D
Sbjct: 449 HKVNFEPT--EYMLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDGTALMIVSTD 506

Query: 73  GSILNSVLEKLS 84
             I +  +E L+
Sbjct: 507 KEIPDEAVESLN 518


>gi|21536501|gb|AAM60833.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
          Length = 603

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 3/94 (3%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N+    +GR    +
Sbjct: 510 DGVPHLTKVGSFEVDVTLEGSIILCRQVDQPGMIGTVGSILGESNVNVNFMSVGRIAPRK 569

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            AI  + +D       L+K+     I  V++F F
Sbjct: 570 QAIMAIGVDDIPSKETLKKIG---EIPAVEEFVF 600


>gi|167768990|ref|ZP_02441043.1| hypothetical protein ANACOL_00311 [Anaerotruncus colihominis DSM
           17241]
 gi|167668630|gb|EDS12760.1| hypothetical protein ANACOL_00311 [Anaerotruncus colihominis DSM
           17241]
          Length = 219

 Score = 39.3 bits (90), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 28  IVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKL 83
           +++ D  G +  V   LG YG+NI +F L R Q    A+  +  DGSI  ++ EK+
Sbjct: 149 VLHRDAPGTIAAVTECLGSYGVNICNFRLAREQKGGTAVMTIETDGSIDRTLNEKI 204


>gi|15791207|ref|NP_281031.1| D-3-phosphoglycerate dehydrogenase [Halobacterium sp. NRC-1]
 gi|169236963|ref|YP_001690163.1| D-3-phosphoglycerate dehydrogenase [Halobacterium salinarum R1]
 gi|10581831|gb|AAG20511.1| phosphoglycerate dehydrogenase [Halobacterium sp. NRC-1]
 gi|167728029|emb|CAP14817.1| phosphoglycerate dehydrogenase [Halobacterium salinarum R1]
          Length = 527

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 43/98 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR ++I     +      M+   N D  G++ F+G +LG   +NIA     R  
Sbjct: 428 LFAGDDPRLVEIDGFRVEAAPNGHMLVARNHDTPGVIGFIGGVLGTAEVNIAGMFNAREA 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D  +    L++L+ +  I  V   E N
Sbjct: 488 RGGEALTVYNLDADVPARALDELAGDDRIVDVTSIELN 525


>gi|289579412|ref|YP_003478039.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter italicus
           Ab9]
 gi|289529125|gb|ADD03477.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter italicus
           Ab9]
          Length = 533

 Score = 39.3 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 36/60 (60%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           M+ + N D+ G++  +GN+LG++GINI+   +  +++   A+  +  D  I +  +E L+
Sbjct: 459 MLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDGTALMIVSTDKEIPDEAVESLN 518


>gi|297545554|ref|YP_003677856.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296843329|gb|ADH61845.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 533

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 36/60 (60%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           M+ + N D+ G++  +GN+LG++GINI+   +  +++   A+  +  D  I +  +E L+
Sbjct: 459 MLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDGTALMIVSTDKEIPDEAVESLN 518


>gi|269127749|ref|YP_003301119.1| D-3-phosphoglycerate dehydrogenase [Thermomonospora curvata DSM
           43183]
 gi|268312707|gb|ACY99081.1| D-3-phosphoglycerate dehydrogenase [Thermomonospora curvata DSM
           43183]
          Length = 531

 Score = 39.3 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 44/85 (51%), Gaps = 4/85 (4%)

Query: 7   PRFI-KIQEIN-FDVDI--GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           P+ I +I EIN +D+++     M      D  GIV  VG +LG+  INIA   +GRS   
Sbjct: 433 PKHIERIVEINGYDMELVPAEHMAFFSYTDRPGIVGVVGRLLGDAQINIASMQVGRSSKG 492

Query: 63  EHAISFLCIDGSILNSVLEKLSVNV 87
             A+  L +D +I   +LE +   +
Sbjct: 493 GKALIALTVDSAIGPDLLETIRTEI 517


>gi|304315109|ref|YP_003850256.1| phosphoglycerate dehydrogenase [Methanothermobacter marburgensis
           str. Marburg]
 gi|302588568|gb|ADL58943.1| phosphoglycerate dehydrogenase [Methanothermobacter marburgensis
           str. Marburg]
          Length = 525

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 39/78 (50%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +P  I I     DV     MI     D+ G +  +G  LGE+ INIA   +GR +    A
Sbjct: 434 EPTIIGINGYRVDVKPEGTMIIARYRDLPGTIGAIGTKLGEHQINIATMQVGRKEIGGEA 493

Query: 66  ISFLCIDGSILNSVLEKL 83
           +  L +D S+ + V++++
Sbjct: 494 VMVLKVDQSVPSEVIDEV 511


>gi|326501108|dbj|BAJ98785.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326504920|dbj|BAK06751.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 616

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 5/94 (5%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G P    +     DV + G L++C    D  G++  VGNILG+  +N++   +GR+   +
Sbjct: 524 GVPHLTVVGPYEVDVSLEGNLILC-RQIDQPGMIGKVGNILGQRNVNVSFMSVGRTSRGK 582

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            AI  + +D       LEK+     I  +++F F
Sbjct: 583 QAIMAIGVDEEPDKKTLEKIG---AIPAIEEFVF 613


>gi|302546895|ref|ZP_07299237.1| phosphoglycerate dehydrogenase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302464513|gb|EFL27606.1| phosphoglycerate dehydrogenase [Streptomyces himastatinicus ATCC
           53653]
          Length = 529

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 43/86 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + +   D+ +   +I +   D  G+V  VG++LGE G+NIA   + RS      ++
Sbjct: 439 KIVSVGQHTIDLAVSDHLIFLRYKDRPGVVGTVGHVLGEAGLNIAGMQVSRSVPGGETLA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVK 93
            L +D ++   VL +++      F +
Sbjct: 499 VLNVDSNVPADVLNEIAQETDATFAR 524


>gi|227499137|ref|ZP_03929272.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus sp. D21]
 gi|226904584|gb|EEH90502.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus sp. D21]
          Length = 529

 Score = 38.9 bits (89), Expect = 0.21,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 38/81 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  D +P   +++   FD      MI   N D  G++  +G +LG   +NIA   + R +
Sbjct: 433 VTPDNQPHITEVEGYQFDTIPAPYMIFARNDDKPGMIGQIGTLLGAGHVNIATMQVSRKK 492

Query: 61  STEHAISFLCIDGSILNSVLE 81
               A+  L +D ++  + LE
Sbjct: 493 KEGTAMMVLTVDSAVDGATLE 513


>gi|255555301|ref|XP_002518687.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223542068|gb|EEF43612.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 596

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 3/94 (3%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N++   +GR    +
Sbjct: 503 DGIPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGSILGEENVNVSFMSVGRIAPRK 562

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  + +D       L+K+     I  +++F F
Sbjct: 563 QAVMAIGVDDQPKKESLKKIG---DIPAIEEFVF 593


>gi|251796380|ref|YP_003011111.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. JDR-2]
 gi|247544006|gb|ACT01025.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. JDR-2]
          Length = 530

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 39/77 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I +   DV     +I I + D  GI+  VG +LG   +NIA   +GR      AI 
Sbjct: 440 RVVQIDKFPVDVTPEGNLILISHNDKPGIIGRVGTLLGNNDVNIATMQVGRQLVGGSAIM 499

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D +    +LE+L+
Sbjct: 500 VLTVDKNAGKDILEQLT 516


>gi|20808958|ref|NP_624129.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           tengcongensis MB4]
 gi|20517622|gb|AAM25733.1| Phosphoglycerate dehydrogenase and related dehydrogenases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 533

 Score = 38.9 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 35/60 (58%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           M+ + N D+ G++  +GN+LG++GINI+   +  +++   A+  +  D  I    +E L+
Sbjct: 459 MLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDGTALMLVSTDKEIPEEAVESLN 518


>gi|256751636|ref|ZP_05492511.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256749445|gb|EEU62474.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 531

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 36/60 (60%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           M+ + N D+ G++  +GN+LG++GINI+   +  +++   A+  +  D  I +  +E L+
Sbjct: 459 MLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDGTALMIVSTDREIPDEAVESLN 518


>gi|159027379|emb|CAO90566.1| serA [Microcystis aeruginosa PCC 7806]
          Length = 525

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 44/90 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S G+ R   + E   +V     M+  ++ D+ GI+  +G +LG + +NIA   +GR  
Sbjct: 429 LLSTGEIRITDLDEFPINVPPSNHMLFTLHQDMPGIIGKIGALLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A+  L +D  +   +L +++    IR
Sbjct: 489 IRGDAVMALSLDDPLPEGLLSEITKVPGIR 518


>gi|167040920|ref|YP_001663905.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X514]
 gi|300913871|ref|ZP_07131188.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307725445|ref|YP_003905196.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
 gi|166855160|gb|ABY93569.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X514]
 gi|300890556|gb|EFK85701.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307582506|gb|ADN55905.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
          Length = 531

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 36/60 (60%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           M+ + N D+ G++  +GN+LG++GINI+   +  +++   A+  +  D  I +  +E L+
Sbjct: 459 MLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDGTALMIVSTDREIPDEAVESLN 518


>gi|282899725|ref|ZP_06307688.1| D-3-phosphoglycerate dehydrogenase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195340|gb|EFA70274.1| D-3-phosphoglycerate dehydrogenase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 526

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 40/73 (54%)

Query: 18  DVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILN 77
           +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR      A+  L ID  + +
Sbjct: 447 NVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKIVRGDAVMALSIDDPLPD 506

Query: 78  SVLEKLSVNVTIR 90
            +LE++     IR
Sbjct: 507 GILEEIKQVSGIR 519


>gi|320101741|ref|YP_004177332.1| D-3-phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
 gi|319749023|gb|ADV60783.1| D-3-phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
          Length = 544

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 40/83 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   + R + +     D D+  +M+   + D  G++  +G ++G + +NIA  ++GR+ 
Sbjct: 437 LFGRQRMRLVGLGPYQIDCDLEGVMLIFTHLDRPGLIGSIGTLMGNHNVNIAQMNVGRAV 496

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               AI  + +D       LE L
Sbjct: 497 KGGEAIGVVNLDSIPPEEALEAL 519


>gi|297798490|ref|XP_002867129.1| hypothetical protein ARALYDRAFT_491252 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297312965|gb|EFH43388.1| hypothetical protein ARALYDRAFT_491252 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 603

 Score = 38.9 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 3/94 (3%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N+    +GR    +
Sbjct: 510 DGVPHLTKVGSFEVDVTLEGSIILCRQVDQPGMIGTVGSILGESNVNVNFMSVGRIAPRK 569

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            AI  + +D       L+K+     I  +++F F
Sbjct: 570 QAIMAIGVDDIPSKDTLKKIG---EIPAIEEFVF 600


>gi|154151703|ref|YP_001405321.1| D-3-phosphoglycerate dehydrogenase [Candidatus Methanoregula boonei
           6A8]
 gi|154000255|gb|ABS56678.1| D-3-phosphoglycerate dehydrogenase [Methanoregula boonei 6A8]
          Length = 534

 Score = 38.9 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 41/83 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF  G+ R + + +   D+     +I   + D  G++     ILG+  INIA   +GR  
Sbjct: 433 VFVKGRSRIVSVDKYTMDLIPEGYVIVSRHLDKPGVIGRASTILGKCNINIAGMQVGRIN 492

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
           + E A+  L +D  +   V++++
Sbjct: 493 AGEEALMVLNVDSEVPEDVMKEI 515


>gi|62321126|dbj|BAD94241.1| Phosphoglycerate dehydrogenase - like protein [Arabidopsis
           thaliana]
          Length = 259

 Score = 38.9 bits (89), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG P   K+     DV + G +++C    D  G++  VG+ILGE  +N+    +GR    
Sbjct: 166 DGVPHLTKVGSFEVDVTLEGSIILC-RQVDQPGMIGTVGSILGESNVNVNFMSVGRIAPR 224

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + AI  + +D       L+K+     I  V++F F
Sbjct: 225 KQAIMAIGVDDIPSKETLKKIG---EIPAVEEFVF 256


>gi|300783616|ref|YP_003763907.1| D-3-phosphoglycerate dehydrogenase [Amycolatopsis mediterranei U32]
 gi|299793130|gb|ADJ43505.1| D-3-phosphoglycerate dehydrogenase [Amycolatopsis mediterranei U32]
          Length = 532

 Score = 38.5 bits (88), Expect = 0.27,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 45/91 (49%), Gaps = 3/91 (3%)

Query: 11  KIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           K+ E+N   FD+     ++ +   D  G++  VG +LGE GINI    + ++     A+ 
Sbjct: 442 KLVEVNGRGFDLRAEGTVLLVEYPDRPGVMGRVGTLLGEAGINIEAAQISQTTDGSDAVM 501

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D  I   +LE +  +V    ++  +FN
Sbjct: 502 LLRVDRHIDAHLLEPIGASVGAHTIRAVDFN 532


>gi|291521648|emb|CBK79941.1| L-serine ammonia-lyase [Coprococcus catus GD/7]
          Length = 222

 Score = 38.5 bits (88), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK R  +I  +  +       + +V+ D LG+V  +  +L  +G+NIA   L R    + 
Sbjct: 130 GKVRISRINNVEVEFTGEYSSVIVVHQDQLGLVAHITAVLSHFGVNIAFMRLFRESKGQT 189

Query: 65  AISFLCIDGSILNSVLEKLSVN 86
           A + + +DG +   + E +S N
Sbjct: 190 AYTLVEVDGDLPKGIKEMISDN 211


>gi|282895559|ref|ZP_06303693.1| D-3-phosphoglycerate dehydrogenase [Raphidiopsis brookii D9]
 gi|281199399|gb|EFA74263.1| D-3-phosphoglycerate dehydrogenase [Raphidiopsis brookii D9]
          Length = 526

 Score = 38.5 bits (88), Expect = 0.27,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 40/73 (54%)

Query: 18  DVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILN 77
           +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR      A+  L ID  + +
Sbjct: 447 NVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKIVRGDAVMALSIDDPLPD 506

Query: 78  SVLEKLSVNVTIR 90
            +LE++     IR
Sbjct: 507 GILEEIKQVSGIR 519


>gi|320334822|ref|YP_004171533.1| D-3-phosphoglycerate dehydrogenase [Deinococcus maricopensis DSM
           21211]
 gi|319756111|gb|ADV67868.1| D-3-phosphoglycerate dehydrogenase [Deinococcus maricopensis DSM
           21211]
          Length = 538

 Score = 38.5 bits (88), Expect = 0.27,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 35/65 (53%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R  ++++   ++     ++ + N D  G V  + N+LG +GINIA   LGRS+    A+ 
Sbjct: 449 RLTRLRDYRVELAPEGFILIVSNQDKPGAVAKLSNLLGTWGINIAGMSLGRSERGGQALF 508

Query: 68  FLCID 72
            L +D
Sbjct: 509 TLTLD 513


>gi|78044181|ref|YP_361480.1| D-3-phosphoglycerate dehydrogenase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996296|gb|ABB15195.1| D-3-phosphoglycerate dehydrogenase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 525

 Score = 38.5 bits (88), Expect = 0.28,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 37/72 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + +PR ++I +   DV      + + + D   ++  VG ILGE GINIA   LGR  
Sbjct: 429 LFRNNEPRIVQIDQYRVDVVPEGYKLFVPHKDQPLMIGKVGIILGEKGINIAGMQLGRIT 488

Query: 61  STEHAISFLCID 72
               A+  L +D
Sbjct: 489 PGGDAVMVLSLD 500


>gi|291548342|emb|CBL21450.1| L-serine ammonia-lyase [Ruminococcus sp. SR1/5]
          Length = 222

 Score = 38.5 bits (88), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK R ++I  +  D       I +++ D  G+V ++   L E  INIA   L R      
Sbjct: 130 GKVRIVEINHVKVDFTGEYSAIIVIHQDTPGVVAYITRCLSERNINIAFMRLFRESKGTT 189

Query: 65  AISFLCIDGSILNSVLEKLSVNVTI 89
           A + +  DG +   ++E +  N  I
Sbjct: 190 AYTIVESDGHLPEDIVESIHRNTNI 214


>gi|289581556|ref|YP_003480022.1| D-3-phosphoglycerate dehydrogenase [Natrialba magadii ATCC 43099]
 gi|289531109|gb|ADD05460.1| D-3-phosphoglycerate dehydrogenase [Natrialba magadii ATCC 43099]
          Length = 528

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 41/84 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR +++     D      M+   N D  G++  +G ++G++G+NIA     R  
Sbjct: 428 LFAGDDPRIVRVDGYRVDAIPHGKMVVTRNTDEPGVIGLIGTVMGKHGVNIAGMFNAREA 487

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               A++   +D  + ++  ++L+
Sbjct: 488 HGGEALTVYNVDSQVPDAAKDELN 511


>gi|255538186|ref|XP_002510158.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223550859|gb|EEF52345.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 598

 Score = 38.5 bits (88), Expect = 0.30,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 5/95 (5%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +GKP    +     DV + G L++C    D  G++  VG+ILGE  +N++   +GR    
Sbjct: 505 EGKPHLTMVGSFGVDVSLEGSLILC-RQIDQPGMIGKVGSILGEENVNVSFMTVGRIAPR 563

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + A+  + +D       L+++     I  V++F F
Sbjct: 564 KQAVMTIGVDEEPNKEALKRIG---EIPLVEEFVF 595


>gi|311029987|ref|ZP_07708077.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           sp. m3-13]
          Length = 220

 Score = 38.5 bits (88), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSV 85
           + +V+ D  G +  V N+L ++ INI H  + R +  + A+  + +D +I  +V+++LS 
Sbjct: 149 LLVVHDDRYGAIAGVANVLAKFAINIGHMEVSRKEKGQKALMTIEVDQNIDEAVIQELSA 208

Query: 86  --NVT 88
             N+T
Sbjct: 209 LPNIT 213


>gi|116751067|ref|YP_847754.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116700131|gb|ABK19319.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 526

 Score = 38.5 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 42/96 (43%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F    PR ++I +   +  +   ++ I N D  G +  +G  LG++ INI+   +G+   
Sbjct: 431 FGKKDPRMVRINDFRLEAALEGHLLLIYNIDTPGTIGAIGTCLGKHHINISMMDVGQVLE 490

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               I FL  D  +   V E+L     +  V+  E 
Sbjct: 491 RGQNIIFLRTDTPVPGHVKEELLAMDNVNVVQAIEL 526


>gi|325003700|ref|ZP_08124812.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia sp. P1]
          Length = 536

 Score = 38.5 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 3/97 (3%)

Query: 5   GKPRFIKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           G+    K+ EIN   FD+     ++ +   D  G++  VG++LGE  +NI    + ++  
Sbjct: 439 GRAEVQKLVEINGRHFDLRAEGEVVLLEYTDRPGVMGRVGSLLGEAAVNIEAAQISQTTE 498

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
              A+  L +D  I  +VLE +  +V  R ++   F+
Sbjct: 499 GTDALMLLRVDRHIDPAVLEPIGASVGARTIRLISFD 535


>gi|328952982|ref|YP_004370316.1| D-3-phosphoglycerate dehydrogenase [Desulfobacca acetoxidans DSM
           11109]
 gi|328453306|gb|AEB09135.1| D-3-phosphoglycerate dehydrogenase [Desulfobacca acetoxidans DSM
           11109]
          Length = 526

 Score = 38.5 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 35/75 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   +PR ++I     +      M+ I N D  G++  +G  +G + INIA   +G+ +
Sbjct: 430 IFGRYEPRLVRINAFRLEAVPEGHMLFIYNTDRPGVIGAIGTTIGNHKINIARMTVGQEK 489

Query: 61  STEHAISFLCIDGSI 75
                I  L  D S+
Sbjct: 490 ERGQNIILLTTDTSV 504


>gi|315221596|ref|ZP_07863516.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus anginosus F0211]
 gi|315189430|gb|EFU23125.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus anginosus F0211]
          Length = 223

 Score = 38.5 bits (88), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFSISLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAGEKAI 193

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D    +  +E++
Sbjct: 194 MIIEVDSRSCDGAIEEI 210


>gi|147920120|ref|YP_686117.1| D-3-phosphoglycerate dehydrogenase [uncultured methanogenic
           archaeon RC-I]
 gi|110621513|emb|CAJ36791.1| D-3-phosphoglycerate dehydrogenase [uncultured methanogenic
           archaeon RC-I]
          Length = 526

 Score = 38.5 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 39/83 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R ++IQ    D      MI   + D  G++  VG ILG+  INI+   +GR  
Sbjct: 430 IFGKSDARIVEIQGYRVDAVPSGTMIVTRHQDRPGVIGKVGMILGKLNINISGMVVGRDA 489

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+  L +D  +  + L+++
Sbjct: 490 VRGDAVMILTVDDEVPAATLKQM 512


>gi|262281664|ref|ZP_06059433.1| L-serine dehydratase [Streptococcus sp. 2_1_36FAA]
 gi|262262118|gb|EEY80815.1| L-serine dehydratase [Streptococcus sp. 2_1_36FAA]
          Length = 223

 Score = 38.1 bits (87), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    I IV+ D+ G++  V + L  Y INIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTDALSRYNINIAQMNVTREKAGEKAI 193

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D       +E++
Sbjct: 194 MIIEVDSRSCEEAVEEI 210


>gi|313889530|ref|ZP_07823176.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pseudoporcinus SPIN 20026]
 gi|313122142|gb|EFR45235.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pseudoporcinus SPIN 20026]
          Length = 223

 Score = 38.1 bits (87), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    + IV+ DI G++  V +IL EY INIA  ++ R  + E AI
Sbjct: 134 IQVTELNGFSVSLTMNTPTLIIVHQDIPGMIAKVTDILSEYEINIAQMNVTRESAGEKAI 193

Query: 67  SFLCIDGSILNSVLEKLSV 85
             + +D       + K++ 
Sbjct: 194 MIIEVDTHDCQDAVNKIAT 212


>gi|23100081|ref|NP_693547.1| D-3-phosphoglycerate dehydrogenase [Oceanobacillus iheyensis
           HTE831]
 gi|22778312|dbj|BAC14582.1| phosphoglycerate dehydrogenase [Oceanobacillus iheyensis HTE831]
          Length = 528

 Score = 38.1 bits (87), Expect = 0.36,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 39/77 (50%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR +++ E   D+     M+ I + D  G++  +G+ + ++ INIA   + RS     AI
Sbjct: 438 PRLVRVDEYRVDITPEGHMVVIQHRDQPGVIGRMGSTIAKHDINIATMQVDRSDIGGDAI 497

Query: 67  SFLCIDGSILNSVLEKL 83
             L ID  + +  L ++
Sbjct: 498 MILTIDRHLADEALNEI 514


>gi|331695673|ref|YP_004331912.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia dioxanivorans
           CB1190]
 gi|326950362|gb|AEA24059.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia dioxanivorans
           CB1190]
          Length = 533

 Score = 38.1 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 48/92 (52%), Gaps = 3/92 (3%)

Query: 5   GKPRFIKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           G+ +  K+ EIN   FD+     ++ +  AD  G++  VG++LGE  +NI    + ++  
Sbjct: 437 GRAQVEKLVEINGRHFDLRAEGDILLLEYADRPGVMGRVGSLLGEAAVNIEAAQISQTTD 496

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
              AI  L +D  I  +VLE +  +V  + V+
Sbjct: 497 GRDAIMLLRVDRPIDPAVLEPIGASVGAKTVR 528


>gi|302542286|ref|ZP_07294628.1| phosphoglycerate dehydrogenase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302459904|gb|EFL22997.1| phosphoglycerate dehydrogenase [Streptomyces himastatinicus ATCC
           53653]
          Length = 533

 Score = 38.1 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 24/77 (31%), Positives = 41/77 (53%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M  +   D  G+V  +G ILGE GINIA   + R+     A+ 
Sbjct: 443 KIVAVGEYDVDLALADHMAFLRYTDRPGVVGTLGRILGEAGINIAGMQVSRAAVGGAALV 502

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D +I  SVL +++
Sbjct: 503 ALTVDDTIPQSVLTEIA 519


>gi|325833264|ref|ZP_08165770.1| phosphoglycerate dehydrogenase [Eggerthella sp. HGA1]
 gi|325485646|gb|EGC88114.1| phosphoglycerate dehydrogenase [Eggerthella sp. HGA1]
          Length = 530

 Score = 38.1 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 32  DILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKL 83
           D  G V  +G ILGE GINI    +G   + + A+ ++ ++G + + VL KL
Sbjct: 464 DAPGRVGAIGTILGEAGINITTMQIGTKPAEQCALVYMNVEGDVDDDVLSKL 515


>gi|256810586|ref|YP_003127955.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus fervens
           AG86]
 gi|256793786|gb|ACV24455.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus fervens
           AG86]
          Length = 525

 Score = 38.1 bits (87), Expect = 0.37,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 3   SDGKPRFIKIQ--EINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           ++ KP  +++   E+NF +  G L I + + D  G +  V   LG+YGINIA   +GR +
Sbjct: 430 ANNKPVILEVDGYEVNF-IPEGVLAI-VKHVDRPGTIGRVCITLGDYGINIAGMQVGRKE 487

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               ++  L +D ++ + V+EK+
Sbjct: 488 PGGESVMLLNLDHTVPDEVVEKI 510


>gi|110598440|ref|ZP_01386712.1| D-3-phosphoglycerate dehydrogenase [Chlorobium ferrooxidans DSM
           13031]
 gi|110339974|gb|EAT58477.1| D-3-phosphoglycerate dehydrogenase [Chlorobium ferrooxidans DSM
           13031]
          Length = 526

 Score = 38.1 bits (87), Expect = 0.38,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 45/84 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D + R + I +   +      +I   N D  G++  V  +L ++ +N+A+  L R +
Sbjct: 430 VFGDKEIRIVMIDQFLVEFKPEGHIIIYNNIDKPGVIAHVTQLLLQHNLNVAYVALSRDE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
             + A++ + +DG + +++L+ +S
Sbjct: 490 EKKVAMTAIVVDGEVSDALLQAVS 513


>gi|219851104|ref|YP_002465536.1| D-3-phosphoglycerate dehydrogenase [Methanosphaerula palustris
           E1-9c]
 gi|219545363|gb|ACL15813.1| D-3-phosphoglycerate dehydrogenase [Methanosphaerula palustris
           E1-9c]
          Length = 532

 Score = 38.1 bits (87), Expect = 0.40,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 40/83 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFS  + R + I     D+D    ++   + D  G++     ILG   +NIA   +GR +
Sbjct: 436 VFSKVRSRIVAIGGYTMDLDPTGFLVISRHLDKPGVIGRASTILGHCEVNIAGMQVGRIR 495

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
             E AI  L +D  + +  ++++
Sbjct: 496 PGEEAIMVLNVDSEVSDEAMDEI 518


>gi|325958180|ref|YP_004289646.1| D-3-phosphoglycerate dehydrogenase [Methanobacterium sp. AL-21]
 gi|325329612|gb|ADZ08674.1| D-3-phosphoglycerate dehydrogenase [Methanobacterium sp. AL-21]
          Length = 525

 Score = 38.1 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 40/78 (51%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +P+ I I     DV+    M+     D  G++  +G  +G++ INIA   +GR +    A
Sbjct: 434 EPKIIMINGYQVDVETEGTMLISKYKDKPGVIGAIGTKIGKHNINIAKMQVGRKELGGEA 493

Query: 66  ISFLCIDGSILNSVLEKL 83
           +  L +D  +  +V+E+L
Sbjct: 494 VMVLKVDQQVPLNVIEEL 511


>gi|327463812|gb|EGF10128.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis
           SK1057]
          Length = 234

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ E AI
Sbjct: 145 IQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAGEKAI 204

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D       +E++
Sbjct: 205 MIIEVDSRSCEEAIEEI 221


>gi|86211233|gb|ABC87292.1| putative phosphoglycerate dehydrogenase [Ceratopteris richardii]
          Length = 262

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           P   K+ E + D  +   +I     D  G++  VGNILG+  IN+    +GR    + A+
Sbjct: 172 PHLCKVGEFDVDASLEGSVILTRQQDQPGMIGIVGNILGDENINVNFMSVGRIAPRKEAL 231

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D     + L+++
Sbjct: 232 MAIGLDDEPTQAALKRI 248


>gi|89099089|ref|ZP_01171968.1| phosphoglycerate dehydrogenase [Bacillus sp. NRRL B-14911]
 gi|89086219|gb|EAR65341.1| phosphoglycerate dehydrogenase [Bacillus sp. NRRL B-14911]
          Length = 524

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR + +   N D      ++ I + D  G++  VG +LG++ INIA   +GR ++   AI
Sbjct: 434 PRIVFLNGFNIDFLPEGELLYIQHMDRPGVIGRVGKVLGDHSINIAAMQVGRKEAGGEAI 493

Query: 67  SFLCIDGSILNS 78
             L  D  +  S
Sbjct: 494 MVLSFDKPLGES 505


>gi|226355874|ref|YP_002785614.1| D-3-phosphoglycerate dehydrogenase [Deinococcus deserti VCD115]
 gi|226317864|gb|ACO45860.1| putative Phosphoglycerate dehydrogenase [Deinococcus deserti
           VCD115]
          Length = 544

 Score = 38.1 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 39/77 (50%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR  ++++   +++    ++   N D  G V  + N+LG +G+NIA   LGR+     A+
Sbjct: 454 PRLTRLRDYRVELEPEGYILIASNEDKPGAVAKLSNLLGTWGVNIAGMALGRAAKGGQAL 513

Query: 67  SFLCIDGSILNSVLEKL 83
             L +D  +    L+ +
Sbjct: 514 FTLTLDDGLSAEQLQAI 530


>gi|271969249|ref|YP_003343445.1| D-3-phosphoglycerate dehydrogenase [Streptosporangium roseum DSM
           43021]
 gi|270512424|gb|ACZ90702.1| D-3-phosphoglycerate dehydrogenase [Streptosporangium roseum DSM
           43021]
          Length = 529

 Score = 37.7 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 7   PRFI-KIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           PR I KI E+N    +++    +      D  GIV  VG ILG++GINIA   + R    
Sbjct: 433 PRQITKIVEVNGYQMEIEPTDHLSFFTYTDRPGIVGVVGRILGDHGINIASMQVARDVKG 492

Query: 63  EHAISFLCIDGSILNSVLEKLSVNV 87
             A+  L +D  I   V++++   +
Sbjct: 493 GKALIALTVDTGIPADVIDQIGAEI 517


>gi|260881561|ref|ZP_05404709.2| phosphoglycerate dehydrogenase [Mitsuokella multacida DSM 20544]
 gi|260848763|gb|EEX68770.1| phosphoglycerate dehydrogenase [Mitsuokella multacida DSM 20544]
          Length = 558

 Score = 37.7 bits (86), Expect = 0.49,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 8   RFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           R ++I +   DVD   R++IC  + +  G++  VG +LG  G+NI+   +G ++     +
Sbjct: 466 RIVRINDFRVDVDPHARILIC-PHINRPGVIGTVGTLLGGNGVNISAMQVGTTEEEGKNL 524

Query: 67  SFLCIDGSILNSVLEKL 83
             L +D  I  ++LE +
Sbjct: 525 MVLTVDNDIPAALLETV 541


>gi|172057923|ref|YP_001814383.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Exiguobacterium sibiricum 255-15]
 gi|171990444|gb|ACB61366.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Exiguobacterium sibiricum 255-15]
          Length = 220

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N     +  G   + +++ D  G +  V +IL +Y INI H  + R +  + A+
Sbjct: 130 IEITELNGVPLKLSGGGPALIVLHHDRFGAIAAVTSILADYEINIGHMEVSRHEKGKQAL 189

Query: 67  SFLCIDGSILNSVLEKL 83
             + ID  +  +VLE++
Sbjct: 190 MAIEIDDRMPTAVLEEI 206


>gi|311898491|dbj|BAJ30899.1| putative D-3-phosphoglycerate dehydrogenase [Kitasatospora setae
           KM-6054]
          Length = 528

 Score = 37.7 bits (86), Expect = 0.50,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 17  FDVDIGRL--MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGS 74
           FDVD+     M      D  G+V  +G ILG+ GINIA   + R   +  A++ + +D  
Sbjct: 447 FDVDVALTDHMAFFHYEDRPGVVGTLGRILGDAGINIAGMQVARDGDS--ALASITVDSE 504

Query: 75  ILNSVLEKLSVNVTIRFVK 93
           +   VL +++  +  RF +
Sbjct: 505 VSQEVLAEIAAAIGARFAR 523


>gi|298491116|ref|YP_003721293.1| D-3-phosphoglycerate dehydrogenase ['Nostoc azollae' 0708]
 gi|298233034|gb|ADI64170.1| D-3-phosphoglycerate dehydrogenase ['Nostoc azollae' 0708]
          Length = 526

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 41/73 (56%)

Query: 18  DVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILN 77
           +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR      A+  L ID  + +
Sbjct: 447 NVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKIVRGDAVMALSIDDPLPD 506

Query: 78  SVLEKLSVNVTIR 90
            +L++++    IR
Sbjct: 507 GILDEITKVPGIR 519


>gi|291287172|ref|YP_003503988.1| D-3-phosphoglycerate dehydrogenase [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884332|gb|ADD68032.1| D-3-phosphoglycerate dehydrogenase [Denitrovibrio acetiphilus DSM
           12809]
          Length = 544

 Score = 37.7 bits (86), Expect = 0.51,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   R +   +   D+      +   N D  GI+  VG ILG++ INIA F L R+ 
Sbjct: 445 VFADQTGRIVIYDKYYTDLIAEGTFLYFNNLDRPGIIGKVGTILGKHSINIADFDLARNV 504

Query: 61  STE---HAISFLCIDGSILNSVLEKL 83
             +    A++F+ +D  +   VL+++
Sbjct: 505 KEDGEADAVAFVRVDSKVPAGVLDEI 530


>gi|319940181|ref|ZP_08014534.1| L-serine dehydratase [Streptococcus anginosus 1_2_62CV]
 gi|319810652|gb|EFW06982.1| L-serine dehydratase [Streptococcus anginosus 1_2_62CV]
          Length = 223

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAGEKAI 193

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D       +E++
Sbjct: 194 MIIEVDSRSCEGAIEEI 210


>gi|330839849|ref|YP_004414429.1| D-3-phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC
           35185]
 gi|329747613|gb|AEC00970.1| D-3-phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC
           35185]
          Length = 527

 Score = 37.7 bits (86), Expect = 0.53,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 8   RFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           R + I     DVD   R++IC  + +  G++  VG ++GE G+NI+   +GR+      +
Sbjct: 435 RIVSINGYRVDVDPHDRILIC-PHINRPGVIGTVGTMMGERGVNISSMQVGRTDKEGTNV 493

Query: 67  SFLCIDGSILNSVLEKLS 84
             L +D  I   +L++++
Sbjct: 494 MVLTVDHDIPEDLLQQIT 511


>gi|260888757|ref|ZP_05900020.1| phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC 35185]
 gi|260861510|gb|EEX76010.1| phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC 35185]
          Length = 529

 Score = 37.7 bits (86), Expect = 0.53,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 8   RFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           R + I     DVD   R++IC  + +  G++  VG ++GE G+NI+   +GR+      +
Sbjct: 437 RIVSINGYRVDVDPHDRILIC-PHINRPGVIGTVGTMMGERGVNISSMQVGRTDKEGTNV 495

Query: 67  SFLCIDGSILNSVLEKLS 84
             L +D  I   +L++++
Sbjct: 496 MVLTVDHDIPEDLLQQIT 513


>gi|153005366|ref|YP_001379691.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. Fw109-5]
 gi|152028939|gb|ABS26707.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. Fw109-5]
          Length = 528

 Score = 37.7 bits (86), Expect = 0.54,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 2/84 (2%)

Query: 1   VFSDGKPRFIKIQEINFD-VDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           V+   + R +++     + V  G +++C  N D  G+V  +G  L   G+NIA   L R 
Sbjct: 432 VYGKREARVVRVNAFRVEAVPDGNVLLC-ENDDAPGVVGNLGTTLAAAGVNIAQISLSRL 490

Query: 60  QSTEHAISFLCIDGSILNSVLEKL 83
           +    A +FL +D      +LEK+
Sbjct: 491 EDRSGAFAFLNVDSPPSAELLEKV 514


>gi|284163372|ref|YP_003401651.1| D-3-phosphoglycerate dehydrogenase [Haloterrigena turkmenica DSM
           5511]
 gi|284013027|gb|ADB58978.1| D-3-phosphoglycerate dehydrogenase [Haloterrigena turkmenica DSM
           5511]
          Length = 528

 Score = 37.7 bits (86), Expect = 0.56,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 41/89 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR +++     D      M+   N D  G++  +G+++G++ +NIA     R  
Sbjct: 428 LFAGDDPRIVRVDGYRVDAIPHGKMVVTRNTDEPGVIGLIGSVMGDHDVNIAGMFNARET 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTI 89
               A++   +D  I +   E+L  +  I
Sbjct: 488 IGGEALTVYNVDSEIPDGAREELEADERI 516


>gi|307265064|ref|ZP_07546624.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919862|gb|EFN50076.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 533

 Score = 37.7 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 35/60 (58%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           M+ + N D+ G++  +GN LG++GINI+   +  +++   A+  +  D  I +  +E L+
Sbjct: 459 MLFVKNKDVPGVIGHIGNALGDFGINISTMQVSPNKNDGTALMIVSTDKEIPDEAVESLN 518


>gi|317121362|ref|YP_004101365.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter marianensis DSM
           12885]
 gi|315591342|gb|ADU50638.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter marianensis DSM
           12885]
          Length = 571

 Score = 37.7 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 40/80 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG PR + +  +  D+     ++   + D  G++  VG++LG   INIA   + R Q   
Sbjct: 443 DGLPRLVHLDGLPLDMVPAPRLLLTRHHDRPGMIGKVGSLLGAREINIAAMQVARRQVRG 502

Query: 64  HAISFLCIDGSILNSVLEKL 83
            AI  L +D  +  ++L ++
Sbjct: 503 EAIMVLALDDPVPAALLAEI 522


>gi|323701688|ref|ZP_08113360.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum nigrificans
           DSM 574]
 gi|323533461|gb|EGB23328.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum nigrificans
           DSM 574]
          Length = 527

 Score = 37.7 bits (86), Expect = 0.59,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 40/84 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR + I     +      M+ I + D  GIV  VG ++G+  INIA   +GR +
Sbjct: 431 LFQGNDPRVVNIDGYRINAATTGHMLVIPHIDKPGIVGKVGTLVGDKDINIAGMQVGRIE 490

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
               AI  + +D  +    L++++
Sbjct: 491 LGGKAIMVMMVDNIVPQCALDEMA 514


>gi|297844730|ref|XP_002890246.1| 3-phosphoglycerate dehydrogenase [Arabidopsis lyrata subsp. lyrata]
 gi|297336088|gb|EFH66505.1| 3-phosphoglycerate dehydrogenase [Arabidopsis lyrata subsp. lyrata]
          Length = 613

 Score = 37.4 bits (85), Expect = 0.61,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G P    +     DV + G L++C    D  G++  VG+ILGE  +N+    +GR+   +
Sbjct: 521 GVPHLTCVGSFGVDVSLEGNLILC-RQVDQPGMIGQVGHILGEQNVNVNFMSVGRTVLRK 579

Query: 64  HAISFLCIDGSILNSVLEKL 83
            AI  + +D    N  LE++
Sbjct: 580 QAIMAIGVDEEPDNKTLERI 599


>gi|114565585|ref|YP_752739.1| D-3-phosphoglycerate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114336520|gb|ABI67368.1| D-3-phosphoglycerate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 530

 Score = 37.4 bits (85), Expect = 0.61,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 37/78 (47%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           P  ++I     + ++   ++ + N D   ++      LG+ GINIA   + R    E AI
Sbjct: 439 PLLVEINGYETESNLEGYLLVVENEDRPRVIGPFATALGDEGINIAGMKVARKTKGEKAI 498

Query: 67  SFLCIDGSILNSVLEKLS 84
             + +D  +   VLEKLS
Sbjct: 499 MIINVDNKVEEPVLEKLS 516


>gi|322386439|ref|ZP_08060068.1| L-serine ammonia-lyase beta subunit [Streptococcus cristatus ATCC
           51100]
 gi|321269525|gb|EFX52456.1| L-serine ammonia-lyase beta subunit [Streptococcus cristatus ATCC
           51100]
          Length = 247

 Score = 37.4 bits (85), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    I IV+ D+ G++  V   L  Y INIA   + R ++ E AI
Sbjct: 158 IQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMTVTREKAGEKAI 217

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D       +E++
Sbjct: 218 MIIEVDSRSCEEAIEEI 234


>gi|222481126|ref|YP_002567363.1| D-3-phosphoglycerate dehydrogenase [Halorubrum lacusprofundi ATCC
           49239]
 gi|222454028|gb|ACM58293.1| D-3-phosphoglycerate dehydrogenase [Halorubrum lacusprofundi ATCC
           49239]
          Length = 534

 Score = 37.4 bits (85), Expect = 0.62,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 2/100 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+    R ++I     D      M+   N D  G++  +G +LG+Y +NIA  +  R  
Sbjct: 429 LFAGEDARIVRIDGFRVDAVPYGHMLVARNTDEPGVIGLIGTVLGDYDVNIAGMYNARET 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               A++   +D  + +  +E L  +   R V+  E  +D
Sbjct: 489 QGGEALTVYNLDQDVPDEAIEALLAD--DRIVEVTEITLD 526


>gi|52080816|ref|YP_079607.1| D-3-phosphoglycerate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|52786187|ref|YP_092016.1| D-3-phosphoglycerate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|319645226|ref|ZP_07999459.1| SerA protein [Bacillus sp. BT1B_CT2]
 gi|52004027|gb|AAU23969.1| phosphoglycerate dehydrogenase SerA [Bacillus licheniformis ATCC
           14580]
 gi|52348689|gb|AAU41323.1| SerA [Bacillus licheniformis ATCC 14580]
 gi|317393035|gb|EFV73829.1| SerA protein [Bacillus sp. BT1B_CT2]
          Length = 525

 Score = 37.4 bits (85), Expect = 0.62,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 17  FDVDI--GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGS 74
           FD+D      ++ I + D  G +  VG ILG++ INIA   +GR +    AI  L  D  
Sbjct: 442 FDIDFYPAGHLVYIHHQDKPGAIGHVGRILGDHDINIATMQVGRKEKGGEAIMMLSFDRH 501

Query: 75  ILNSVLEKL 83
           + + +L +L
Sbjct: 502 LEDDILAEL 510


>gi|308173548|ref|YP_003920253.1| L-serine dehydratase subunit beta [Bacillus amyloliquefaciens DSM
           7]
 gi|307606412|emb|CBI42783.1| L-serine dehydratase (beta chain) [Bacillus amyloliquefaciens DSM
           7]
 gi|328553519|gb|AEB24011.1| L-serine dehydratase (beta chain) [Bacillus amyloliquefaciens
           TA208]
 gi|328911689|gb|AEB63285.1| L-serine dehydratase (beta chain) [Bacillus amyloliquefaciens LL3]
          Length = 220

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%), Gaps = 3/79 (3%)

Query: 10  IKIQEIN-FDVDIG--RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N F++ +      I +V+ D  G +  V N+L ++ IN+ H  + R    + A+
Sbjct: 130 IEITELNGFELRLSGNHPAILVVHNDKFGTIAGVANVLAKFSINVGHMEVARKDVGQLAL 189

Query: 67  SFLCIDGSILNSVLEKLSV 85
             + +D +I   VL++LS 
Sbjct: 190 MTIEVDQNIEEEVLDELST 208


>gi|154686001|ref|YP_001421162.1| SdaAB [Bacillus amyloliquefaciens FZB42]
 gi|154351852|gb|ABS73931.1| SdaAB [Bacillus amyloliquefaciens FZB42]
          Length = 220

 Score = 37.4 bits (85), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%), Gaps = 3/79 (3%)

Query: 10  IKIQEIN-FDVDIG--RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N F++ +      I +V+ D  G +  V N+L ++ IN+ H  + R    + A+
Sbjct: 130 IEITELNGFELRLSGNHPAILVVHNDKFGTIAGVANVLAKFSINVGHMEVARKDVGQLAL 189

Query: 67  SFLCIDGSILNSVLEKLSV 85
             + +D +I   VL++LS 
Sbjct: 190 MTIEVDQNIEEEVLDELST 208


>gi|153814124|ref|ZP_01966792.1| hypothetical protein RUMTOR_00333 [Ruminococcus torques ATCC 27756]
 gi|317499930|ref|ZP_07958166.1| hypothetical protein HMPREF1026_00108 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331087847|ref|ZP_08336772.1| L-serine dehydratase [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145848520|gb|EDK25438.1| hypothetical protein RUMTOR_00333 [Ruminococcus torques ATCC 27756]
 gi|316898647|gb|EFV20682.1| hypothetical protein HMPREF1026_00108 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330409542|gb|EGG88983.1| L-serine dehydratase [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 228

 Score = 37.4 bits (85), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK R  +I E+  D       + ++  D  G++  + N L E  +NIA+  L R +    
Sbjct: 130 GKIRIARINEVEVDFTGEYSTLIVIQQDKPGVIAHITNCLSEMNVNIAYMKLYREEKGCT 189

Query: 65  AISFLCIDGSILNSVLEKLSVN 86
           A S +  DG +  +V  ++  N
Sbjct: 190 AYSIVESDGIVPQTVAGRIKEN 211


>gi|169825985|ref|YP_001696143.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus sphaericus
           C3-41]
 gi|168990473|gb|ACA38013.1| Phosphoglycerate dehydrogenase [Lysinibacillus sphaericus C3-41]
          Length = 535

 Score = 37.4 bits (85), Expect = 0.67,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 42/93 (45%), Gaps = 10/93 (10%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +K+++   DV     ++ I N D  G +  V   L E  INIA   +GR+Q    A+ 
Sbjct: 446 RIVKVEDYVVDVIPQGHLLYIKNTDKPGAIGRVATKLAEKDINIATMQVGRAQVGGTAVM 505

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            L ID  + N  L          FV Q E N+D
Sbjct: 506 MLTIDNVVTNEDLA---------FVAQLE-NID 528


>gi|256396892|ref|YP_003118456.1| D-3-phosphoglycerate dehydrogenase [Catenulispora acidiphila DSM
           44928]
 gi|256363118|gb|ACU76615.1| D-3-phosphoglycerate dehydrogenase [Catenulispora acidiphila DSM
           44928]
          Length = 535

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 7   PRFI-KIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           PR + KI E++    DV I   ++ +   D  G+V  +G +LG  GINI    + R+   
Sbjct: 439 PRLVEKIVEVDGFQLDVTIAEHLLFLRYTDRPGVVGQLGGVLGAAGINIGGMQVARAAKG 498

Query: 63  EHAISFLCIDGSILNSVLEKLSVNV 87
             A+  L +D  +   +LE++   +
Sbjct: 499 GEALVALTVDSVVPAGLLEEIKAAI 523


>gi|331004363|ref|ZP_08327836.1| L-serine dehydratase [Lachnospiraceae oral taxon 107 str. F0167]
 gi|330411093|gb|EGG90512.1| L-serine dehydratase [Lachnospiraceae oral taxon 107 str. F0167]
          Length = 221

 Score = 37.4 bits (85), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 37/82 (45%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK R +KI  ++ D       I +V+ D  G++ ++  IL E+ INIA   L R      
Sbjct: 130 GKVRIVKIDRVDIDFSGEYSAIILVHRDRPGVIAYITKILSEHNINIAFMKLYRESKGNK 189

Query: 65  AISFLCIDGSILNSVLEKLSVN 86
           A + +  D  I   +   L  N
Sbjct: 190 AYTIIESDEMITPDIKSGLYKN 211


>gi|17229382|ref|NP_485930.1| D-3-phosphoglycerate dehydrogenase [Nostoc sp. PCC 7120]
 gi|17130980|dbj|BAB73589.1| phosphoglycerate dehydrogenase [Nostoc sp. PCC 7120]
          Length = 526

 Score = 37.4 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 40/73 (54%)

Query: 18  DVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILN 77
           +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR      A+  L ID  + +
Sbjct: 447 NVPPSKYMVFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKIVRGDAVMALSIDDPLPD 506

Query: 78  SVLEKLSVNVTIR 90
            +L +++    IR
Sbjct: 507 GILAEITKVPGIR 519


>gi|160936062|ref|ZP_02083435.1| hypothetical protein CLOBOL_00958 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440872|gb|EDP18596.1| hypothetical protein CLOBOL_00958 [Clostridium bolteae ATCC
           BAA-613]
          Length = 271

 Score = 37.4 bits (85), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK R  +I  I+ D       + I++ D LG++  +   L E  +NIA   L R    + 
Sbjct: 171 GKVRISRIDHIDVDFSGEYSTLIIIHRDRLGVLAHITRCLSEGYVNIAFMKLFRETKGDR 230

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFV 92
           A S +  DGS+ + ++ ++  N  ++ V
Sbjct: 231 AYSIIEFDGSLPDHMVSRIYENPDVQDV 258


>gi|159036772|ref|YP_001536025.1| D-3-phosphoglycerate dehydrogenase [Salinispora arenicola CNS-205]
 gi|157915607|gb|ABV97034.1| D-3-phosphoglycerate dehydrogenase [Salinispora arenicola CNS-205]
          Length = 531

 Score = 37.4 bits (85), Expect = 0.73,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 45/80 (56%), Gaps = 3/80 (3%)

Query: 11  KIQEIN-FDVDIGR--LMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           K+ E++ FDV+IG   +++ +   D  G+V  VG +LG  G+NIA   + R ++    + 
Sbjct: 439 KLTEVDGFDVEIGAEGILVFLRYVDRPGVVGTVGTLLGAAGVNIAAMQVARREAGGETLM 498

Query: 68  FLCIDGSILNSVLEKLSVNV 87
            L +D ++   +L  ++ +V
Sbjct: 499 TLTVDQALGADLLTSVADSV 518


>gi|15615060|ref|NP_243363.1| L-serine dehydratase beta subunit [Bacillus halodurans C-125]
 gi|10175117|dbj|BAB06216.1| L-serine dehydratase beta subunit [Bacillus halodurans C-125]
          Length = 220

 Score = 37.4 bits (85), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 42/80 (52%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK   +++   +  +      I +V+ D  G++  V N+L ++ INI H  + R +  + 
Sbjct: 128 GKIEIVELNGFHLKLSGNHPAILVVHTDRFGVIASVSNMLAKHEINIGHMEVSRKEKGKE 187

Query: 65  AISFLCIDGSILNSVLEKLS 84
           A+  + +D ++ + +L++L 
Sbjct: 188 ALMVIEVDQNVDDLLLQELE 207


>gi|119717608|ref|YP_924573.1| D-3-phosphoglycerate dehydrogenase [Nocardioides sp. JS614]
 gi|119538269|gb|ABL82886.1| D-3-phosphoglycerate dehydrogenase [Nocardioides sp. JS614]
          Length = 536

 Score = 37.4 bits (85), Expect = 0.74,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 39/78 (50%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           K R +++   + D++    +  +   D  G+V  VG I+G+ GINIA   + R      A
Sbjct: 444 KERLVEVNGFDVDLEPTEHLAFLTYEDRPGMVGTVGVIIGDAGINIAGMQVARDAKGGRA 503

Query: 66  ISFLCIDGSILNSVLEKL 83
           +  L +D +I   VL ++
Sbjct: 504 LVALSVDTAIPAEVLAEM 521


>gi|260588469|ref|ZP_05854382.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Blautia
           hansenii DSM 20583]
 gi|331082254|ref|ZP_08331381.1| L-serine dehydratase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260540944|gb|EEX21513.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Blautia
           hansenii DSM 20583]
 gi|330403048|gb|EGG82613.1| L-serine dehydratase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 223

 Score = 37.0 bits (84), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK + +K+ +I  D       + +   D  G+V  +  +L E G+NIA   L R +    
Sbjct: 131 GKVKIVKLNQIEVDFTGEYSTLIVSQTDKPGVVAHITRVLSEEGVNIAFMRLFREEKGAA 190

Query: 65  AISFLCIDGSILNSVLEKLSVN 86
           A + +  D  I   VL+++  N
Sbjct: 191 AFTVVESDEKIPAKVLDRIREN 212


>gi|302384761|ref|YP_003820583.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium saccharolyticum WM1]
 gi|302195389|gb|ADL02960.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium saccharolyticum WM1]
          Length = 222

 Score = 37.0 bits (84), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 37/79 (46%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK + I+I  I+ D       + I + D  G+V ++   L E  +NIA   L R +    
Sbjct: 130 GKVKIIRINGIDVDFTGEYSTLVIRHLDYPGMVAYIATSLSERNVNIAFMRLFRERKGAT 189

Query: 65  AISFLCIDGSILNSVLEKL 83
           A S +  D  I   +LEKL
Sbjct: 190 AYSVVESDEEIPQELLEKL 208


>gi|293335763|ref|NP_001170081.1| hypothetical protein LOC100383999 [Zea mays]
 gi|224033345|gb|ACN35748.1| unknown [Zea mays]
          Length = 519

 Score = 37.0 bits (84), Expect = 0.84,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 5/94 (5%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G P    +     DV + G L++C    D  G++  VGNILG+  +NI    +GR+   +
Sbjct: 427 GVPHLTLVGPYEVDVSLEGNLILC-RQIDQPGMIGKVGNILGDTNVNINFMSVGRTFRGK 485

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            AI  + +D       LEK+     I  +++F F
Sbjct: 486 QAIMAIGVDEEPDKDTLEKIG---AIPAIEEFVF 516


>gi|194704786|gb|ACF86477.1| unknown [Zea mays]
          Length = 624

 Score = 37.0 bits (84), Expect = 0.84,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 5/94 (5%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G P    +     DV + G L++C    D  G++  VGNILG+  +NI    +GR+   +
Sbjct: 532 GVPHLTLVGPYEVDVSLEGNLILC-RQIDQPGMIGKVGNILGDTNVNINFMSVGRTFRGK 590

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            AI  + +D       LEK+     I  +++F F
Sbjct: 591 QAIMAIGVDEEPDKDTLEKIG---AIPAIEEFVF 621


>gi|134102592|ref|YP_001108253.1| D-3-phosphoglycerate dehydrogenase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|291004723|ref|ZP_06562696.1| D-3-phosphoglycerate dehydrogenase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|133915215|emb|CAM05328.1| D-3-phosphoglycerate dehydrogenase (PgdH) [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 531

 Score = 37.0 bits (84), Expect = 0.84,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 11  KIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           KI E+N   FD+     ++ +   D  G++  VG +LGE G+NI    + ++     A+ 
Sbjct: 441 KIVEVNGRHFDLRAEGNVLLLEYPDRPGVMGKVGTLLGEVGVNIEAATVSQTTERSDAVM 500

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  +   VLE +   V  R V+   F
Sbjct: 501 LLRVDRPVDAGVLEPIGAAVGARVVRAVTF 530


>gi|226529328|ref|NP_001147079.1| LOC100280688 [Zea mays]
 gi|195607108|gb|ACG25384.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 624

 Score = 37.0 bits (84), Expect = 0.85,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 45/94 (47%), Gaps = 5/94 (5%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G P    +     DV + G L++C    D  G++  VGNILG+  +NI    +GR+   +
Sbjct: 532 GVPHLTLVGPYEVDVSLEGNLILC-RQIDQPGMIGKVGNILGDTNVNINFMSVGRTFRGK 590

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            AI  + +D       LEK+     I  +++F F
Sbjct: 591 QAIMAIGVDEEPDKDTLEKIG---AILAIEEFVF 621


>gi|116789697|gb|ABK25346.1| unknown [Picea sitchensis]
          Length = 622

 Score = 37.0 bits (84), Expect = 0.85,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 37/79 (46%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P   K+   + DV +   +I     D  G++  VGNILGE  +N+    +GR    + 
Sbjct: 530 GIPHLSKVGAFSVDVSLEGSVILCRQTDQPGMIGTVGNILGEENVNVNFMSVGRIAPRKK 589

Query: 65  AISFLCIDGSILNSVLEKL 83
           A+  + +D       L+K+
Sbjct: 590 AVMAIGVDEEPSKGALKKI 608


>gi|225388457|ref|ZP_03758181.1| hypothetical protein CLOSTASPAR_02193 [Clostridium asparagiforme
           DSM 15981]
 gi|225045486|gb|EEG55732.1| hypothetical protein CLOSTASPAR_02193 [Clostridium asparagiforme
           DSM 15981]
          Length = 253

 Score = 37.0 bits (84), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 10  IKIQEIN-FDVDIG--RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I ++EIN  DV I      + +++ D  G +  V  +L + G+NI +F L R Q    A+
Sbjct: 162 ILVREINGMDVSITGQHTTLIVLHRDAPGTIASVTEVLADAGVNICNFRLSREQKGGQAV 221

Query: 67  SFLCIDGSILNSVLEKLSV 85
             + IDGS    + +K+ V
Sbjct: 222 MTIEIDGSFGQELNDKVQV 240


>gi|319653242|ref|ZP_08007344.1| L-serine dehydratase subunit [Bacillus sp. 2_A_57_CT2]
 gi|317395163|gb|EFV75899.1| L-serine dehydratase subunit [Bacillus sp. 2_A_57_CT2]
          Length = 220

 Score = 37.0 bits (84), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 49/90 (54%), Gaps = 7/90 (7%)

Query: 10  IKIQEIN-FDVDIG--RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N F++ +      I +V+ D  G++  V NIL ++ INI H  + R +  + AI
Sbjct: 130 IEITELNSFELKLSGEHPAILVVHNDQFGVISAVTNILSKHQINIGHMEVSRKEKGKMAI 189

Query: 67  SFLCIDGSILNSVLEKLS--VNVT--IRFV 92
             + +D  I + V+ +L    N+T  IR V
Sbjct: 190 MVIEVDQKIGHDVMTELEGLPNITQIIRMV 219


>gi|75909963|ref|YP_324259.1| D-3-phosphoglycerate dehydrogenase [Anabaena variabilis ATCC 29413]
 gi|75703688|gb|ABA23364.1| D-3-phosphoglycerate dehydrogenase [Anabaena variabilis ATCC 29413]
          Length = 526

 Score = 37.0 bits (84), Expect = 0.95,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 40/73 (54%)

Query: 18  DVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILN 77
           +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR      A+  L ID  + +
Sbjct: 447 NVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKIVRGDAVMALSIDDPLPD 506

Query: 78  SVLEKLSVNVTIR 90
            +L +++    IR
Sbjct: 507 GILAEITKVPGIR 519


>gi|269838299|ref|YP_003320527.1| D-3-phosphoglycerate dehydrogenase [Sphaerobacter thermophilus DSM
           20745]
 gi|269787562|gb|ACZ39705.1| D-3-phosphoglycerate dehydrogenase [Sphaerobacter thermophilus DSM
           20745]
          Length = 737

 Score = 37.0 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 35  GIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKL 83
           G+V  VG ILG Y +NIA   +GR +    AI  L +D  I  + L ++
Sbjct: 655 GVVGRVGTILGRYNVNIAGMQVGRHERGGQAIMVLNVDDIIPEAALAEI 703


>gi|323350806|ref|ZP_08086465.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis VMC66]
 gi|322122980|gb|EFX94683.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis VMC66]
          Length = 234

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ E AI
Sbjct: 145 IQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAGEKAI 204

Query: 67  SFLCID 72
             + +D
Sbjct: 205 MIIEVD 210


>gi|327467647|gb|EGF13144.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK330]
          Length = 234

 Score = 36.6 bits (83), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ E AI
Sbjct: 145 IQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAGEKAI 204

Query: 67  SFLCID 72
             + +D
Sbjct: 205 MIIEVD 210


>gi|302780109|ref|XP_002971829.1| hypothetical protein SELMODRAFT_412481 [Selaginella moellendorffii]
 gi|300160128|gb|EFJ26746.1| hypothetical protein SELMODRAFT_412481 [Selaginella moellendorffii]
          Length = 625

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 45/94 (47%), Gaps = 3/94 (3%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG     ++ + + DV +   +I     D  GI+  VG +LG+  +N++   +GR+   +
Sbjct: 532 DGLAHLSQVGQFSMDVSLEGSVILCKQVDQPGIIGKVGGLLGDGNVNVSFMSVGRTSPRK 591

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  + +D      VL ++     I  V++F F
Sbjct: 592 QAVMAIGVDEEPSKEVLHRIG---AIPAVEEFVF 622


>gi|157151322|ref|YP_001449342.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus gordonii str. Challis substr. CH1]
 gi|157076116|gb|ABV10799.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus gordonii str. Challis substr. CH1]
          Length = 223

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAGEKAI 193

Query: 67  SFLCID 72
             + +D
Sbjct: 194 MIIEVD 199


>gi|160879605|ref|YP_001558573.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium phytofermentans ISDg]
 gi|160428271|gb|ABX41834.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium phytofermentans ISDg]
          Length = 222

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (46%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK + ++I  I+ D       + I + D  G+V ++   L E  +NIA   L R +    
Sbjct: 130 GKIKIVRINGIDVDFTGEYSTLVIRHHDYPGMVAYIATSLSERNVNIAFMRLFRERKGAT 189

Query: 65  AISFLCIDGSILNSVLEKL 83
           A S +  D  I   +LEKL
Sbjct: 190 AYSVVESDEEIPRELLEKL 208


>gi|325689332|gb|EGD31338.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK115]
          Length = 223

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAGEKAI 193

Query: 67  SFLCID 72
             + +D
Sbjct: 194 MIIEVD 199


>gi|268324733|emb|CBH38321.1| D-3-phosphoglycerate dehydrogenase [uncultured archaeon]
          Length = 542

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 9/99 (9%)

Query: 1   VFSDGKPRFIKIQEINFDVD-IGRLMIC--IVNADILGIVVFVGNILGEYGINIAHFHLG 57
           +F    PR +KI     D    G ++IC  I    ++G V     ILG++ INI    +G
Sbjct: 446 LFGKDDPRIVKIDGFWMDASPSGHMLICSFIDKPRVIGPVC---TILGDHSINITGMRVG 502

Query: 58  RSQSTEHAISFLCIDGSILNSVLE---KLSVNVTIRFVK 93
           R +    A+  L +D  +   ++E   K+   + I+ VK
Sbjct: 503 REKKEGEAVMVLNVDNPVAGDIIEDIMKVENLIDIKLVK 541


>gi|328945152|gb|EGG39307.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis
           SK1087]
          Length = 223

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAGEKAI 193

Query: 67  SFLCID 72
             + +D
Sbjct: 194 MIIEVD 199


>gi|324991888|gb|EGC23811.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK405]
 gi|324996222|gb|EGC28132.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK678]
 gi|327458512|gb|EGF04862.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK1]
 gi|327471586|gb|EGF17029.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK408]
 gi|327490316|gb|EGF22103.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis
           SK1058]
          Length = 223

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAGEKAI 193

Query: 67  SFLCID 72
             + +D
Sbjct: 194 MIIEVD 199


>gi|119356910|ref|YP_911554.1| D-3-phosphoglycerate dehydrogenase [Chlorobium phaeobacteroides DSM
           266]
 gi|119354259|gb|ABL65130.1| D-3-phosphoglycerate dehydrogenase [Chlorobium phaeobacteroides DSM
           266]
          Length = 526

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 42/84 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D + R + I     +      +I   N D  G++  V  +L  + +N+A   L R +
Sbjct: 430 VFGDKELRIVMIDRFIVEFKPEGTIIIYNNIDQPGVIAQVTQLLLLHNLNVASIALSRDE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
             + AI+ + +DG +  ++L+++S
Sbjct: 490 EKKLAITAIVVDGGVTTTLLDEIS 513


>gi|324989556|gb|EGC21502.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK353]
 gi|325686454|gb|EGD28483.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK72]
          Length = 223

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAGEKAI 193

Query: 67  SFLCID 72
             + +D
Sbjct: 194 MIIEVD 199


>gi|119508833|ref|ZP_01627985.1| D-3-phosphoglycerate dehydrogenase [Nodularia spumigena CCY9414]
 gi|119466362|gb|EAW47247.1| D-3-phosphoglycerate dehydrogenase [Nodularia spumigena CCY9414]
          Length = 526

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 39/73 (53%)

Query: 18  DVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILN 77
           +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR      A+  L ID  + +
Sbjct: 447 NVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKIVRGDAVMALSIDDPLPD 506

Query: 78  SVLEKLSVNVTIR 90
            +L ++     IR
Sbjct: 507 GILAEIVKVAGIR 519


>gi|261403538|ref|YP_003247762.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus vulcanius
           M7]
 gi|261370531|gb|ACX73280.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus vulcanius
           M7]
          Length = 524

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 4   DGKPRFIKIQ--EINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           + KP  + +   ++NF +  G L I I + D  G +  V  +LG+YGINIA   +GR + 
Sbjct: 431 NNKPVILDVDGYDVNF-IPEGALAI-IKHIDRPGTIGRVCILLGDYGINIAGMQVGRKEP 488

Query: 62  TEHAISFLCIDGSILNSVLEKL 83
              ++  L +D ++   V+EK+
Sbjct: 489 GGESVMLLNLDHTVPEDVIEKI 510


>gi|125719135|ref|YP_001036268.1| L-serine dehydratase beta subunit [Streptococcus sanguinis SK36]
 gi|125499052|gb|ABN45718.1| L-serine dehydratase beta subunit [Streptococcus sanguinis SK36]
 gi|325695738|gb|EGD37637.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK150]
 gi|325698054|gb|EGD39935.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK160]
          Length = 223

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N     + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ E AI
Sbjct: 134 IQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAGEKAI 193

Query: 67  SFLCID 72
             + +D
Sbjct: 194 MIIEVD 199


>gi|256380010|ref|YP_003103670.1| D-3-phosphoglycerate dehydrogenase [Actinosynnema mirum DSM 43827]
 gi|255924313|gb|ACU39824.1| D-3-phosphoglycerate dehydrogenase [Actinosynnema mirum DSM 43827]
          Length = 532

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 48/95 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           D   + + +   +FD+     ++ +  +D  G++  VG +LGE G+N+    + + +   
Sbjct: 438 DQVEKIVGVNGRSFDLRAEGNVLLLEYSDRPGVMGTVGTLLGEAGVNVEAAQISQQKGGS 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            A+  L +D  + ++VL+ +  +V  R ++   F+
Sbjct: 498 EALMLLRVDRPVDSNVLDPIGASVGARTMRSVNFD 532


>gi|296331160|ref|ZP_06873634.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674316|ref|YP_003865988.1| L-serine dehydratase subunit beta [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151804|gb|EFG92679.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412560|gb|ADM37679.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 220

 Score = 36.6 bits (83), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 34/59 (57%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           I +V+ D  G +  V N+L ++ IN+ H  + R    + A+  + +D +I + VL++LS
Sbjct: 149 ILVVHNDKFGTIAGVANVLAKFSINVGHMEVARKDIGQLALMTIEVDQNIDDHVLDELS 207


>gi|331086303|ref|ZP_08335383.1| L-serine dehydratase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330406069|gb|EGG85592.1| L-serine dehydratase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 222

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK + ++I +I+ +       + +   D  G+V  +   L E  +NIA   L R     +
Sbjct: 130 GKMKIVRINQIDVEFTGEYSTLIVSQTDKPGVVAHITQCLSEENVNIAFMRLFREDKGAN 189

Query: 65  AISFLCIDGSILNSVLEKLSVN 86
           A + +  D +I +SVLEK+  +
Sbjct: 190 AFTVVESDETIPSSVLEKIKTH 211


>gi|242081631|ref|XP_002445584.1| hypothetical protein SORBIDRAFT_07g021980 [Sorghum bicolor]
 gi|241941934|gb|EES15079.1| hypothetical protein SORBIDRAFT_07g021980 [Sorghum bicolor]
          Length = 619

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 5/94 (5%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G P    +     DV + G L++C    D  G++  VGNILG+  +NI+   +GR+   +
Sbjct: 527 GVPHLTLVGPYEVDVSLEGNLILC-RQIDQPGMIGKVGNILGQRNVNISFMSVGRTFRGK 585

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            AI  + +D       LE +     I  +++F F
Sbjct: 586 QAIMAIGVDEEPDKETLENIG---AIPAIEEFVF 616


>gi|307326525|ref|ZP_07605720.1| D-3-phosphoglycerate dehydrogenase [Streptomyces violaceusniger Tu
           4113]
 gi|306887933|gb|EFN18924.1| D-3-phosphoglycerate dehydrogenase [Streptomyces violaceusniger Tu
           4113]
          Length = 533

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 41/77 (53%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M  +   D  G+V  +G ILGE GINIA   + R+ +   A+ 
Sbjct: 443 KIVAVGEYDVDLALADHMAFLRYTDRPGVVGTLGRILGEAGINIAGMQVSRAAAGGAALV 502

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D +I   VL +++
Sbjct: 503 ALTVDDTIPQPVLTEIA 519


>gi|283782491|ref|YP_003373246.1| D-3-phosphoglycerate dehydrogenase [Pirellula staleyi DSM 6068]
 gi|283440944|gb|ADB19386.1| D-3-phosphoglycerate dehydrogenase [Pirellula staleyi DSM 6068]
          Length = 542

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 31/59 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           +F +  PR I++ +   +  +   ++   + D+ GI+  VG I G + +NI    +GR+
Sbjct: 432 LFGNNMPRLIRLGDYRLEAYLDGNLLIFTHHDVPGIIGAVGTIFGNHKVNIGQMSVGRA 490


>gi|224060560|ref|XP_002300235.1| predicted protein [Populus trichocarpa]
 gi|118485917|gb|ABK94804.1| unknown [Populus trichocarpa]
 gi|222847493|gb|EEE85040.1| predicted protein [Populus trichocarpa]
          Length = 597

 Score = 36.2 bits (82), Expect = 1.4,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 43/94 (45%), Gaps = 3/94 (3%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG++LG   +N++   +GR    +
Sbjct: 504 DGIPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGSVLGVENVNVSFMSVGRIAPRK 563

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  + +D       L+K+     I  V++F F
Sbjct: 564 QAVMAIGVDEQPSKETLKKIG---DIPAVEEFVF 594


>gi|157692265|ref|YP_001486727.1| L-serine ammonia-lyase beta chain [Bacillus pumilus SAFR-032]
 gi|157681023|gb|ABV62167.1| L-serine ammonia-lyase beta chain [Bacillus pumilus SAFR-032]
          Length = 220

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSV 85
           I +V+ D  G +  V N+L ++ INI H  + R    + A+  + +D +I  +VL +L  
Sbjct: 149 ILVVHNDRYGTIAAVANVLAKFAINIGHMEVARKDVGQEALMTIEVDQNIDPAVLLELET 208


>gi|194014916|ref|ZP_03053533.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           pumilus ATCC 7061]
 gi|194013942|gb|EDW23507.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           pumilus ATCC 7061]
          Length = 220

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSV 85
           I +V+ D  G +  V N+L ++ INI H  + R    + A+  + +D +I  + L +L  
Sbjct: 149 ILVVHNDRYGTIAAVANVLAKFAINIGHMEVARKDVGQEALMTIEVDQNIDPAALSELET 208


>gi|186685295|ref|YP_001868491.1| D-3-phosphoglycerate dehydrogenase [Nostoc punctiforme PCC 73102]
 gi|186467747|gb|ACC83548.1| D-3-phosphoglycerate dehydrogenase [Nostoc punctiforme PCC 73102]
          Length = 526

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 37/66 (56%)

Query: 18  DVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILN 77
           +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR      A+  L ID  +  
Sbjct: 447 NVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKIVRGDAVMALSIDDPLPE 506

Query: 78  SVLEKL 83
            +L+++
Sbjct: 507 GILDEI 512


>gi|330934580|ref|XP_003304604.1| hypothetical protein PTT_17253 [Pyrenophora teres f. teres 0-1]
 gi|311318673|gb|EFQ87289.1| hypothetical protein PTT_17253 [Pyrenophora teres f. teres 0-1]
          Length = 586

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 15/76 (19%)

Query: 22  GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR--------------SQSTEHAIS 67
           G L+IC  N D +G + +VGN+LG+ G+NI   ++                 Q  + A+ 
Sbjct: 498 GTLLIC-RNFDSVGKIGYVGNVLGKAGVNIKFMNVAPLDEEVEERQNEQNGGQGHKEALM 556

Query: 68  FLCIDGSILNSVLEKL 83
            L +DG +   VL++L
Sbjct: 557 ILGVDGRVGEDVLKRL 572


>gi|229541128|ref|ZP_04430188.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           coagulans 36D1]
 gi|229325548|gb|EEN91223.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           coagulans 36D1]
          Length = 220

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 35/58 (60%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKL 83
           + +V+ D  G +  V NIL  + INI H  + R ++ + A+  + +D ++ ++V+E++
Sbjct: 149 VLVVHQDRYGAIAAVSNILSAHEINIGHMEVSRKEAGKMALMAIEVDQNLDDAVIEEM 206


>gi|113477612|ref|YP_723673.1| D-3-phosphoglycerate dehydrogenase [Trichodesmium erythraeum
           IMS101]
 gi|110168660|gb|ABG53200.1| D-3-phosphoglycerate dehydrogenase [Trichodesmium erythraeum
           IMS101]
          Length = 527

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 21/83 (25%), Positives = 39/83 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R   I     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR      A+ 
Sbjct: 438 RITNIDGFPINVPPSPYMLLTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKIVRGDAVM 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIR 90
            L +D  +   +L ++     IR
Sbjct: 498 VLSVDDPLPEEILTEILKEPGIR 520


>gi|119491306|ref|ZP_01623360.1| D-3-phosphoglycerate dehydrogenase [Lyngbya sp. PCC 8106]
 gi|119453470|gb|EAW34632.1| D-3-phosphoglycerate dehydrogenase [Lyngbya sp. PCC 8106]
          Length = 527

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 33/59 (55%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKL 83
           M+  ++ D+ GI+  +G++LG + +NIA   +GR      A+  L ID  +   +L ++
Sbjct: 455 MLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKIVRGEAVMVLSIDDPLPEGLLSEI 513


>gi|256372302|ref|YP_003110126.1| D-3-phosphoglycerate dehydrogenase [Acidimicrobium ferrooxidans DSM
           10331]
 gi|256008886|gb|ACU54453.1| D-3-phosphoglycerate dehydrogenase [Acidimicrobium ferrooxidans DSM
           10331]
          Length = 527

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 42/88 (47%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +PR + +     +V   R M+ + N D  G+V  VG++LG+ G +I    +        A
Sbjct: 431 EPRVVLVDGHWVEVPPSRWMLVVRNVDRPGMVGVVGSLLGQAGRSIDAMAVSPRTDDGTA 490

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVK 93
           +  L +DG I + VL +L     I + +
Sbjct: 491 LMVLGVDGPIPDEVLTELDATDGIIYAR 518


>gi|52080188|ref|YP_078979.1| L-serine dehydratase subunit beta [Bacillus licheniformis ATCC
           14580]
 gi|52785565|ref|YP_091394.1| SdaAB [Bacillus licheniformis ATCC 14580]
 gi|319646033|ref|ZP_08000263.1| SdaAB protein [Bacillus sp. BT1B_CT2]
 gi|52003399|gb|AAU23341.1| L-serine dehydratase (beta chain) [Bacillus licheniformis ATCC
           14580]
 gi|52348067|gb|AAU40701.1| SdaAB [Bacillus licheniformis ATCC 14580]
 gi|317391783|gb|EFV72580.1| SdaAB protein [Bacillus sp. BT1B_CT2]
          Length = 220

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSV 85
           I +V+ D  G +  V N+L ++ INI H  + R    + A+  + +D +I  +V ++L  
Sbjct: 149 ILVVHNDRYGTIAGVANVLAKFAINIGHMEVARKDVGQEALMTIEVDQTIDPAVFDELRA 208

Query: 86  NVTIRFVKQ 94
              I  V Q
Sbjct: 209 LPNIIEVTQ 217


>gi|83588894|ref|YP_428903.1| D-3-phosphoglycerate dehydrogenase [Moorella thermoacetica ATCC
           39073]
 gi|83571808|gb|ABC18360.1| D-3-phosphoglycerate dehydrogenase [Moorella thermoacetica ATCC
           39073]
          Length = 525

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 39/79 (49%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+PR + +   + D      ++ I + D   I+  V   +G++G+NIA   +GR +    
Sbjct: 433 GEPRLVNLDGYSVDTIPAGHLLVIPHLDRPRIIGPVALAIGDHGVNIAAMQVGRRERGGQ 492

Query: 65  AISFLCIDGSILNSVLEKL 83
           A+  + +D  +  + L+ +
Sbjct: 493 AVMLISVDSEVPRAALDAI 511


>gi|56963608|ref|YP_175339.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
 gi|56909851|dbj|BAD64378.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
          Length = 533

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 40/77 (51%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR + I   + DV     ++ I + D  G++  +G +L ++ +NIA   +GR  +   AI
Sbjct: 443 PRIVSINGFSVDVVAEGHILYIQHFDRPGVIGKMGQLLAKHDVNIATMQVGRKSAGGEAI 502

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D  +  +V++ L
Sbjct: 503 MIVQVDKHVDQTVIDGL 519


>gi|15669207|ref|NP_248012.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus jannaschii
           DSM 2661]
 gi|3122874|sp|Q58424|SERA_METJA RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|1591676|gb|AAB99020.1| phosphoglycerate dehydrogenase (serA) [Methanocaldococcus
           jannaschii DSM 2661]
          Length = 524

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 4   DGKPRFIKIQ--EINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           + KP  +++   E++F +  G L I I + D  G +  V   LG+YGINIA   +GR + 
Sbjct: 431 NNKPVILEVDGYEVSF-IPEGVLAI-IKHIDRPGTIGRVCITLGDYGINIASMQVGRKEP 488

Query: 62  TEHAISFLCIDGSILNSVLEKL 83
              ++  L +D ++   V+EK+
Sbjct: 489 GGESVMLLNLDHTVPEEVIEKI 510


>gi|326490081|dbj|BAJ94114.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326504998|dbj|BAK02886.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 613

 Score = 35.8 bits (81), Expect = 1.9,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           DG P    +   + DV + G L++C    D  GI+  VG+ILG   +N+    +GR    
Sbjct: 520 DGTPHLTLVGPFSVDVSLEGNLILC-RQVDQPGIIGKVGSILGTMNLNVNFMSVGRIAPG 578

Query: 63  EHAISFLCID 72
           + AI  + ID
Sbjct: 579 KQAIMAIGID 588


>gi|291484136|dbj|BAI85211.1| L-serine dehydratase beta chain [Bacillus subtilis subsp. natto
           BEST195]
          Length = 220

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 3/78 (3%)

Query: 10  IKIQEIN-FDVDIG--RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N F++ +      I +V+ D  G +  V N+L ++ IN+ H  + R    + A+
Sbjct: 130 IEITELNGFELRLSGNHPAILVVHNDKFGTIAGVANVLAKFSINVGHMEVARKDIGQLAL 189

Query: 67  SFLCIDGSILNSVLEKLS 84
             + +D +I + +L++LS
Sbjct: 190 MTIEVDQNIDDHILDELS 207


>gi|16078648|ref|NP_389467.1| L-serine dehydratase beta chain [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221309460|ref|ZP_03591307.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313785|ref|ZP_03595590.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318709|ref|ZP_03600003.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322980|ref|ZP_03604274.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321315351|ref|YP_004207638.1| L-serine dehydratase subunit beta [Bacillus subtilis BSn5]
 gi|6094257|sp|O34635|SDHB_BACSU RecName: Full=Probable L-serine dehydratase, beta chain; Short=SDH;
           AltName: Full=L-serine deaminase; Short=L-SD
 gi|2337814|emb|CAA74258.1| putative YhaQ protein [Bacillus subtilis subsp. subtilis str. 168]
 gi|2633957|emb|CAB13458.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|320021625|gb|ADV96611.1| L-serine dehydratase (beta chain) [Bacillus subtilis BSn5]
          Length = 220

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 3/78 (3%)

Query: 10  IKIQEIN-FDVDIG--RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N F++ +      I +V+ D  G +  V N+L ++ IN+ H  + R    + A+
Sbjct: 130 IEITELNGFELRLSGNHPAILVVHNDKFGTIAGVANVLAKFSINVGHMEVARKDIGQLAL 189

Query: 67  SFLCIDGSILNSVLEKLS 84
             + +D +I + +L++LS
Sbjct: 190 MTIEVDQNIDDHILDELS 207


>gi|221633751|ref|YP_002522977.1| D-3-phosphoglycerate dehydrogenase [Thermomicrobium roseum DSM
           5159]
 gi|221157124|gb|ACM06251.1| phosphoglycerate dehydrogenase SerA [Thermomicrobium roseum DSM
           5159]
          Length = 745

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSI----LNSVL 80
           M+   + D  GI+  +G ILG Y +NIA   +GR      AI  L +D  I    LN +L
Sbjct: 649 MLITHHLDRPGIIGRIGTILGRYEVNIAGMQVGRRARGGEAIMVLNVDDPIPEAALNEIL 708

Query: 81  E 81
           +
Sbjct: 709 Q 709


>gi|222640652|gb|EEE68784.1| hypothetical protein OsJ_27507 [Oryza sativa Japonica Group]
          Length = 528

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G P    +     DV + G L++C    D  G++  VGNILG+  +NI+   +GR+   +
Sbjct: 436 GVPHLTVVGPYEVDVSLEGNLILC-RQIDQPGMIGKVGNILGQTNVNISFMSVGRTFRGK 494

Query: 64  HAISFLCIDGSILNSVLEKL 83
            AI  + +D       LE +
Sbjct: 495 QAIMAIGVDEEPDKETLEHI 514


>gi|125561721|gb|EAZ07169.1| hypothetical protein OsI_29415 [Oryza sativa Indica Group]
          Length = 621

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G P    +     DV + G L++C    D  G++  VGNILG+  +NI+   +GR+   +
Sbjct: 529 GVPHLTVVGPYEVDVSLEGNLILC-RQIDQPGMIGKVGNILGQTNVNISFMSVGRTFRGK 587

Query: 64  HAISFLCIDGSILNSVLEKL 83
            AI  + +D       LE +
Sbjct: 588 QAIMAIGVDEEPDKETLEHI 607


>gi|42408279|dbj|BAD09434.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica
           Group]
 gi|42409460|dbj|BAD09817.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica
           Group]
 gi|215769351|dbj|BAH01580.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 621

 Score = 35.8 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G P    +     DV + G L++C    D  G++  VGNILG+  +NI+   +GR+   +
Sbjct: 529 GVPHLTVVGPYEVDVSLEGNLILC-RQIDQPGMIGKVGNILGQTNVNISFMSVGRTFRGK 587

Query: 64  HAISFLCIDGSILNSVLEKL 83
            AI  + +D       LE +
Sbjct: 588 QAIMAIGVDEEPDKETLEHI 607


>gi|323342650|ref|ZP_08082882.1| L-serine ammonia-lyase beta subunit [Erysipelothrix rhusiopathiae
           ATCC 19414]
 gi|322463762|gb|EFY08956.1| L-serine ammonia-lyase beta subunit [Erysipelothrix rhusiopathiae
           ATCC 19414]
          Length = 223

 Score = 35.8 bits (81), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           +KI EIN    ++D G   I I + D  G++  V  IL E  INI    + R +  + A 
Sbjct: 133 VKITEINGTKVEIDGGVATILIFHEDCPGMIAKVATILSEMHINIGSMKVDREEKGKKAY 192

Query: 67  SFLCIDGSILNSVLEKL 83
             + +D   L + L++L
Sbjct: 193 MVIELDQDDLETSLDRL 209


>gi|253580324|ref|ZP_04857590.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848417|gb|EES76381.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Ruminococcus sp. 5_1_39BFAA]
          Length = 222

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 40/88 (45%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK R +KI  +  D       + +++ D  G+V ++   L +  INIA   L R    + 
Sbjct: 130 GKVRIVKINHVQVDFTGEYSAVIVIHQDTPGVVAYITKCLSDRNINIAFMRLFREGKGDI 189

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFV 92
           A + +  DG +  +++  +  N  I  V
Sbjct: 190 AYTIVESDGKLPENIVPAIRENPNIHEV 217


>gi|311068106|ref|YP_003973029.1| L-serine dehydratase subunit beta [Bacillus atrophaeus 1942]
 gi|310868623|gb|ADP32098.1| L-serine dehydratase subunit beta [Bacillus atrophaeus 1942]
          Length = 220

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 33/59 (55%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           I +V+ D  G +  V N+L ++ IN+ H  + R    + A+  + +D +I + VL++L 
Sbjct: 149 ILVVHNDKFGTIAGVANVLAKFSINVGHMEVARKDIGQLALMTIEVDQNIDDDVLDELK 207


>gi|224105607|ref|XP_002313870.1| predicted protein [Populus trichocarpa]
 gi|222850278|gb|EEE87825.1| predicted protein [Populus trichocarpa]
          Length = 543

 Score = 35.4 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 3/94 (3%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   ++     DV +   +I     D  G++  VG++LG   +N++   +GR    +
Sbjct: 450 DGIPHLTRVGSFEVDVSLEGSIILCRQVDQPGMIGKVGSVLGGQNVNVSFMSVGRIAPRK 509

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  + +D       L+K+     I  V++F F
Sbjct: 510 QAVMAIGVDEQPSKETLKKIG---DIPAVEEFVF 540


>gi|169830231|ref|YP_001716213.1| D-3-phosphoglycerate dehydrogenase [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637075|gb|ACA58581.1| D-3-phosphoglycerate dehydrogenase [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 526

 Score = 35.4 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 37/83 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR + I     D      M+ I + D   I+  VG ++G++ +NIA   +GR  
Sbjct: 430 LFRGNDPRVVFIDGYRVDAVTEGHMLIIPHIDRPRIIGAVGTLIGQHDVNIAAMQVGRKV 489

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
               A+  L ID  +    LE +
Sbjct: 490 IGGRAVMVLMIDSPVPPETLEAI 512


>gi|257869767|ref|ZP_05649420.1| L-serine dehydratase [Enterococcus gallinarum EG2]
 gi|257803931|gb|EEV32753.1| L-serine dehydratase [Enterococcus gallinarum EG2]
          Length = 221

 Score = 35.4 bits (80), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N     + +G     IV+ D+ G+V  V N+L E  INI    + R    E AI
Sbjct: 133 IQISELNGFKISLTLGTPTYVIVHQDVPGMVARVTNLLSEAQINIGTMTVTRESKGEKAI 192

Query: 67  SFLCID 72
             + +D
Sbjct: 193 MIIEVD 198


>gi|126649438|ref|ZP_01721679.1| phosphoglycerate dehydrogenase [Bacillus sp. B14905]
 gi|126593763|gb|EAZ87686.1| phosphoglycerate dehydrogenase [Bacillus sp. B14905]
          Length = 535

 Score = 35.4 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 10/93 (10%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +K+++   DV     ++ I N D  G +  V   L E  INIA   +GR+Q    A+ 
Sbjct: 446 RIVKVEDYVVDVIPQGHLLYIKNTDKPGAIGRVATKLAEKEINIATMQVGRAQVGGTAVM 505

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            L ID  + +  L          FV Q E N+D
Sbjct: 506 MLTIDNVVTDEDLA---------FVAQLE-NID 528


>gi|158522862|ref|YP_001530732.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
 gi|158511688|gb|ABW68655.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
          Length = 527

 Score = 35.0 bits (79), Expect = 3.1,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 30/57 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLG 57
           +F    PR ++I +   DV     M+ I++ +  G++  +G   GE G+NI  F +G
Sbjct: 430 LFGKIYPRIVEINDFRVDVSPEGHMLIILSENKPGVIGRIGTTFGEGGVNIVRFMVG 486


>gi|322383141|ref|ZP_08056963.1| L-serine dehydratase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321152684|gb|EFX45315.1| L-serine dehydratase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 263

 Score = 35.0 bits (79), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 36/59 (61%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           I +V+ D  G +  V N+L ++ INI H  + R +  ++A+  + +D ++ + ++E++S
Sbjct: 192 ILVVHNDRYGAIASVTNVLTKHYINIGHMEVSRKEKGKNALMIIEMDQNLDDYIIEEIS 250


>gi|189201403|ref|XP_001937038.1| D-3-phosphoglycerate dehydrogenase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187984137|gb|EDU49625.1| D-3-phosphoglycerate dehydrogenase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 573

 Score = 35.0 bits (79), Expect = 3.2,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 18/79 (22%)

Query: 22  GRLMICIVNADILGIVVFVGNILGEYGINIAHFHL---------------GRS--QSTEH 64
           G L+IC  N D +G + +VGN+LG+ G+NI   ++               G++  Q  + 
Sbjct: 482 GTLLIC-RNFDSVGKIGYVGNVLGKAGVNIKFMNVAPLDEEVEERQNEQNGKNGGQGHKE 540

Query: 65  AISFLCIDGSILNSVLEKL 83
           A+  L +DG +   VL++L
Sbjct: 541 ALMILGVDGRVGEDVLKRL 559


>gi|295110453|emb|CBL24406.1| L-serine ammonia-lyase [Ruminococcus obeum A2-162]
          Length = 222

 Score = 35.0 bits (79), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 39/88 (44%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK R +KI  +  D       + + + D  G+V ++   L +  +NIA   L R    E 
Sbjct: 130 GKVRIVKINSVQVDFTGEYSAVIVTHQDKPGVVAYITKCLSDRNVNIAFMRLFRESKGEI 189

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFV 92
           A + +  DG +   + + + +N  I  V
Sbjct: 190 AYTIVESDGHLPEDIDDTIRLNQNIHEV 217


>gi|56964072|ref|YP_175803.1| L-serine dehydratase beta subunit [Bacillus clausii KSM-K16]
 gi|56910315|dbj|BAD64842.1| L-serine dehydratase beta subunit [Bacillus clausii KSM-K16]
          Length = 220

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 43/78 (55%), Gaps = 3/78 (3%)

Query: 10  IKIQEIN-FDVDIG--RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N FD+ +      I + + D  G++  V N+L ++ +NI H  + R +  E A+
Sbjct: 130 IEIVELNGFDLRLSGNHPAILVAHLDRYGVIAAVSNLLAKHQLNIGHMEVSRKEKGETAL 189

Query: 67  SFLCIDGSILNSVLEKLS 84
             + +D ++  ++L +L 
Sbjct: 190 MVIEVDQNVDKALLLELE 207


>gi|326790990|ref|YP_004308811.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium lentocellum DSM 5427]
 gi|326541754|gb|ADZ83613.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium lentocellum DSM 5427]
          Length = 222

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query: 14  EINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDG 73
           E+ FD +   L I   + D  G+V  +   L E+ INIA+    R    E A + +  D 
Sbjct: 141 EVFFDGEYETLFIN--HEDRTGVVAHITQCLSEWQINIAYMRSYRQAKGEVASTIIETDQ 198

Query: 74  SILNSVLEKLSVNVTIRFVKQ 94
            I + VL  +  N ++++ K+
Sbjct: 199 PICDEVLAAIMENSSVQYAKK 219


>gi|325662533|ref|ZP_08151136.1| L-serine dehydratase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471229|gb|EGC74454.1| L-serine dehydratase [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 222

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 40/82 (48%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK + ++I +I+ +       + +   D  G+V  +   L E  +NIA   L R     +
Sbjct: 130 GKMKIVRINQIDVEFTGEYSTLIVSQTDKPGVVAHITQCLSEENVNIAFMRLFREDKGAN 189

Query: 65  AISFLCIDGSILNSVLEKLSVN 86
           A + +  D +I +SVL+K+  +
Sbjct: 190 AFTVVESDETIPSSVLDKIKTH 211


>gi|313902560|ref|ZP_07835960.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter subterraneus
           DSM 13965]
 gi|313467126|gb|EFR62640.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter subterraneus
           DSM 13965]
          Length = 579

 Score = 35.0 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 39/80 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR + +  +  D+     ++   + D  G++  VG +LG   INIA   + R Q   
Sbjct: 437 EGLPRLVHLDGLPLDMVPAPRLLLTRHHDRPGMIGKVGGLLGMGEINIAAMQVARRQVRG 496

Query: 64  HAISFLCIDGSILNSVLEKL 83
            AI  L +D  +  S+L ++
Sbjct: 497 EAIMVLALDDPLPPSLLAEI 516


>gi|325107117|ref|YP_004268185.1| D-3-phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
 gi|324967385|gb|ADY58163.1| D-3-phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
          Length = 546

 Score = 34.7 bits (78), Expect = 3.9,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 2/78 (2%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR--SQSTEHA 65
           R + + +   D  +   M+   + D+ G++  VG  LG++ INI H  LGR   Q    +
Sbjct: 443 RLVLLDDYQLDGYLDGTMMVYRHKDVPGLIGAVGTTLGKHKINIGHMALGRETEQPGGDS 502

Query: 66  ISFLCIDGSILNSVLEKL 83
           I+   +D    + ++E++
Sbjct: 503 IAVFNLDTRPSDEIIEEI 520


>gi|291301774|ref|YP_003513052.1| D-3-phosphoglycerate dehydrogenase [Stackebrandtia nassauensis DSM
           44728]
 gi|290570994|gb|ADD43959.1| D-3-phosphoglycerate dehydrogenase [Stackebrandtia nassauensis DSM
           44728]
          Length = 533

 Score = 34.7 bits (78), Expect = 4.0,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 6/86 (6%)

Query: 7   PRFI-KIQEIN-FDVDI---GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           PR + K+ EI+ +DV+I   G L+I +   D  GIV  +G  LG+  INI    + R ++
Sbjct: 437 PREVRKLTEIDGYDVEIDAEGPLLI-MRYTDRPGIVGLIGGSLGDESINIGAMQVSRREA 495

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNV 87
              A+  +  D  +   +L KL+  V
Sbjct: 496 GGEALMIVATDAEVPADLLTKLAGTV 521


>gi|152976546|ref|YP_001376063.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus subsp. cytotoxis NVH 391-98]
 gi|152025298|gb|ABS23068.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cytotoxicus NVH 391-98]
          Length = 220

 Score = 34.7 bits (78), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN-FDVDIG--RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N FD+ +      + IVN D  G +  V +IL ++ INI+   + R +    A+
Sbjct: 131 IEVVELNGFDLQLSGTSPALLIVNNDRFGAIASVASILAKHEINISTMSVSRKEKGRKAL 190

Query: 67  SFLCIDGSILNSVLEKL 83
             +  D ++ N V+E++
Sbjct: 191 MVIETDEALENEVIEEI 207


>gi|301103195|ref|XP_002900684.1| D-3-phosphoglycerate dehydrogenase, putative [Phytophthora
           infestans T30-4]
 gi|262101947|gb|EEY59999.1| D-3-phosphoglycerate dehydrogenase, putative [Phytophthora
           infestans T30-4]
          Length = 603

 Score = 34.7 bits (78), Expect = 4.1,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 32/64 (50%)

Query: 30  NADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTI 89
           N D+ G +  + + L +  INIA+F L R  + EH +  L +D    +  L  L    ++
Sbjct: 536 NEDVPGAIAGILSELSDAKINIANFGLARQNNVEHPLGILALDSVPSDETLNALKDLPSV 595

Query: 90  RFVK 93
           R V+
Sbjct: 596 RSVR 599


>gi|167462040|ref|ZP_02327129.1| L-serine dehydratase beta subunit [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 220

 Score = 34.7 bits (78), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 36/59 (61%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           I +V+ D  G +  V N+L ++ INI H  + R +  ++A+  + +D ++ + ++E++S
Sbjct: 149 ILVVHNDRYGAIASVTNVLTKHYINIGHMEVSRKEKGKNALMIIEMDQNLDDYIIEEIS 207


>gi|226324270|ref|ZP_03799788.1| hypothetical protein COPCOM_02049 [Coprococcus comes ATCC 27758]
 gi|225206718|gb|EEG89072.1| hypothetical protein COPCOM_02049 [Coprococcus comes ATCC 27758]
          Length = 222

 Score = 34.7 bits (78), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 34/82 (41%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK R  +I  +  D       I +V  D  G+V ++   L E GINIA   L R      
Sbjct: 130 GKARLCRINGVEVDFTGEYSSIVVVQKDAPGVVAYITKCLSELGINIAFMRLFRESKGNT 189

Query: 65  AISFLCIDGSILNSVLEKLSVN 86
           A + +  D  +   + + +  N
Sbjct: 190 AYTIVESDDLVPEDIADTIRRN 211


>gi|167044704|gb|ABZ09375.1| putative D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
           domain protein [uncultured marine microorganism
           HF4000_APKG7H23]
          Length = 491

 Score = 34.7 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 19/76 (25%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 9   FIKIQEINFDVD-IGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
            +++ + + D+   GR M+   + D  G++  +G I GE+ INI+   +GR      A  
Sbjct: 402 LVRVNDFSLDLQPTGRFMMFTEHTDRPGMIGRMGTIAGEHDINISFMEVGRRAPRGEATM 461

Query: 68  FLCIDGSILNSVLEKL 83
            + +D  I +  L + 
Sbjct: 462 IVGLDDPISDEALAEF 477


>gi|299537582|ref|ZP_07050875.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus fusiformis ZC1]
 gi|298726951|gb|EFI67533.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus fusiformis ZC1]
          Length = 537

 Score = 34.7 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 10/93 (10%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +K+++   DV     ++ I N D  G +  V   L E  INIA   +GR+Q    A+ 
Sbjct: 448 RIVKVEDYVVDVIPQGHLLYIKNTDKPGAIGRVATKLAEKEINIATMQVGRAQVGGTAVM 507

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            L +D    N V E+      + FV Q E N+D
Sbjct: 508 MLTVD----NVVTEE-----DLVFVAQLE-NID 530


>gi|72161018|ref|YP_288675.1| D-3-phosphoglycerate dehydrogenase [Thermobifida fusca YX]
 gi|71914750|gb|AAZ54652.1| D-3-phosphoglycerate dehydrogenase [Thermobifida fusca YX]
          Length = 528

 Score = 34.7 bits (78), Expect = 4.7,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 29/53 (54%)

Query: 35  GIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNV 87
           G+V  VG +LG+  +NIA   + R +    A+  L +D +I +  LE +S  +
Sbjct: 465 GVVGVVGQLLGQAQVNIAGMQVSRDKEGGAALIALTVDSAIPDETLETISKEI 517


>gi|218781218|ref|YP_002432536.1| D-3-phosphoglycerate dehydrogenase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762602|gb|ACL05068.1| D-3-phosphoglycerate dehydrogenase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 526

 Score = 34.7 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 39/83 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           ++   +P+ ++I     ++     ++ I N D  G +  VG++LGE  +NIA   +G+ +
Sbjct: 430 IYGKAEPKIVRIDSFRVEMVPEGHVLLIHNVDKPGAIGSVGSMLGEASVNIARMQVGQEE 489

Query: 61  STEHAISFLCIDGSILNSVLEKL 83
                   +  D    + V+ KL
Sbjct: 490 DGNRNFIVMETDTETPDDVVAKL 512


>gi|227504457|ref|ZP_03934506.1| phosphoglycerate dehydrogenase [Corynebacterium striatum ATCC 6940]
 gi|227199105|gb|EEI79153.1| phosphoglycerate dehydrogenase [Corynebacterium striatum ATCC 6940]
          Length = 528

 Score = 34.7 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 38/82 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG  +FI+I E  FD+      +     D  G +  VG  LG  GINI    L + ++  
Sbjct: 434 DGVEKFIRINERGFDMRATGRNLFFSYDDAPGALGTVGTKLGAAGINIVAAALTQGKTPA 493

Query: 64  HAISFLCIDGSILNSVLEKLSV 85
            A+  L ++  +   ++E + V
Sbjct: 494 DAVLILRVEREVAEELVEDIKV 515


>gi|257791620|ref|YP_003182226.1| D-3-phosphoglycerate dehydrogenase [Eggerthella lenta DSM 2243]
 gi|317487964|ref|ZP_07946548.1| phosphoglycerate dehydrogenase [Eggerthella sp. 1_3_56FAA]
 gi|257475517|gb|ACV55837.1| D-3-phosphoglycerate dehydrogenase [Eggerthella lenta DSM 2243]
 gi|316912946|gb|EFV34471.1| phosphoglycerate dehydrogenase [Eggerthella sp. 1_3_56FAA]
          Length = 526

 Score = 34.3 bits (77), Expect = 5.1,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 32  DILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKL 83
           D  G V  +G ILGE GINI    +      + A+ ++ ++G + + VL KL
Sbjct: 460 DAPGRVGTIGTILGEAGINITTMQIATLPGEQCALVYMNVEGDVDDDVLSKL 511


>gi|210615487|ref|ZP_03290614.1| hypothetical protein CLONEX_02830 [Clostridium nexile DSM 1787]
 gi|210150336|gb|EEA81345.1| hypothetical protein CLONEX_02830 [Clostridium nexile DSM 1787]
          Length = 222

 Score = 34.3 bits (77), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 37/82 (45%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK + ++I  I+ +       + +   D  G+V  +   L E  +NIA   L R     +
Sbjct: 130 GKMKIVRINNIDVEFTGEYSTLIVQQKDTPGVVAHITQALSEQEVNIAFMRLFREDKGAN 189

Query: 65  AISFLCIDGSILNSVLEKLSVN 86
           A + +  D  I  +VL+K+  N
Sbjct: 190 AYTVVESDEPIPEAVLDKIKTN 211


>gi|323489546|ref|ZP_08094773.1| L-serine dehydratase subunit beta [Planococcus donghaensis MPA1U2]
 gi|323396677|gb|EGA89496.1| L-serine dehydratase subunit beta [Planococcus donghaensis MPA1U2]
          Length = 220

 Score = 34.3 bits (77), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKL 83
           I +V+ D  G +  V N L +Y INI H  + R +    A+  + +D ++   V+E L
Sbjct: 149 ILVVHEDRSGCIANVANCLYKYNINIGHMEVSRKERGHMALMVIEVDQNVDKEVMEDL 206


>gi|260891940|ref|YP_003238037.1| D-3-phosphoglycerate dehydrogenase [Ammonifex degensii KC4]
 gi|260864081|gb|ACX51187.1| D-3-phosphoglycerate dehydrogenase [Ammonifex degensii KC4]
          Length = 527

 Score = 34.3 bits (77), Expect = 5.3,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 38/79 (48%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +PR ++I     D      ++ I + D   I+  +G ++G + INIA   +GR +    A
Sbjct: 436 EPRVVEIDGYRVDAVPEGYVLFIPHLDRPRIIGRIGTLIGAHDINIAAMQVGRKEIGGKA 495

Query: 66  ISFLCIDGSILNSVLEKLS 84
           I  L +D  +    L +++
Sbjct: 496 IMLLSVDSPVPEETLREIA 514


>gi|300087849|ref|YP_003758371.1| D-3-phosphoglycerate dehydrogenase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527582|gb|ADJ26050.1| D-3-phosphoglycerate dehydrogenase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 526

 Score = 34.3 bits (77), Expect = 5.5,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 39/74 (52%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           ++I +   D+  G   +   + D  G++  VG I G+  +N+++ HL R +    A+  L
Sbjct: 439 VRINDYWIDITPGGFFLFADHRDRPGLIGAVGGITGKADVNVSYMHLSRLKPRGQALMVL 498

Query: 70  CIDGSILNSVLEKL 83
            +D S+ ++ L ++
Sbjct: 499 ALDESLSDADLAEI 512


>gi|296123070|ref|YP_003630848.1| D-3-phosphoglycerate dehydrogenase [Planctomyces limnophilus DSM
           3776]
 gi|296015410|gb|ADG68649.1| D-3-phosphoglycerate dehydrogenase [Planctomyces limnophilus DSM
           3776]
          Length = 546

 Score = 34.3 bits (77), Expect = 5.6,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 42/88 (47%), Gaps = 2/88 (2%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE--HA 65
           R +++ + + D  +   ++   + D  G++  +G   G++ +NIAH  +GR ++     A
Sbjct: 440 RLVRVNQFHLDAYLDGTLLLYRHIDRPGVIGTIGTACGQHNVNIAHMAVGRERNEPGGEA 499

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVK 93
           ++ L +D       L  +  N  +  V+
Sbjct: 500 LAILNLDNEPSAEALAAVQANPAVTSVQ 527


>gi|219850460|ref|YP_002464893.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aggregans DSM
           9485]
 gi|219544719|gb|ACL26457.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aggregans DSM
           9485]
          Length = 525

 Score = 34.3 bits (77), Expect = 5.6,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 5   GKPRFIKIQEINFD-VDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G+P  +++     D V  G L+I   + D  G++  VG +LG   +NI+  ++GR    E
Sbjct: 433 GEPHIVQMDGYFVDFVPQGSLLI-TYHHDQPGMIGKVGQLLGAADVNISGMYVGRRAPRE 491

Query: 64  HAISFLCIDGSILNSVLEKLS 84
            A+  L +D      V+E+++
Sbjct: 492 QAVMVLTLDEPAPPQVMEQVA 512


>gi|163845877|ref|YP_001633921.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222523594|ref|YP_002568064.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus sp. Y-400-fl]
 gi|163667166|gb|ABY33532.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222447473|gb|ACM51739.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus sp. Y-400-fl]
          Length = 525

 Score = 34.3 bits (77), Expect = 5.6,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 42/81 (51%), Gaps = 2/81 (2%)

Query: 5   GKPRFIKIQEINFD-VDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G+P  +++     D V  G L+I   + D  G++  VG +LG   +NI+  ++GR    E
Sbjct: 433 GEPHIVQMDGYFVDFVPQGSLLI-TYHHDQPGMIGKVGQLLGAADVNISGMYVGRRAPRE 491

Query: 64  HAISFLCIDGSILNSVLEKLS 84
            A+  L +D      V+E+++
Sbjct: 492 RAVMVLTLDEPAPPQVMEQIA 512


>gi|317125479|ref|YP_004099591.1| D-3-phosphoglycerate dehydrogenase [Intrasporangium calvum DSM
           43043]
 gi|315589567|gb|ADU48864.1| D-3-phosphoglycerate dehydrogenase [Intrasporangium calvum DSM
           43043]
          Length = 527

 Score = 34.3 bits (77), Expect = 5.8,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I   + +V +   M+    +D  GI+  VG ILG+ G+NI    + R  + + AI 
Sbjct: 438 KLVGINGYDLEVPLSDHMLIFEYSDRPGIIGAVGRILGDSGVNIGGMQVSR--AADQAIG 495

Query: 68  FLCIDGSI 75
            L +D ++
Sbjct: 496 VLNVDSAV 503


>gi|315162115|gb|EFU06132.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0645]
          Length = 233

 Score = 34.3 bits (77), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N     + +G     +V+ D+ G++  V NIL    INI+   + R    E AI
Sbjct: 144 IQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKGEKAI 203

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             + +D + +  ++ +L+  + I  V  F+
Sbjct: 204 MIIEVDQAEVGDIVMQLAEILHIYSVNYFD 233


>gi|167765968|ref|ZP_02438021.1| hypothetical protein CLOSS21_00459 [Clostridium sp. SS2/1]
 gi|167712325|gb|EDS22904.1| hypothetical protein CLOSS21_00459 [Clostridium sp. SS2/1]
 gi|291558762|emb|CBL37562.1| L-serine ammonia-lyase [butyrate-producing bacterium SSC/2]
          Length = 222

 Score = 34.3 bits (77), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK R  +I ++  D       + ++  D  G+V ++   L +  +NIA   L R      
Sbjct: 130 GKARICRINDVEVDFTGEYSTLIVIQKDKPGVVTYITKCLSDQDVNIAFMRLFRESKGNT 189

Query: 65  AISFLCIDGSILNSVLEKL--SVNVT 88
           A S +  DG +  ++ E++  S NV+
Sbjct: 190 AYSIVESDGLLPENIAEEIRKSPNVS 215


>gi|317497232|ref|ZP_07955556.1| L-serine dehydratase [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316895477|gb|EFV17635.1| L-serine dehydratase [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 222

 Score = 33.9 bits (76), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK R  +I ++  D       + ++  D  G+V ++   L +  +NIA   L R      
Sbjct: 130 GKARICRINDVEVDFTGEYSTLIVIQKDKPGVVTYITKCLSDQDVNIAFMRLFRESKGNT 189

Query: 65  AISFLCIDGSILNSVLEKL--SVNVT 88
           A S +  DG +  ++ E++  S NV+
Sbjct: 190 AYSIVESDGLLPENIAEEIRKSPNVS 215


>gi|29377199|ref|NP_816353.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis V583]
 gi|29344665|gb|AAO82423.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis V583]
          Length = 222

 Score = 33.9 bits (76), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N     + +G     +V+ D+ G++  V NIL    INI+   + R    E AI
Sbjct: 133 IQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKGEKAI 192

Query: 67  SFLCIDGSILNSVLEKLS 84
             + +D + +  ++ +L+
Sbjct: 193 MIIEVDQAEVGDIVMQLA 210


>gi|315174944|gb|EFU18961.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1346]
          Length = 233

 Score = 33.9 bits (76), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N     + +G     +V+ D+ G++  V NIL    INI+   + R    E AI
Sbjct: 144 IQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKGEKAI 203

Query: 67  SFLCIDGSILNSVLEKLS 84
             + +D + +  ++ +L+
Sbjct: 204 MIIEVDQAEVGDIVMQLA 221


>gi|295113664|emb|CBL32301.1| L-serine ammonia-lyase [Enterococcus sp. 7L76]
 gi|323481644|gb|ADX81083.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis 62]
          Length = 222

 Score = 33.9 bits (76), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N     + +G     +V+ D+ G++  V NIL    INI+   + R    E AI
Sbjct: 133 IQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKGEKAI 192

Query: 67  SFLCIDGSILNSVLEKLS 84
             + +D + +  ++ +L+
Sbjct: 193 MIIEVDQAEVGDIVMQLA 210


>gi|315151757|gb|EFT95773.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0012]
          Length = 233

 Score = 33.9 bits (76), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N     + +G     +V+ D+ G++  V NIL    INI+   + R    E AI
Sbjct: 144 IQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKGEKAI 203

Query: 67  SFLCIDGSILNSVLEKLS 84
             + +D + +  ++ +L+
Sbjct: 204 MIIEVDQAEVGDIVMQLA 221


>gi|227519493|ref|ZP_03949542.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0104]
 gi|229544896|ref|ZP_04433621.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1322]
 gi|229549163|ref|ZP_04437888.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis ATCC 29200]
 gi|255971880|ref|ZP_05422466.1| L-serine deaminase [Enterococcus faecalis T1]
 gi|256616778|ref|ZP_05473624.1| L-serine deaminase [Enterococcus faecalis ATCC 4200]
 gi|256763346|ref|ZP_05503926.1| L-serine deaminase [Enterococcus faecalis T3]
 gi|256854020|ref|ZP_05559385.1| L-serine dehydratase [Enterococcus faecalis T8]
 gi|256957948|ref|ZP_05562119.1| L-serine deaminase [Enterococcus faecalis DS5]
 gi|256961032|ref|ZP_05565203.1| L-serine deaminase [Enterococcus faecalis Merz96]
 gi|256963826|ref|ZP_05567997.1| L-serine deaminase [Enterococcus faecalis HIP11704]
 gi|257079886|ref|ZP_05574247.1| L-serine deaminase [Enterococcus faecalis JH1]
 gi|257081715|ref|ZP_05576076.1| L-serine deaminase [Enterococcus faecalis E1Sol]
 gi|257084312|ref|ZP_05578673.1| L-serine deaminase [Enterococcus faecalis Fly1]
 gi|257087689|ref|ZP_05582050.1| L-serine deaminase [Enterococcus faecalis D6]
 gi|257090907|ref|ZP_05585268.1| L-serine deaminase [Enterococcus faecalis CH188]
 gi|257416891|ref|ZP_05593885.1| L-serine deaminase [Enterococcus faecalis AR01/DG]
 gi|257420113|ref|ZP_05597107.1| L-serine deaminase [Enterococcus faecalis T11]
 gi|257421666|ref|ZP_05598656.1| L-serine dehydratase [Enterococcus faecalis X98]
 gi|293384578|ref|ZP_06630444.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis R712]
 gi|293386807|ref|ZP_06631378.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis S613]
 gi|300860470|ref|ZP_07106557.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TUSoD Ef11]
 gi|307269249|ref|ZP_07550603.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX4248]
 gi|307271773|ref|ZP_07553044.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0855]
 gi|307276958|ref|ZP_07558068.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX2134]
 gi|307288659|ref|ZP_07568640.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0109]
 gi|307290274|ref|ZP_07570190.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0411]
 gi|312900082|ref|ZP_07759399.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0470]
 gi|312902546|ref|ZP_07761752.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0635]
 gi|312906404|ref|ZP_07765412.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis DAPTO 512]
 gi|312951895|ref|ZP_07770783.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0102]
 gi|312979437|ref|ZP_07791125.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis DAPTO 516]
 gi|227073105|gb|EEI11068.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0104]
 gi|229305717|gb|EEN71713.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis ATCC 29200]
 gi|229309997|gb|EEN75984.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1322]
 gi|255962898|gb|EET95374.1| L-serine deaminase [Enterococcus faecalis T1]
 gi|256596305|gb|EEU15481.1| L-serine deaminase [Enterococcus faecalis ATCC 4200]
 gi|256684597|gb|EEU24292.1| L-serine deaminase [Enterococcus faecalis T3]
 gi|256710963|gb|EEU26006.1| L-serine dehydratase [Enterococcus faecalis T8]
 gi|256948444|gb|EEU65076.1| L-serine deaminase [Enterococcus faecalis DS5]
 gi|256951528|gb|EEU68160.1| L-serine deaminase [Enterococcus faecalis Merz96]
 gi|256954322|gb|EEU70954.1| L-serine deaminase [Enterococcus faecalis HIP11704]
 gi|256987916|gb|EEU75218.1| L-serine deaminase [Enterococcus faecalis JH1]
 gi|256989745|gb|EEU77047.1| L-serine deaminase [Enterococcus faecalis E1Sol]
 gi|256992342|gb|EEU79644.1| L-serine deaminase [Enterococcus faecalis Fly1]
 gi|256995719|gb|EEU83021.1| L-serine deaminase [Enterococcus faecalis D6]
 gi|256999719|gb|EEU86239.1| L-serine deaminase [Enterococcus faecalis CH188]
 gi|257158719|gb|EEU88679.1| L-serine deaminase [Enterococcus faecalis ARO1/DG]
 gi|257161941|gb|EEU91901.1| L-serine deaminase [Enterococcus faecalis T11]
 gi|257163490|gb|EEU93450.1| L-serine dehydratase [Enterococcus faecalis X98]
 gi|291078124|gb|EFE15488.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis R712]
 gi|291083810|gb|EFE20773.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis S613]
 gi|300849509|gb|EFK77259.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TUSoD Ef11]
 gi|306498695|gb|EFM68196.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0411]
 gi|306500413|gb|EFM69749.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0109]
 gi|306506381|gb|EFM75541.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX2134]
 gi|306511651|gb|EFM80650.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0855]
 gi|306514468|gb|EFM83029.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX4248]
 gi|310627558|gb|EFQ10841.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis DAPTO 512]
 gi|310630084|gb|EFQ13367.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0102]
 gi|310634216|gb|EFQ17499.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0635]
 gi|311287808|gb|EFQ66364.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis DAPTO 516]
 gi|311292839|gb|EFQ71395.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0470]
 gi|315025512|gb|EFT37444.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX2137]
 gi|315030458|gb|EFT42390.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX4000]
 gi|315032570|gb|EFT44502.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0017]
 gi|315035093|gb|EFT47025.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0027]
 gi|315143888|gb|EFT87904.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX2141]
 gi|315148683|gb|EFT92699.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX4244]
 gi|315154315|gb|EFT98331.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0031]
 gi|315155584|gb|EFT99600.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0043]
 gi|315159592|gb|EFU03609.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0312]
 gi|315165290|gb|EFU09307.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1302]
 gi|315168703|gb|EFU12720.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1341]
 gi|315579645|gb|EFU91836.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0630]
 gi|327535938|gb|AEA94772.1| L-serine dehydratase [Enterococcus faecalis OG1RF]
 gi|329578038|gb|EGG59452.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1467]
          Length = 233

 Score = 33.9 bits (76), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N     + +G     +V+ D+ G++  V NIL    INI+   + R    E AI
Sbjct: 144 IQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKGEKAI 203

Query: 67  SFLCIDGSILNSVLEKLS 84
             + +D + +  ++ +L+
Sbjct: 204 MIIEVDQAEVGDIVMQLA 221


>gi|227554207|ref|ZP_03984254.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis HH22]
 gi|227176654|gb|EEI57626.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis HH22]
 gi|315170480|gb|EFU14497.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1342]
 gi|315573760|gb|EFU85951.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0309B]
 gi|315580274|gb|EFU92465.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0309A]
          Length = 233

 Score = 33.9 bits (76), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N     + +G     +V+ D+ G++  V NIL    INI+   + R    E AI
Sbjct: 144 IQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKGEKAI 203

Query: 67  SFLCIDGSILNSVLEKLS 84
             + +D + +  ++ +L+
Sbjct: 204 MIIEVDQAEVGDIVMQLA 221


>gi|255974875|ref|ZP_05425461.1| L-serine deaminase [Enterococcus faecalis T2]
 gi|307278731|ref|ZP_07559798.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0860]
 gi|255967747|gb|EET98369.1| L-serine deaminase [Enterococcus faecalis T2]
 gi|306504592|gb|EFM73795.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0860]
          Length = 233

 Score = 33.9 bits (76), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 10  IKIQEIN---FDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I+I E+N     + +G     +V+ D+ G++  V NIL    INI+   + R    E AI
Sbjct: 144 IQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKGEKAI 203

Query: 67  SFLCIDGSILNSVLEKLS 84
             + +D + +  ++ +L+
Sbjct: 204 MIIEVDQAEVGDIVMQLA 221


>gi|73662854|ref|YP_301635.1| putative L-serine dehydratase beta subunit [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
 gi|72495369|dbj|BAE18690.1| putative L-serine dehydratase beta subunit [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 221

 Score = 33.9 bits (76), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 36/79 (45%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GK   + I   N  +      + + + D  G +  V NILG+  IN+    + R +  + 
Sbjct: 128 GKIEVVAINGFNIAISGNYPALLVFHKDTFGTIGRVANILGDSSINVGSMQVSRKEKGDQ 187

Query: 65  AISFLCIDGSILNSVLEKL 83
           A+    +D ++ +  +EK+
Sbjct: 188 ALMTCELDDAVNDETIEKI 206


>gi|239624630|ref|ZP_04667661.1| L-serine dehydratase [Clostridiales bacterium 1_7_47_FAA]
 gi|239521016|gb|EEQ60882.1| L-serine dehydratase [Clostridiales bacterium 1_7_47FAA]
          Length = 219

 Score = 33.9 bits (76), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSV 85
           + +++ D  G +  V  ++ + G+NI +F L R Q    A+  + IDGS    + +K+ V
Sbjct: 147 LIVLHRDAPGTIAAVTEVMADAGVNICNFRLSRQQKGGDAVMTIEIDGSFGPELNQKIKV 206


>gi|291532213|emb|CBL05326.1| L-serine ammonia-lyase [Megamonas hypermegale ART12/1]
          Length = 220

 Score = 33.9 bits (76), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%)

Query: 26  ICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSV 85
           I IV+ D+ G+V  V   L  Y INIA+  + RS+    A+  + +D +I +  ++  S 
Sbjct: 148 IIIVHQDMPGVVNGVTAALARYNINIAYMKVSRSERGAEALMNIEVDDTISDEAVKACSR 207

Query: 86  NVTIRFV 92
            + ++ V
Sbjct: 208 VIGVKKV 214


>gi|284045014|ref|YP_003395354.1| D-3-phosphoglycerate dehydrogenase [Conexibacter woesei DSM 14684]
 gi|283949235|gb|ADB51979.1| D-3-phosphoglycerate dehydrogenase [Conexibacter woesei DSM 14684]
          Length = 541

 Score = 33.9 bits (76), Expect = 8.2,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE-- 63
           +P  +++    FD+ +   +      D+ G++  VG++ GE GINI    +GR    +  
Sbjct: 444 RPHLLEVWGQRFDLQLESHLALFCYRDVPGMIGRVGSVFGEKGINIVSAAVGREPGDDGP 503

Query: 64  ----HAISFLCIDGSILNSVLEKL 83
               +A+  +  D  +  +V+E++
Sbjct: 504 TAGGNAVMAVTTDAPVPAAVIEEI 527


>gi|307826385|ref|ZP_07656587.1| D-3-phosphoglycerate dehydrogenase [Methylobacter tundripaludum
           SV96]
 gi|307732562|gb|EFO03437.1| D-3-phosphoglycerate dehydrogenase [Methylobacter tundripaludum
           SV96]
          Length = 527

 Score = 33.9 bits (76), Expect = 8.3,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 7   PRFIKIQEINFDV-DIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           PR + I + + +V  +G L++   + D  G++  + ++LG   INI+   +G +   + A
Sbjct: 437 PRLVCIDQFDIEVVPVGTLLV-TQHDDKPGVISAISSVLGNANINISRMQVGTADEQQRA 495

Query: 66  ISFLCIDGSILNSVLEKL 83
           ++ + +   +   +L++L
Sbjct: 496 MAVISVSEPLTEDLLQQL 513


>gi|86742318|ref|YP_482718.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. CcI3]
 gi|86569180|gb|ABD12989.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. CcI3]
          Length = 529

 Score = 33.5 bits (75), Expect = 8.8,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 34/66 (51%)

Query: 35  GIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
           GIV  VG +LGE  INIA   + R Q+   A+  L +D ++   +L +++  +   + + 
Sbjct: 464 GIVGAVGALLGEAHINIASAQVSRLQAGGEALMSLSLDDAVAPDILAEIAKIIGASYARA 523

Query: 95  FEFNVD 100
              + D
Sbjct: 524 VSISSD 529


>gi|237785818|ref|YP_002906523.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium kroppenstedtii
           DSM 44385]
 gi|237758730|gb|ACR17980.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium kroppenstedtii
           DSM 44385]
          Length = 532

 Score = 33.5 bits (75), Expect = 9.0,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 46/95 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG  + ++I +   D+      + +   D  G +  VG+ LGE GIN+    L + ++  
Sbjct: 438 DGVEKIVRINDRGLDLRAEGRNVFLHYKDRPGALGAVGSQLGERGINVEAAALSQDKAGT 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            A   L +D ++ + V+E +  ++  ++    +F+
Sbjct: 498 GATLALRVDKAVPDDVMESMKASLDAQYAIALDFD 532


>gi|229086711|ref|ZP_04218878.1| L-serine dehydratase, beta chain [Bacillus cereus Rock3-44]
 gi|228696585|gb|EEL49403.1| L-serine dehydratase, beta chain [Bacillus cereus Rock3-44]
          Length = 219

 Score = 33.5 bits (75), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 10  IKIQEIN-FDVDIG--RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           I++ E+N FD+ +      + IVN D  G +  V +IL ++ INI+   + R +    A+
Sbjct: 130 IEVVELNGFDLQLSGTSPALLIVNNDRFGAIASVASILAKHEINISTMSVSRKEKGRKAL 189

Query: 67  SFLCIDGSILNSVLEKL 83
             +  D  + N V+E++
Sbjct: 190 MVIETDQLLANEVIEEI 206


>gi|225165807|ref|ZP_03727591.1| D-3-phosphoglycerate dehydrogenase [Opitutaceae bacterium TAV2]
 gi|224799953|gb|EEG18398.1| D-3-phosphoglycerate dehydrogenase [Opitutaceae bacterium TAV2]
          Length = 529

 Score = 33.5 bits (75), Expect = 9.9,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 40/90 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + +PR + I     +V     ++ + N D  G+V  VG +LG  G+NIA   L R     
Sbjct: 436 NNEPRVVGINGREVEVAAEGQLLVLENTDKPGMVGMVGTLLGNDGVNIADMSLTRLILGG 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
            A   + +D     +  + L  N  ++F K
Sbjct: 496 TAYMVVRVDHEPSPTARKALKDNPAVKFAK 525


>gi|258517404|ref|YP_003193626.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257781109|gb|ACV65003.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 526

 Score = 33.5 bits (75), Expect = 9.9,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 32/60 (53%)

Query: 25  MICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLS 84
           M+ + + D   I+  VG ++GE+ INIA   +GR +    A+  L ID  + +  L  ++
Sbjct: 454 MLVVPHYDRPKIIGKVGTLIGEHDINIAAMQVGRKEIGGKAVMVLTIDDVVPDDTLRAIA 513


Searching..................................................done


Results from round 2




>gi|325063120|gb|ADY66810.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium sp. H13-3]
          Length = 531

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 51/100 (51%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LGE G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKNINMDADVGSHMIYITNTDVPGMIGFMGTTLGEAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR V+   FN+D
Sbjct: 492 EGGDAIALLYVDGPVSEDVLDKLRANPAIRQVRPLTFNID 531


>gi|227823299|ref|YP_002827271.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium fredii NGR234]
 gi|227342300|gb|ACP26518.1| phosphoglycerate dehydrogenase [Sinorhizobium fredii NGR234]
          Length = 531

 Score =  159 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 66/100 (66%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ + N D+ G++ F+G  LG+  +NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYLTNTDVPGMIGFIGTTLGDANVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +  +VL+KL  N  +R  K   FNVD
Sbjct: 492 QGGDAIALLYVDGPVSEAVLDKLRANPAVRQAKPLVFNVD 531


>gi|15891242|ref|NP_356914.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str.
           C58]
 gi|15159607|gb|AAK89699.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str.
           C58]
          Length = 531

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 53/100 (53%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LGE G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKNINMDADVGSHMIYITNTDVPGMIGFMGTTLGEAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR VK   FNVD
Sbjct: 492 EAGDAIALLYVDGPVSEEVLDKLRANSAIRQVKPLTFNVD 531


>gi|260432240|ref|ZP_05786211.1| phosphoglycerate dehydrogenase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416068|gb|EEX09327.1| phosphoglycerate dehydrogenase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 531

 Score =  156 bits (396), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +GE+G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGKTMGEHGVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+       +K  EF+V
Sbjct: 492 AGGEAIALLYVDEPVPAEARAKLAETGLFTQIKPLEFDV 530


>gi|150397816|ref|YP_001328283.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium medicae WSM419]
 gi|150029331|gb|ABR61448.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium medicae WSM419]
          Length = 531

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 68/100 (68%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ + N D+ G++ F+G+ LG+ G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGAHMVYLTNTDVPGMIGFIGSTLGDAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +  +VL++L  N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGPVSETVLDRLRANEAIRQAKPLVFNID 531


>gi|307318345|ref|ZP_07597780.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti AK83]
 gi|306896027|gb|EFN26778.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti AK83]
          Length = 531

 Score =  156 bits (395), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ I N D+ G++ F+G+ LG+ G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYITNTDVPGMIGFIGSTLGDAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGPVSEIVLDKLRANEAIRQAKPLVFNID 531


>gi|307300480|ref|ZP_07580260.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C]
 gi|306904646|gb|EFN35230.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C]
          Length = 531

 Score =  156 bits (395), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ I N D+ G++ F+G+ LG+ G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYITNTDVPGMIGFIGSTLGDAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGPVSEIVLDKLRANEAIRQAKPLVFNID 531


>gi|15966483|ref|NP_386836.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti 1021]
 gi|15075754|emb|CAC47309.1| Putative D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti
           1021]
          Length = 531

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ I N D+ G++ F+G+ LG+ G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYITNTDVPGMIGFIGSTLGDAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGPVSEIVLDKLRANEAIRQAKPLVFNID 531


>gi|126738641|ref|ZP_01754346.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. SK209-2-6]
 gi|126720440|gb|EBA17146.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. SK209-2-6]
          Length = 531

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +GE+G+NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNNDVPGIIGSLGQTMGEHGVNIANFTLGRSE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+       +K  +F+V
Sbjct: 492 AGGEAIALLYVDEPVPAEARAKLAETDLFNQIKPLQFDV 530


>gi|116253700|ref|YP_769538.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258348|emb|CAK09450.1| putative D-3-phosphoglycerate dehydrogenase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 531

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + ++VL +L+ +  +R  K   FN+D
Sbjct: 492 QGGDAIALLYVDGKVDDAVLAELTAHQAVRQAKPLTFNID 531


>gi|241206175|ref|YP_002977271.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860065|gb|ACS57732.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 531

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + ++VL +L+ +  +R  K   FN+D
Sbjct: 492 QGGDAIALLYVDGKVDDAVLAELTAHQAVRQAKPLTFNID 531


>gi|56698179|ref|YP_168551.1| D-3-phosphoglycerate dehydrogenase [Ruegeria pomeroyi DSS-3]
 gi|56679916|gb|AAV96582.1| D-3-phosphoglycerate dehydrogenase [Ruegeria pomeroyi DSS-3]
          Length = 531

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +G  +GE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGINVDAEIGAHMLYTTNEDVPGIIGTLGQTMGENGVNIANFTLGRAA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+       +K  EF+V
Sbjct: 492 AGGEAIALLYVDEPVPAEARAKLAETGLFNQIKPLEFDV 530


>gi|255264452|ref|ZP_05343794.1| phosphoglycerate dehydrogenase [Thalassiobium sp. R2A62]
 gi|255106787|gb|EET49461.1| phosphoglycerate dehydrogenase [Thalassiobium sp. R2A62]
          Length = 530

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG+ M+   N D+ GI+  +G  +GE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGQHMLYTTNEDVPGIIGTLGQTMGENGVNIANFTLGRAD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L ID  +   V+ KL        VK  +F+V
Sbjct: 492 RGGEAIALLYIDDPVAADVIAKLEATEMFTQVKPLDFDV 530


>gi|218663595|ref|ZP_03519525.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli IE4771]
          Length = 535

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 436 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGGAGVNIANFQLGRDK 495

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 496 QGGDAIALLYVDGEVEDGVLEQLTAHQAIRQAKLLTFNID 535


>gi|254453066|ref|ZP_05066503.1| phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
 gi|198267472|gb|EDY91742.1| phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
          Length = 516

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  MI   N D+ GI+  +G  +G++ +NIA+F LGRS 
Sbjct: 417 VFSDGKPRFIQIKGINIDAEIGAHMIYTTNEDVPGIIGTLGQTMGKHNVNIANFTLGRSA 476

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D ++  + L ++        VK   F+V
Sbjct: 477 ANGEAIALLYVDETVPAAALAEIEATGMFTQVKPLTFDV 515


>gi|254466037|ref|ZP_05079448.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium Y4I]
 gi|206686945|gb|EDZ47427.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium Y4I]
          Length = 531

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN + D+G  M+   N D+ GI+  +G  LG+ G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINLEADVGAHMLYTTNEDVPGIIGTLGQTLGDNGVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   +  KL+       +K  EF+V
Sbjct: 492 AGGEAIALLYVDEPVPAEIRAKLAETGLFNQIKPLEFDV 530


>gi|149202983|ref|ZP_01879954.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. TM1035]
 gi|149143529|gb|EDM31565.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. TM1035]
          Length = 531

 Score =  153 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 64/99 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IGR M+   N D+ GI+  +G  +G++G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGRHMLYTTNEDVPGIIGTLGMTMGDHGVNIANFTLGRSD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  + ++ L      + +++  F+V
Sbjct: 492 AGGEAIALLYVDAPVPEAAIKALHATGKFQQIRELRFDV 530


>gi|126733884|ref|ZP_01749631.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS2]
 gi|126716750|gb|EBA13614.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS2]
          Length = 530

 Score =  153 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 58/99 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D  G++  +G  LG   +NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGEHMVYTTNEDRPGVIGTLGTTLGANNVNIANFTLGRSE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  I    +E L      + VK   FNV
Sbjct: 492 AKGEAIALLYVDEPIPAQAIEALETTGLFQQVKPLTFNV 530


>gi|254509701|ref|ZP_05121768.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium KLH11]
 gi|221533412|gb|EEE36400.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium KLH11]
          Length = 531

 Score =  153 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +G  +GE+ +NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDVPGIIGVLGQTMGEHNVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +       L+       +K  EF+V
Sbjct: 492 AGGEAIALLYVDAPVPAEARAVLAETGLFTQIKPLEFDV 530


>gi|190893267|ref|YP_001979809.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT
           652]
 gi|190698546|gb|ACE92631.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT
           652]
          Length = 531

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 50/100 (50%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FNVD
Sbjct: 492 QGGDAIALLYVDGEVEDGVLERLTAHQAIRQAKLLTFNVD 531


>gi|327193458|gb|EGE60354.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli
           CNPAF512]
          Length = 531

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGEVEDGVLEQLTAHQAIRQAKLLTFNID 531


>gi|110635490|ref|YP_675698.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium sp. BNC1]
 gi|110286474|gb|ABG64533.1| D-3-phosphoglycerate dehydrogenase [Chelativorans sp. BNC1]
          Length = 532

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D  GI+  +G I G++G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINLDAEVGEHMLYTTNNDTPGIIGQLGTICGKHGVNIANFQLGRNR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D      VLE+L    +I   K   F+V
Sbjct: 492 PGGDAIALLYLDAPFPQPVLEELKSTGSIISAKPLRFDV 530


>gi|114763689|ref|ZP_01443083.1| D-3-phosphoglycerate dehydrogenase [Pelagibaca bermudensis
           HTCC2601]
 gi|114543690|gb|EAU46703.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. HTCC2601]
          Length = 531

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 63/99 (63%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G +LGE+ +N+A+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGEHMLYTTNEDVPGIIGKLGTMLGEHKVNLANFTLGRSA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+   +D ++  SV++ L      R VK  EF+V
Sbjct: 492 QGGEAIAIAYLDEAMDASVVDALKATGLFRQVKPLEFDV 530


>gi|218509868|ref|ZP_03507746.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli Brasil 5]
          Length = 254

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 155 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 214

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 215 QGGDAIALLYVDGEVEDGVLEQLTAHQAIRQAKLLTFNID 254


>gi|218675485|ref|ZP_03525154.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli GR56]
          Length = 531

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGEVEDGVLERLTAHQAIRQAKLLTFNID 531


>gi|86139432|ref|ZP_01058001.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. MED193]
 gi|85823935|gb|EAQ44141.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. MED193]
          Length = 531

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 63/99 (63%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +GE+G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNNDVPGIIGTLGQTMGEHGVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D ++      KL+       +K  +F+V
Sbjct: 492 AGGEAIALLYVDAAVPAEARAKLAETDLFNQIKPLQFDV 530


>gi|83952581|ref|ZP_00961312.1| D-3-phosphoglycerate dehydrogenase [Roseovarius nubinhibens ISM]
 gi|83836254|gb|EAP75552.1| D-3-phosphoglycerate dehydrogenase [Roseovarius nubinhibens ISM]
          Length = 531

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 63/99 (63%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D  GI+  +G  +G+ G+NIA+F LGRSQ
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDEPGIIGMLGQTMGQNGVNIANFTLGRSQ 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   V+++L      + V+  +F+V
Sbjct: 492 AGGEAIALLYVDAEVPAPVIKQLEDTGMFKQVRPLQFDV 530


>gi|328542552|ref|YP_004302661.1| Aspartyl/glutamyl tRNA amidotransferase subunit C [Polymorphum
           gilvum SL003B-26A1]
 gi|326412298|gb|ADZ69361.1| Aspartyl/glutamyl tRNA amidotransferase subunit C [Polymorphum
           gilvum SL003B-26A1]
          Length = 528

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 62/97 (63%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+++ IN + ++G  M+ I N D  G +   G +LG+ G+NIA F+LGR++
Sbjct: 432 VFADGKPRIIQVKGINMEAELGPHMLYITNEDKPGFIGKFGTLLGQAGVNIATFNLGRTE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI+ + +DG +    LE+++    ++ VK  +F
Sbjct: 492 AGGDAIALIEVDGDVPARTLEQINALPLVKQVKLLKF 528


>gi|85705886|ref|ZP_01036982.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. 217]
 gi|85669474|gb|EAQ24339.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. 217]
          Length = 531

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 64/99 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IGR M+   N D+ GI+  +G  +GE G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGRHMLYTTNEDVPGIIGTLGMTMGENGVNIANFTLGRSD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  + ++ L      + +++ +F+V
Sbjct: 492 AGGEAIALLYVDAPVPEAAIKALHATGKFQQIRELKFDV 530


>gi|163745024|ref|ZP_02152384.1| D-3-phosphoglycerate dehydrogenase [Oceanibulbus indolifex HEL-45]
 gi|161381842|gb|EDQ06251.1| D-3-phosphoglycerate dehydrogenase [Oceanibulbus indolifex HEL-45]
          Length = 531

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ I  D +IG  M+   N D+ GI+  +G  +GE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGITIDAEIGEHMLYTTNEDVPGIIGTLGQTMGENGVNIANFTLGRNT 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  +V+ KL      R +K  +F+V
Sbjct: 492 AKGEAIALLYVDDQVPEAVIGKLRDTGMFRQIKPLQFDV 530


>gi|254436982|ref|ZP_05050476.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 307]
 gi|198252428|gb|EDY76742.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 307]
          Length = 531

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  MI   N D+ GI+  +G  +G++ +NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMIYTTNEDVPGIIGTLGQTMGKHNVNIANFTLGRSA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  + L++L        VK   F+V
Sbjct: 492 ANGEAIALLYVDEVVPAATLKELEATGMFTQVKPLTFDV 530


>gi|260429359|ref|ZP_05783336.1| phosphoserine aminotransferase [Citreicella sp. SE45]
 gi|260419982|gb|EEX13235.1| phosphoserine aminotransferase [Citreicella sp. SE45]
          Length = 918

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 64/99 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G +LG++ +N+A+F LGRS 
Sbjct: 819 VFSDGKPRFIQIKGINIDAEVGEHMLYTTNEDVPGIIGKLGTLLGDHKVNLANFTLGRSA 878

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+   +D ++ +SV++ L      R VK  EF++
Sbjct: 879 QGAEAIAISYLDEALDDSVVKALKDTGLFRQVKPLEFDL 917


>gi|209550768|ref|YP_002282685.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536524|gb|ACI56459.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 531

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + ++VL +L+ N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGDVDDTVLAQLTANQAIRQAKLLTFNID 531


>gi|163758780|ref|ZP_02165867.1| D-3-phosphoglycerate dehydrogenase [Hoeflea phototrophica DFL-43]
 gi|162284070|gb|EDQ34354.1| D-3-phosphoglycerate dehydrogenase [Hoeflea phototrophica DFL-43]
          Length = 531

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 68/100 (68%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G+ MI I N D+ G++ F+G+ LG+ G+NIA+FHLGR  
Sbjct: 432 VFSDGKPRFIQIKGINMDADVGQHMIYIANTDVPGMIGFMGSTLGDAGVNIANFHLGRET 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            +  AI+ L +D  +   VL KL+ +  I+  K   FNVD
Sbjct: 492 ESGDAIALLYVDELVSQDVLAKLTAHHAIKQAKPLVFNVD 531


>gi|149912706|ref|ZP_01901240.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. AzwK-3b]
 gi|149813112|gb|EDM72938.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. AzwK-3b]
          Length = 531

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 64/99 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IGR M+   N D  GI+  +G  +GE G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGRHMLYTTNNDEPGIIGTLGQTMGENGVNIANFTLGRSN 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  I  +V++KL      + V+  +F+V
Sbjct: 492 AGGEAIALLYVDAPIETAVIKKLEATGKFQQVRALQFDV 530


>gi|254477808|ref|ZP_05091194.1| phosphoglycerate dehydrogenase [Ruegeria sp. R11]
 gi|214032051|gb|EEB72886.1| phosphoglycerate dehydrogenase [Ruegeria sp. R11]
          Length = 531

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 58/99 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +G+  +NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGALGKTMGDNDVNIANFTLGRSD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+       +K   F+V
Sbjct: 492 AGGEAIALLYVDEPVPAEARAKLAETGLFTQIKPLAFDV 530


>gi|86359045|ref|YP_470937.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli CFN 42]
 gi|86283147|gb|ABC92210.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CFN 42]
          Length = 531

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 66/100 (66%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VL +L+ +  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGEVEDGVLTQLTAHQAIRQAKLLTFNID 531


>gi|254462167|ref|ZP_05075583.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium HTCC2083]
 gi|206678756|gb|EDZ43243.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 531

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +GN +G+ G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDVPGIIGLLGNTMGKSGVNIANFTLGRAD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  I   VL+ L        VK  EF+V
Sbjct: 492 VGGEAIALLYVDNPIPADVLKTLDGTGMFSQVKPLEFDV 530


>gi|222086960|ref|YP_002545494.1| D-3-phosphoglycerate dehydrogenase protein [Agrobacterium
           radiobacter K84]
 gi|221724408|gb|ACM27564.1| D-3-phosphoglycerate dehydrogenase protein [Agrobacterium
           radiobacter K84]
          Length = 531

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ + N D+ G++ F+G+ LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYLANTDVPGMIGFIGSTLGSAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG I + VL KL+ +  IR  K   FNVD
Sbjct: 492 QGGDAIALLYVDGPINDEVLGKLTAHQAIRQAKPLVFNVD 531


>gi|89070040|ref|ZP_01157371.1| D-3-phosphoglycerate dehydrogenase [Oceanicola granulosus HTCC2516]
 gi|89044377|gb|EAR50515.1| D-3-phosphoglycerate dehydrogenase [Oceanicola granulosus HTCC2516]
          Length = 530

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG+ M+   N D+ GI+  +G  +G  G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGQHMLYTTNEDVPGIIGTLGTTMGSNGVNIANFTLGRSA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +    L+ L      R VK  +F V
Sbjct: 492 AKGEAIALLYVDEEVPAKALDALKQTGMFRQVKTLQFEV 530


>gi|126732689|ref|ZP_01748485.1| D-3-phosphoglycerate dehydrogenase [Sagittula stellata E-37]
 gi|126706819|gb|EBA05889.1| D-3-phosphoglycerate dehydrogenase [Sagittula stellata E-37]
          Length = 532

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 59/99 (59%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  LG  G+NIA+F LGRS 
Sbjct: 433 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGMTLGGMGVNIANFTLGRSA 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+     R +K   F+V
Sbjct: 493 AKGEAIALLYVDEPVPAEARAKLAETGMFRQIKPLSFDV 531


>gi|17939923|emb|CAD19520.1| d-3 phosphoglycerate dehydrogenase, L-serine dehydratase [Rhizobium
           etli]
          Length = 125

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 66/100 (66%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 26  VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 85

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VL +L+ +  IR  K   FN+D
Sbjct: 86  QGGDAIALLYVDGEVEDGVLTQLTAHQAIRQAKLLTFNID 125


>gi|110677605|ref|YP_680612.1| D-3-phosphoglycerate dehydrogenase [Roseobacter denitrificans OCh
           114]
 gi|109453721|gb|ABG29926.1| D-3-phosphoglycerate dehydrogenase [Roseobacter denitrificans OCh
           114]
          Length = 531

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ I  D ++G  M+   N D+ GI+  +G  +GE G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGIQIDAEVGAHMLYTTNEDVPGIIGTLGQTMGENGVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   V++KL        VK   F+V
Sbjct: 492 AKGEAIALLYVDDQVPAPVIKKLEKTGMFTQVKPLIFDV 530


>gi|218516339|ref|ZP_03513179.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli 8C-3]
          Length = 231

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 132 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 191

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 192 QGGDAIALLYVDGEVEDGVLEQLTAHQAIRQAKLLTFNID 231


>gi|159045858|ref|YP_001534652.1| D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shibae DFL 12]
 gi|157913618|gb|ABV95051.1| D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shibae DFL 12]
          Length = 531

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D  G++  +G ILGE  +NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGEHMLYTTNKDTPGMIGTLGGILGENQVNIANFTLGRNE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   V +KL      + V+  +FNV
Sbjct: 492 TNGDAIAMLYLDAPLPRDVQDKLIATGLFQQVRPLQFNV 530


>gi|239832773|ref|ZP_04681102.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum intermedium LMG
           3301]
 gi|239825040|gb|EEQ96608.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum intermedium LMG
           3301]
          Length = 538

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 61/98 (62%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 438 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHNVNIANFSLGRDHP 497

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L+    I+     EFNV
Sbjct: 498 GGDAIAMLYVDEQIPQAALDELTAQEAIKAATPLEFNV 535


>gi|259417745|ref|ZP_05741664.1| phosphoglycerate dehydrogenase [Silicibacter sp. TrichCH4B]
 gi|259346651|gb|EEW58465.1| phosphoglycerate dehydrogenase [Silicibacter sp. TrichCH4B]
          Length = 531

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 58/99 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  LG+  +NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNKDVPGIIGTLGQTLGDMDVNIANFTLGRNE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  +      KL+       +K   F+V
Sbjct: 492 VGGEAIALLYVDAEVPADARAKLAETGYFTQIKPLAFDV 530


>gi|99082861|ref|YP_615015.1| D-3-phosphoglycerate dehydrogenase [Ruegeria sp. TM1040]
 gi|99039141|gb|ABF65753.1| D-3-phosphoglycerate dehydrogenase [Ruegeria sp. TM1040]
          Length = 531

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 58/99 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  LG+  +NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNQDVPGIIGTLGQTLGDMDVNIANFTLGRNE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  +      KL+       +K   F+V
Sbjct: 492 VGGEAIALLYVDAEVPADARAKLAETGYFTQIKPLAFDV 530


>gi|163733251|ref|ZP_02140695.1| D-3-phosphoglycerate dehydrogenase [Roseobacter litoralis Och 149]
 gi|161393786|gb|EDQ18111.1| D-3-phosphoglycerate dehydrogenase [Roseobacter litoralis Och 149]
          Length = 531

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ I  D ++G  M+   N D+ GI+  +G  +GE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGIQIDAEVGAHMLYTTNEDVPGIIGALGQTMGENGVNIANFTLGRAV 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   V++KL        VK   F+V
Sbjct: 492 AQGEAIALLYVDDQVPAPVIKKLEATGMFTQVKPLMFDV 530


>gi|254700347|ref|ZP_05162175.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261750842|ref|ZP_05994551.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261740595|gb|EEY28521.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
          Length = 533

 Score =  148 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 42/98 (42%), Positives = 61/98 (62%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR Q 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDQP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|126724751|ref|ZP_01740594.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705915|gb|EBA05005.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
          Length = 530

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +G  +G  G+NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDVPGIIGTLGQTMGGNGVNIANFTLGRSE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D +I   +L +L      + V    F+V
Sbjct: 492 VGGEAIALLYVDSAIPAPILAELKTTGMFQSVNPLRFDV 530


>gi|158422609|ref|YP_001523901.1| D-3-phosphoglycerate dehydrogenase [Azorhizobium caulinodans ORS
           571]
 gi|158329498|dbj|BAF86983.1| D-3-phosphoglycerate dehydrogenase [Azorhizobium caulinodans ORS
           571]
          Length = 528

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+PR + I+ I  D      M+ + N D  G +    ++LG+ G+NIA F LGR  
Sbjct: 432 VFADGQPRIVDIKGIKVDAGFAPNMLYVTNEDKPGFIGRFASLLGDAGVNIATFALGRDH 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   VL K+S    +R VKQ  F
Sbjct: 492 PGGDAIALVEVDGPVPADVLGKVSALPHVRQVKQLRF 528


>gi|225628254|ref|ZP_03786288.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti str. Cudo]
 gi|225616100|gb|EEH13148.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti str. Cudo]
          Length = 538

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 438 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 497

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 498 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 535


>gi|163845265|ref|YP_001622920.1| D-3-phosphoglycerate dehydrogenase [Brucella suis ATCC 23445]
 gi|163675988|gb|ABY40098.1| D-3-phosphoglycerate dehydrogenase [Brucella suis ATCC 23445]
          Length = 533

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|256160401|ref|ZP_05458090.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
 gi|265998770|ref|ZP_06111327.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
 gi|262553459|gb|EEZ09228.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
          Length = 533

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|254708700|ref|ZP_05170511.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261316192|ref|ZP_05955389.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261295415|gb|EEX98911.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
          Length = 533

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|294850937|ref|ZP_06791613.1| phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|294821580|gb|EFG38576.1| phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-0026]
          Length = 533

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|260167901|ref|ZP_05754712.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
 gi|261757340|ref|ZP_06001049.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
 gi|261737324|gb|EEY25320.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
          Length = 533

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|23502543|ref|NP_698670.1| D-3-phosphoglycerate dehydrogenase [Brucella suis 1330]
 gi|148559678|ref|YP_001259539.1| D-3-phosphoglycerate dehydrogenase [Brucella ovis ATCC 25840]
 gi|161619616|ref|YP_001593503.1| D-3-phosphoglycerate dehydrogenase [Brucella canis ATCC 23365]
 gi|254703466|ref|ZP_05165294.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|254708447|ref|ZP_05170275.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|254714547|ref|ZP_05176358.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|254717444|ref|ZP_05179255.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|254719689|ref|ZP_05181500.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|256030226|ref|ZP_05443840.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|256061723|ref|ZP_05451860.1| D-3-phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|256370095|ref|YP_003107606.1| D-3-phosphoglycerate dehydrogenase [Brucella microti CCM 4915]
 gi|260568773|ref|ZP_05839241.1| SerA family protein [Brucella suis bv. 4 str. 40]
 gi|261219276|ref|ZP_05933557.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|261315946|ref|ZP_05955143.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261322337|ref|ZP_05961534.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|261325728|ref|ZP_05964925.1| phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|261754095|ref|ZP_05997804.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|265984704|ref|ZP_06097439.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|265987255|ref|ZP_06099812.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|306837853|ref|ZP_07470715.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. NF 2653]
 gi|306841404|ref|ZP_07474106.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO2]
 gi|306844678|ref|ZP_07477263.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO1]
 gi|23348542|gb|AAN30585.1| D-3-phosphoglycerate dehydrogenase [Brucella suis 1330]
 gi|148370935|gb|ABQ60914.1| phosphoglycerate dehydrogenase [Brucella ovis ATCC 25840]
 gi|161336427|gb|ABX62732.1| D-3-phosphoglycerate dehydrogenase [Brucella canis ATCC 23365]
 gi|256000258|gb|ACU48657.1| D-3-phosphoglycerate dehydrogenase [Brucella microti CCM 4915]
 gi|260154157|gb|EEW89239.1| SerA family protein [Brucella suis bv. 4 str. 40]
 gi|260924365|gb|EEX90933.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|261295027|gb|EEX98523.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|261301708|gb|EEY05205.1| phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|261304972|gb|EEY08469.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261743848|gb|EEY31774.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|264659452|gb|EEZ29713.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|264663296|gb|EEZ33557.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|306274850|gb|EFM56620.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO1]
 gi|306288510|gb|EFM59862.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO2]
 gi|306407092|gb|EFM63309.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. NF 2653]
          Length = 533

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|83941656|ref|ZP_00954118.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. EE-36]
 gi|83847476|gb|EAP85351.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. EE-36]
          Length = 531

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN + ++G  M+   N D+ GI+  +G  LG   +NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIEAEVGAHMLYTTNNDVPGIIGTLGQTLGANDVNIANFTLGRST 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L IDG +    L+ L      + VK+ EF V
Sbjct: 492 AKGEAIALLYIDGPLPEKALKDLRDTGLFKQVKELEFEV 530


>gi|83855133|ref|ZP_00948663.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. NAS-14.1]
 gi|83842976|gb|EAP82143.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. NAS-14.1]
          Length = 531

 Score =  147 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN + ++G  M+   N D+ GI+  +G  LG   +NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIEAEVGAHMLYTTNNDVPGIIGTLGQTLGANDVNIANFTLGRST 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L IDG +    L+ L      + VK+ EF V
Sbjct: 492 AKGEAIALLYIDGPLPEKALKDLRDTGLFKQVKELEFEV 530


>gi|17986632|ref|NP_539266.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
 gi|17982247|gb|AAL51530.1| d-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
          Length = 538

 Score =  147 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 438 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 497

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 498 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 535


>gi|225853142|ref|YP_002733375.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis ATCC 23457]
 gi|256045296|ref|ZP_05448190.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256263367|ref|ZP_05465899.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260565812|ref|ZP_05836295.1| aspartyl/glutamyl tRNA amidotransferase subunit C [Brucella
           melitensis bv. 1 str. 16M]
 gi|265991722|ref|ZP_06104279.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|225641507|gb|ACO01421.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis ATCC 23457]
 gi|260151185|gb|EEW86280.1| aspartyl/glutamyl tRNA amidotransferase subunit C [Brucella
           melitensis bv. 1 str. 16M]
 gi|263002678|gb|EEZ15081.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093365|gb|EEZ17434.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|326409698|gb|ADZ66763.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis M28]
 gi|326539406|gb|ADZ87621.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis M5-90]
          Length = 533

 Score =  147 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|304394494|ref|ZP_07376415.1| phosphoglycerate dehydrogenase [Ahrensia sp. R2A130]
 gi|303293404|gb|EFL87783.1| phosphoglycerate dehydrogenase [Ahrensia sp. R2A130]
          Length = 533

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 59/97 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN + + G  M+   N+D  GI+  +G + GE G+NIAHF+LGR+ 
Sbjct: 435 VFSDGKPRFIQIKGINMEAEAGEHMLYTTNSDAPGIIGKLGTLFGEAGVNIAHFYLGRNH 494

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AIS + +D  +    LEKL     I   K  EF
Sbjct: 495 AGGDAISLIQLDHPVPADFLEKLKDTPEIDSAKPLEF 531


>gi|256114254|ref|ZP_05454999.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265995559|ref|ZP_06108116.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|262766843|gb|EEZ12461.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
          Length = 533

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|126460798|ref|YP_001041912.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102462|gb|ABN75140.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 531

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 63/98 (64%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++GR M+   N D+ GI+  +G  +G+ G+NIA+F LGR+  
Sbjct: 433 FSDGKPRFIQIKGINIDAEVGRHMLYTTNEDVPGIIGLLGMTMGKNGVNIANFTLGRTSV 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            + AI+ L +D +I   V+E L      + VK  EF+V
Sbjct: 493 GQEAIAILYLDQAIDPKVVETLESTGLFQQVKPLEFDV 530


>gi|77464929|ref|YP_354433.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides 2.4.1]
 gi|221640849|ref|YP_002527111.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides KD131]
 gi|77389347|gb|ABA80532.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides 2.4.1]
 gi|221161630|gb|ACM02610.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides KD131]
          Length = 534

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 63/98 (64%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++GR M+   N D+ GI+  +G  +G+ G+NIA+F LGR+  
Sbjct: 436 FSDGKPRFIQIKGINIDAEVGRHMLYTTNEDVPGIIGLLGMTMGKNGVNIANFTLGRTSV 495

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            + AI+ L +D +I   V+E L      + VK  EF+V
Sbjct: 496 GQEAIAILYLDQAIDPKVVETLESTGLFQQVKPLEFDV 533


>gi|222149645|ref|YP_002550602.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis S4]
 gi|221736627|gb|ACM37590.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis S4]
          Length = 531

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 46/100 (46%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGPHMIYISNTDVPGMIGFMGTTLGNAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            +  AI+ L +DG +  +VL++L+ N  I+  +   F V+
Sbjct: 492 ESGDAIALLYVDGPVEQTVLDQLTANAAIKQARLLTFAVE 531


>gi|319781038|ref|YP_004140514.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166926|gb|ADV10464.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 533

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 66/99 (66%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G+ M+   NAD  GI+  +G + GE G+NIA+F LGR++ 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGQHMLYTTNADAPGIIGLLGTVCGENGVNIANFQLGRNRP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
              AI+ L +D     +VLEK+  + +I   K+ +F+V+
Sbjct: 493 GGDAIALLYLDAPFPEAVLEKVKAHKSIDSAKRLQFDVN 531


>gi|61612115|gb|AAX47292.1| 3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri]
          Length = 533

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 66/99 (66%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G+ M+   NAD  GI+  +G + GE G+NIA+F LGR++ 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGQHMLYTTNADAPGIIGLLGTVCGENGVNIANFQLGRNRP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
              AI+ L +D     +VLEK+  + +I   K+ +F+V+
Sbjct: 493 GGDAIALLYLDAPFPEAVLEKVKAHKSIDSAKRLQFDVN 531


>gi|237816063|ref|ZP_04595059.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus str. 2308 A]
 gi|237788726|gb|EEP62938.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus str. 2308 A]
          Length = 538

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 438 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 497

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 498 GGDAIAMLYVDEQIPQAALDELMAQEAIRVATPLEFNV 535


>gi|46203185|ref|ZP_00208842.1| COG0111: Phosphoglycerate dehydrogenase and related dehydrogenases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 534

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DGKPR I+I+ I+ D      M+ + N D  G +   G++LGE G+N+A F LGR  
Sbjct: 438 VFHDGKPRVIEIRGIDIDAAFAPHMLYVRNHDKPGFIGRFGSVLGEAGVNVATFALGREA 497

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +DG +   VL+ +     ++ V+   F
Sbjct: 498 EGGNAIAFVAVDGPVPAEVLKTIEAIPQVKRVRPVRF 534


>gi|62290557|ref|YP_222350.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 1 str.
           9-941]
 gi|82700473|ref|YP_415047.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis biovar
           Abortus 2308]
 gi|189024778|ref|YP_001935546.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus S19]
 gi|254689854|ref|ZP_05153108.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|254694347|ref|ZP_05156175.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698003|ref|ZP_05159831.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730889|ref|ZP_05189467.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|256258108|ref|ZP_05463644.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|260547197|ref|ZP_05822935.1| SerA family protein [Brucella abortus NCTC 8038]
 gi|260755386|ref|ZP_05867734.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260758607|ref|ZP_05870955.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260762439|ref|ZP_05874776.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884402|ref|ZP_05896016.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|261214655|ref|ZP_05928936.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297248957|ref|ZP_06932665.1| phosphoglycerate dehydrogenase [Brucella abortus bv. 5 str. B3196]
 gi|62196689|gb|AAX74989.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 1
           str. 9-941]
 gi|82616574|emb|CAJ11653.1| ATP/GTP-binding site motif A (P-loop):Amino acid-binding
           ACT:D-isomer specific 2-hydroxyacid dehydrogenase,
           catalytic domain: [Brucella melitensis biovar Abortus
           2308]
 gi|189020350|gb|ACD73072.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus S19]
 gi|260095562|gb|EEW79440.1| SerA family protein [Brucella abortus NCTC 8038]
 gi|260668925|gb|EEX55865.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260672865|gb|EEX59686.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675494|gb|EEX62315.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260873930|gb|EEX80999.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|260916262|gb|EEX83123.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297174090|gb|EFH33447.1| phosphoglycerate dehydrogenase [Brucella abortus bv. 5 str. B3196]
          Length = 533

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRVATPLEFNV 530


>gi|146276068|ref|YP_001166227.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554309|gb|ABP68922.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 531

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 63/98 (64%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++GR M+   N D+ GI+  +G  +G+ G+NIA+F LGR+  
Sbjct: 433 FSDGKPRFIQIKGINIDAEVGRHMLYTTNEDVPGIIGLLGMTMGKNGVNIANFTLGRTSV 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            + AI+ L +D +I   V+E L      + VK  EF+V
Sbjct: 493 GQEAIAILYLDQAIDPKVVETLESTGMFQQVKPLEFDV 530


>gi|298292958|ref|YP_003694897.1| D-3-phosphoglycerate dehydrogenase [Starkeya novella DSM 506]
 gi|296929469|gb|ADH90278.1| D-3-phosphoglycerate dehydrogenase [Starkeya novella DSM 506]
          Length = 528

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+PR ++I+ I  D +    M+ + N D  G V    ++LG+ GINIA F LGR +
Sbjct: 432 VFADGRPRIVEIKGIKVDAEFAPSMLYVTNEDRPGFVGRFASLLGDAGINIATFALGRDR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   +L+K+    +++  K   F
Sbjct: 492 QGGDAIALVEVDGKVPAELLDKVQQIPSVKQAKPLVF 528


>gi|153008560|ref|YP_001369775.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560448|gb|ABS13946.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum anthropi ATCC
           49188]
          Length = 533

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGK RFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ INIA+F LGR   
Sbjct: 433 FSDGKARFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHNINIANFSLGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L+    I+     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELTAQEAIKAATPLEFNV 530


>gi|254504693|ref|ZP_05116844.1| D-3-phosphoglycerate dehydrogenase [Labrenzia alexandrii DFL-11]
 gi|222440764|gb|EEE47443.1| D-3-phosphoglycerate dehydrogenase [Labrenzia alexandrii DFL-11]
          Length = 528

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+++ IN + ++G  M+ I N D  G +  +G  LG   +NIA F+LGR+ 
Sbjct: 432 VFADGKPRIIQVKGINMEAELGEHMLYITNEDKPGFIGHLGMELGNNEVNIATFNLGRTA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E AI  + +D  +   V+ +L     ++ VK   F
Sbjct: 492 PGEEAICLVEVDAPVSKEVMARLETVSHVKQVKPLRF 528


>gi|254486096|ref|ZP_05099301.1| phosphoglycerate dehydrogenase [Roseobacter sp. GAI101]
 gi|214042965|gb|EEB83603.1| phosphoglycerate dehydrogenase [Roseobacter sp. GAI101]
          Length = 531

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +G  LG  G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDVPGIIGTLGQTLGANGVNIANFTLGRSV 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L ID  +  + +++L        VK+ EF+V
Sbjct: 492 AKGEAIALLYIDDVLPATAIKQLQDTGLFTQVKELEFDV 530


>gi|119383566|ref|YP_914622.1| D-3-phosphoglycerate dehydrogenase [Paracoccus denitrificans
           PD1222]
 gi|119373333|gb|ABL68926.1| D-3-phosphoglycerate dehydrogenase [Paracoccus denitrificans
           PD1222]
          Length = 529

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ G++  +G  LG+ G+NIA+F LGR++
Sbjct: 431 VFSDGKPRFIQIRGINVDAEIGEHMLYTRNRDVPGVIGALGMTLGDLGVNIANFTLGRTK 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           + + AI+ L +D  +    LE L        V+  +F V
Sbjct: 491 TGDDAIAILYLDEPLKPEALEALRATGKFLQVRPLQFEV 529


>gi|39937368|ref|NP_949644.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           CGA009]
 gi|192293149|ref|YP_001993754.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           TIE-1]
 gi|39651226|emb|CAE29749.1| putative phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           CGA009]
 gi|192286898|gb|ACF03279.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           TIE-1]
          Length = 529

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G  MI + N D  G +    ++LG+  +NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGSSMIYVTNEDKPGFIGKFASLLGDAKVNIATFNLGRHT 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + IDG     VLEK+     ++ VK   F
Sbjct: 493 EGGDAIALVTIDGPAPTEVLEKVQALPQVKQVKALTF 529


>gi|299134302|ref|ZP_07027495.1| D-3-phosphoglycerate dehydrogenase [Afipia sp. 1NLS2]
 gi|298591049|gb|EFI51251.1| D-3-phosphoglycerate dehydrogenase [Afipia sp. 1NLS2]
          Length = 529

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DG PR + I+ I  D + G+ MI I N D  G +    ++LG+  +NIA FHLGR+Q
Sbjct: 433 VYADGAPRLVNIKGIRVDAEFGKSMIYITNEDKPGFIGQFASLLGDAKVNIATFHLGRNQ 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   +L K++    ++  K   F
Sbjct: 493 QGGDAIALVEVDGPVPAEILAKVAKLPHVKQAKALTF 529


>gi|260467077|ref|ZP_05813257.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium opportunistum
           WSM2075]
 gi|259029186|gb|EEW30482.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium opportunistum
           WSM2075]
          Length = 533

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/98 (42%), Positives = 64/98 (65%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G+ M+   NAD  GI+  +G + GE G+NIA+F LGR++ 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGQHMLYTTNADAPGIIGLLGTVCGENGVNIANFQLGRNRP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D      VLE++  + +I   K+ +F+V
Sbjct: 493 GGDAIALLYLDAPFPEKVLEQVRAHKSIDSAKRLQFDV 530


>gi|316935825|ref|YP_004110807.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           DX-1]
 gi|315603539|gb|ADU46074.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           DX-1]
          Length = 529

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G  MI + N D  G +    ++LG+  +NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGASMIYVTNEDKPGFIGKFASLLGDAKVNIATFNLGRHS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + IDG     VLEK+     ++ VK   F
Sbjct: 493 QGGDAIALVEIDGPAPAEVLEKVQALPPVKQVKALTF 529


>gi|92116697|ref|YP_576426.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter hamburgensis X14]
 gi|91799591|gb|ABE61966.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter hamburgensis X14]
          Length = 529

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+ G+NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAGVNIATFNLGRHG 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++  +VL K+     ++ VK   F
Sbjct: 493 QGGDAIALVEVDGNVPENVLAKVQALPQVKQVKALTF 529


>gi|163742511|ref|ZP_02149897.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis 2.10]
 gi|161384096|gb|EDQ08479.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis 2.10]
          Length = 531

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G ILG+ G+NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGQILGDMGVNIANFTLGRSE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  +    L+       +K  +F+V
Sbjct: 492 AGGEAIALLYVDEPVPAAARAALAETEFFNQIKPLQFDV 530


>gi|90425581|ref|YP_533951.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
 gi|90107595|gb|ABD89632.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
          Length = 529

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 54/97 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG PR + I+ I  D + G+ MI + N D  G +    ++LG+  INIA F+LGR +
Sbjct: 433 VFADGHPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKINIATFNLGRHE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   V+ K+     ++  K   F
Sbjct: 493 LGGDAIALVEVDGAVPAEVIAKVQALPQVKQAKALVF 529


>gi|13473319|ref|NP_104886.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium loti MAFF303099]
 gi|14024068|dbj|BAB50672.1| phosphoglycerate dehydrogenase [Mesorhizobium loti MAFF303099]
          Length = 533

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 42/98 (42%), Positives = 64/98 (65%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G+ M+   NAD  GI+  +G + GE G+NIA+F LGR++ 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGQHMLYTTNADAPGIIGLLGTVCGENGVNIANFQLGRNRP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D      VLE++  + +I   K+ +F+V
Sbjct: 493 GGDAIALLYLDAPFPEKVLEQVRAHKSIDSAKRLQFDV 530


>gi|75677149|ref|YP_319570.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
 gi|74422019|gb|ABA06218.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
          Length = 529

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DG PR + I+ I  D + G+ MI + N D  G +    ++LG+ G+NIA F+LGR  
Sbjct: 433 VYADGHPRLVDIKGIRVDAEFGKSMIYVTNEDRPGFIGKFASLLGDAGVNIATFNLGRHS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DGS+  +VL K+     +R  K   F
Sbjct: 493 QGGDAIALVEVDGSVPENVLAKVQALPQVRQAKALTF 529


>gi|91978368|ref|YP_571027.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
 gi|91684824|gb|ABE41126.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
          Length = 529

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+  +NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKVNIATFNLGRHS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   V+ ++     ++  K   F
Sbjct: 493 QGGDAIALVEVDGPVPAEVIAQVQALPPVKQAKALVF 529


>gi|307944592|ref|ZP_07659932.1| phosphoglycerate dehydrogenase [Roseibium sp. TrichSKD4]
 gi|307772341|gb|EFO31562.1| phosphoglycerate dehydrogenase [Roseibium sp. TrichSKD4]
          Length = 528

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 58/97 (59%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+PR I+++ IN +  +   M+ I N D  G +  +G  LG  G+NIA F+LGR+ 
Sbjct: 432 VFADGRPRIIQVKGINMEAGLSEHMLYITNEDKPGFIGQLGMELGSNGVNIASFNLGRTA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E AI  + +DG +  S++ +LS    ++ VK  +F
Sbjct: 492 PGEDAICLIEVDGEVPASIMARLSAVPHVKQVKALQF 528


>gi|209886269|ref|YP_002290126.1| phosphoglycerate dehydrogenase [Oligotropha carboxidovorans OM5]
 gi|209874465|gb|ACI94261.1| phosphoglycerate dehydrogenase [Oligotropha carboxidovorans OM5]
          Length = 529

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DG PR + I+ I  D + G+ MI I N D  G +    ++LG+  +NIA FHLGR+Q
Sbjct: 433 VYADGAPRLVNIKGIRVDAEFGKSMIYITNEDKPGFIGKFASLLGDAKVNIATFHLGRNQ 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   +L K++    ++  K   F
Sbjct: 493 QGGDAIALVEVDGPVPQEILTKVAALPQVKQAKALAF 529


>gi|163738093|ref|ZP_02145509.1| flagellar L-ring protein precursor H [Phaeobacter gallaeciensis
           BS107]
 gi|161388709|gb|EDQ13062.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis
           BS107]
          Length = 531

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G ILG+ G+NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGQILGDMGVNIANFTLGRSE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  +    L+       +K  +F+V
Sbjct: 492 AGGEAIALLYVDEPVPAAARAALAETEFFNQIKPLQFDV 530


>gi|90418985|ref|ZP_01226896.1| D-3-phosphoglycerate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337065|gb|EAS50770.1| D-3-phosphoglycerate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 535

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 59/99 (59%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G+ M+   N D  GI+  +G   G  G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINLDAEVGQHMVYTTNNDAPGIIGLLGTTFGAAGVNIANFQLGRNR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  +   +L+ +  +  I   K   F+V
Sbjct: 492 PGGDAIALLYLDSPMPEDLLKTVLSHKEIISAKPLRFDV 530


>gi|84502815|ref|ZP_01000928.1| D-3-phosphoglycerate dehydrogenase [Oceanicola batsensis HTCC2597]
 gi|84388798|gb|EAQ01668.1| D-3-phosphoglycerate dehydrogenase [Oceanicola batsensis HTCC2597]
          Length = 531

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +G+ G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGQTMGQNGVNIANFTLGRAS 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D +     L  L      R +K  +F++
Sbjct: 492 AAGEAIALLYLDEAPRKDALSALEQTGLFRQIKPLQFDI 530


>gi|86748440|ref|YP_484936.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
 gi|86571468|gb|ABD06025.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
          Length = 529

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+  +NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGQSMIYVTNEDKPGFIGKFASLLGDAKVNIATFNLGRHS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + IDG     V+ K+     ++  K   F
Sbjct: 493 QGGDAIALVEIDGPAPADVIAKVQALPQVKQAKALAF 529


>gi|114704945|ref|ZP_01437853.1| phosphoglycerate dehydrogenase [Fulvimarina pelagi HTCC2506]
 gi|114539730|gb|EAU42850.1| phosphoglycerate dehydrogenase [Fulvimarina pelagi HTCC2506]
          Length = 532

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 39/98 (39%), Positives = 60/98 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D  GI+  +G + G+ G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGEHMVYTTNNDAPGIIGLLGTVFGKAGVNIANFQLGRNR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               AI+ L +D ++   VL+++  +  I       F+
Sbjct: 492 PGGDAIALLYVDSAVPEGVLDQVRDHKEIHRAVALRFD 529


>gi|146342773|ref|YP_001207821.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. ORS278]
 gi|146195579|emb|CAL79606.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. ORS278]
          Length = 529

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 54/97 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+  INIA FHLGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKINIATFHLGRVA 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   +L K+     ++  K   F
Sbjct: 493 PGSDAIALVEVDGAVPAELLAKIQALPQVKQAKALAF 529


>gi|89052752|ref|YP_508203.1| D-3-phosphoglycerate dehydrogenase [Jannaschia sp. CCS1]
 gi|88862301|gb|ABD53178.1| D-3-phosphoglycerate dehydrogenase [Jannaschia sp. CCS1]
          Length = 531

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 57/97 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N DI GI+  +G  +GE G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGEHMLYTTNHDIPGIIGTLGQTMGENGVNIANFTLGRSG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ L +D      VL KL        VK  +F
Sbjct: 492 RDGEAIALLYLDEQPPADVLGKLMETGLFESVKPLQF 528


>gi|84514603|ref|ZP_01001967.1| D-3-phosphoglycerate dehydrogenase [Loktanella vestfoldensis SKA53]
 gi|84511654|gb|EAQ08107.1| D-3-phosphoglycerate dehydrogenase [Loktanella vestfoldensis SKA53]
          Length = 530

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G+ILG   +NIA+F LGR++
Sbjct: 432 VFNDGKPRFIQIKGINIDAEVGENMVYTTNNDVPGIIGVLGSILGTNSVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +    + +L      + VK   F++
Sbjct: 492 AKGEAIALLYLDEPLPAKAVAELEGTGKFKQVKPLRFDI 530


>gi|84687790|ref|ZP_01015661.1| D-3-phosphoglycerate dehydrogenase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84664226|gb|EAQ10719.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2654]
          Length = 532

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ I  D +IG  M+   N D+ GI+  +G  LGE G+NIA+F LGR+Q
Sbjct: 434 VFSDGKPRFIQIKGITIDAEIGEHMLYTTNKDVPGIIGTLGRTLGEMGVNIANFTLGRNQ 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  +  +V + LS     + V   +F +
Sbjct: 494 QGGDAIALLYVDAEVPANVRKALSDTGMFQNVSALQFAI 532


>gi|148253350|ref|YP_001237935.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. BTAi1]
 gi|146405523|gb|ABQ34029.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. BTAi1]
          Length = 529

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+  INIA FHLGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKINIATFHLGRVA 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI+ + IDG++   +L K+     ++  K   F
Sbjct: 493 AGSDAIALVEIDGAVPAELLAKIQALPQVKQAKALTF 529


>gi|115526154|ref|YP_783065.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
 gi|115520101|gb|ABJ08085.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
          Length = 530

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG PR + I+ I  D + G+ MI + N D  G +    ++LG+  INIA F+LGR  
Sbjct: 434 VFADGHPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKINIATFNLGRHS 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   +L K+     ++  K   F
Sbjct: 494 QGGDAIALVEVDGAVPTELLAKVQSLPQVKQAKALVF 530


>gi|310814538|ref|YP_003962502.1| D-3-phosphoglycerate dehydrogenase [Ketogulonicigenium vulgare Y25]
 gi|308753273|gb|ADO41202.1| D-3-phosphoglycerate dehydrogenase [Ketogulonicigenium vulgare Y25]
          Length = 531

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 46/100 (46%), Positives = 64/100 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+EIN D +IG  MI   N D+ G++  +G ILGE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKEINVDAEIGADMIYTTNKDVPGVIGTLGGILGENGVNIANFTLGRAD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG    +VL+K+  +     V    F+V+
Sbjct: 492 QGGEAIAVLYVDGRPDEAVLDKVRASGKFGQVTAMHFDVN 531


>gi|85715274|ref|ZP_01046257.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter sp. Nb-311A]
 gi|85697920|gb|EAQ35794.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter sp. Nb-311A]
          Length = 549

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DG PR + I+ I  D + G+ MI + N D  G +    ++LG+ G+NIA F+LGR  
Sbjct: 453 VYADGHPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGRFASLLGDAGLNIATFNLGRHS 512

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DGS+  +VL K+     ++  K   F
Sbjct: 513 QGGDAIALVEVDGSVPENVLAKVQALPQVKQAKALTF 549


>gi|118588317|ref|ZP_01545726.1| D-3-phosphoglycerate dehydrogenase [Stappia aggregata IAM 12614]
 gi|118439023|gb|EAV45655.1| D-3-phosphoglycerate dehydrogenase [Stappia aggregata IAM 12614]
          Length = 528

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+++ IN + ++G  M+ I N D  G +  +G  LG  G+NIA FHLGR  
Sbjct: 432 VFADGKPRIIQVKGINMEAELGPQMLYITNEDKPGFIGHLGMELGNSGVNIATFHLGRLA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + AI  + +DG +   VL +L     ++ VK  +F
Sbjct: 492 PGDDAICLVEVDGDVSPDVLARLEAVSHVKQVKALKF 528


>gi|260574246|ref|ZP_05842251.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sp. SW2]
 gi|259023712|gb|EEW27003.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sp. SW2]
          Length = 531

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 61/98 (62%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D +IGR M+   N D+ GI+  +G  +G+  +NIA+F LGRS  
Sbjct: 433 FSDGKPRFIQIKGINIDAEIGRHMLYTTNEDVPGIIGLLGMTMGKNSVNIANFTLGRSGV 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            + AI+ L +D  I   V++ L      + VK  EF+V
Sbjct: 493 GQDAIAILYLDQRIDPKVVDTLESTGLFQQVKALEFDV 530


>gi|154252585|ref|YP_001413409.1| D-3-phosphoglycerate dehydrogenase [Parvibaculum lavamentivorans
           DS-1]
 gi|154156535|gb|ABS63752.1| D-3-phosphoglycerate dehydrogenase [Parvibaculum lavamentivorans
           DS-1]
          Length = 525

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 56/97 (57%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFS G PR I+I+ +N +  +GR M+ + N D  G +  +G+ LG+ GINIA+F+LGR +
Sbjct: 429 VFSGGLPRLIQIKSVNMEAALGRHMLYVTNLDKPGFIGALGSTLGKAGINIANFNLGREK 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI  + +D  +  + L ++     +  VK   F
Sbjct: 489 AGGDAICLIEVDADVPAATLAEIQALPHVVQVKALSF 525


>gi|46201295|ref|ZP_00208046.1| COG0111: Phosphoglycerate dehydrogenase and related dehydrogenases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 526

 Score =  140 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   K R ++I+ I+ + ++G  M+ + N D  G +  +G +LG  G+NIA FHLGRS+
Sbjct: 429 LFGGDKARVVEIKGISIEAELGSHMLYVTNQDKPGFIGALGTLLGANGVNIATFHLGRSE 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI    +D  + N +LEK+     +   K   F
Sbjct: 489 AGGDAILLTQVDQPVSNELLEKVRALPQVVQAKFLTF 525


>gi|154245150|ref|YP_001416108.1| D-3-phosphoglycerate dehydrogenase [Xanthobacter autotrophicus Py2]
 gi|154159235|gb|ABS66451.1| D-3-phosphoglycerate dehydrogenase [Xanthobacter autotrophicus Py2]
          Length = 528

 Score =  140 bits (354), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+PR + I+ IN D +    MI + N D  G +     +LG+ G+NIA F LGR  
Sbjct: 432 VFADGRPRIVNIKGINVDAEFAPSMIYVTNEDKPGFIGRFAGLLGDAGLNIATFALGRDH 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   VL K+     ++  K   F
Sbjct: 492 LGGDAIALVAVDGTVPADVLGKVQALPQVKAAKALAF 528


>gi|220926557|ref|YP_002501859.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium nodulans ORS
           2060]
 gi|219951164|gb|ACL61556.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium nodulans ORS
           2060]
          Length = 531

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DG PR ++I+ I  +      M+ + NAD  G +   G +LGE G+N+A FHLGR +
Sbjct: 435 VFHDGVPRTVEIRSIPLEAAFAPHMLYVRNADQPGFIGRFGTLLGEAGVNVATFHLGRDR 494

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI F+ +D  +  ++L ++     ++  +   F
Sbjct: 495 PGGDAICFVAVDQPVSPALLRQIEAIPQVKRARAVRF 531


>gi|170744437|ref|YP_001773092.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium sp. 4-46]
 gi|168198711|gb|ACA20658.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium sp. 4-46]
          Length = 531

 Score =  140 bits (353), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DG PR ++I+ I  +      M+ + NAD  G +   G +LGE G+N+A FHLGR +
Sbjct: 435 VFQDGVPRIVEIRSIPLEAAFAPHMLYVRNADQPGFIGRFGTLLGEAGVNVATFHLGRDR 494

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI F  +D  +  ++L ++     ++  +   F
Sbjct: 495 PGGDAICFAAVDQPVSPALLRQIEAIPQVKRARAVRF 531


>gi|114769879|ref|ZP_01447489.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium HTCC2255]
 gi|114549584|gb|EAU52466.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium HTCC2255]
          Length = 529

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 59/99 (59%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N DI GI+  +G  +GEY +NIA+F LGR  
Sbjct: 431 VFSDGKPRFIQIKGINIDAEVGSHMLYTTNKDIPGIIGTLGQTMGEYDVNIANFTLGRKN 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D +   + ++ L      + V   +F V
Sbjct: 491 TGGDAIALLYLDCAPNQNAMDSLQKTGIFQTVSALKFEV 529


>gi|144897885|emb|CAM74749.1| D-3-phosphoglycerate dehydrogenase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 525

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 54/97 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   KPR + I+ I  + ++G  M+ + N D  G +  +G++LG  G+NIA FHLGRS+
Sbjct: 429 LFGGDKPRVVAIKGIPIEAELGSHMLYVTNQDKPGFIGALGSLLGARGVNIATFHLGRSE 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI    +D  + +++L+++     +   K   F
Sbjct: 489 AGGDAILLTQVDQPLTDAILDEVKALPHVVQAKALNF 525


>gi|27382512|ref|NP_774041.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium japonicum USDA
           110]
 gi|27355684|dbj|BAC52666.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium japonicum USDA
           110]
          Length = 529

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V+ DGKPR + ++ I  D + G+ MI + N D  G +    ++LG   +NIA FHLGR +
Sbjct: 433 VYHDGKPRLVDVKGIRVDAEFGKSMIYVTNEDKPGFIGAFASLLGAAKLNIATFHLGRVK 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   VL K+     ++  K   F
Sbjct: 493 LGGDAIALVEVDGAVPADVLAKVQALPQVKQAKALTF 529


>gi|217977556|ref|YP_002361703.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
 gi|217502932|gb|ACK50341.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
          Length = 528

 Score =  138 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I I  I  D  +G  M+ + N D  G +    +ILG  GINIA F LGR +
Sbjct: 432 VFNDGKPRIIMINGIKVDAAVGPSMVYVTNEDRPGFIGRFASILGNAGINIATFALGRDR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               +I+ + +D ++   VL+ +     ++  K   F
Sbjct: 492 EGGSSIALVEVDENVPEKVLDAVRRLPGVKEAKALRF 528


>gi|240137235|ref|YP_002961704.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens AM1]
 gi|240007201|gb|ACS38427.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens AM1]
          Length = 535

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ IN D     LM+ + N D  G V   G +LGE G+N+A F +GR  
Sbjct: 439 VFNDGKPRVIEIRGINIDAPFAPLMLYVRNHDRPGFVGSFGTVLGEAGVNLATFAMGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIEAIPQVKRVRPVRF 535


>gi|254559246|ref|YP_003066341.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens DM4]
 gi|254266524|emb|CAX22288.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens DM4]
          Length = 535

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ IN D     LM+ + N D  G V   G +LGE G+N+A F +GR  
Sbjct: 439 VFNDGKPRVIEIRGINIDAPFAPLMLYVRNHDRPGFVGSFGTVLGEAGVNLATFAMGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIEAIPQVKRVRPVRF 535


>gi|163850102|ref|YP_001638145.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium extorquens
           PA1]
 gi|163661707|gb|ABY29074.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium extorquens
           PA1]
          Length = 535

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ IN D     LM+ + N D  G V   G +LGE G+N+A F +GR  
Sbjct: 439 VFNDGKPRVIEIRGINIDAPFAPLMLYVRNHDRPGFVGSFGTVLGEAGVNLATFAMGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIEAIPQVKRVRPVRF 535


>gi|218528706|ref|YP_002419522.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium
           chloromethanicum CM4]
 gi|218521009|gb|ACK81594.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium
           chloromethanicum CM4]
          Length = 535

 Score =  138 bits (349), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ IN D     LM+ + N D  G V   G +LGE G+N+A F +GR  
Sbjct: 439 VFNDGKPRVIEIRGINIDAPFAPLMLYVRNHDRPGFVGSFGTVLGEAGVNLATFAMGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIEAIPQVKRVRPVRF 535


>gi|254473015|ref|ZP_05086413.1| phosphoglycerate dehydrogenase [Pseudovibrio sp. JE062]
 gi|211957736|gb|EEA92938.1| phosphoglycerate dehydrogenase [Pseudovibrio sp. JE062]
          Length = 532

 Score =  137 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D KPR I+I+ IN + ++G  M+ + N D  G +  +G+ILG+  INIA F+LGR  
Sbjct: 432 VFGDQKPRIIQIKGINMEAELGENMLYVTNQDKPGFIGQLGSILGDAKINIATFNLGRKV 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E AI  + IDG I  + + +++    +   K   F
Sbjct: 492 EGEEAICLVEIDGEIAEATVNEIAAIEQVNQAKLLHF 528


>gi|83312292|ref|YP_422556.1| D-3-phosphoglycerate dehydrogenase [Magnetospirillum magneticum
           AMB-1]
 gi|82947133|dbj|BAE51997.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Magnetospirillum magneticum AMB-1]
          Length = 526

 Score =  137 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   K R ++I+ I+ + ++G+ M+ + N D  G +  +G++LG  G+NIA FHLGRS+
Sbjct: 429 LFGGNKARVVEIKGISIEAELGQNMLYVTNQDKPGFIGALGSLLGANGVNIATFHLGRSE 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI    +D  + N +LEK+     +   K   F
Sbjct: 489 AGGDAILLTQVDQPVSNDLLEKVRALPQVVQAKFLTF 525


>gi|326389093|ref|ZP_08210675.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206693|gb|EGD57528.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 528

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +G+PR ++I +I  + D+   M+ IVN D  G +  +G +LG+  INI  FHLGR Q
Sbjct: 431 LFGNGQPRLVEIFDIAVEADLDGDMLYIVNTDAPGFIGSIGTLLGQSNINIGTFHLGRRQ 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  + + VL K      +R VK  +F
Sbjct: 491 AGGEAVLLLSVDSPVSDEVLAKAKTLNGVRLVKALKF 527


>gi|182678253|ref|YP_001832399.1| D-3-phosphoglycerate dehydrogenase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634136|gb|ACB94910.1| D-3-phosphoglycerate dehydrogenase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 529

 Score =  135 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DGKPR I I +I  D  +  +MI + N D  G +    ++LG   +NIA F LGR +
Sbjct: 433 VFHDGKPRIIAINDIKIDAAVAPVMIYVSNEDKPGFIGRFASLLGNASVNIATFALGRDR 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++  SV  ++     ++ VK   F
Sbjct: 493 EGGSAIALVEVDGAVPESVQNEVKALPGVKKVKALAF 529


>gi|325284843|ref|YP_004264305.1| D-3-phosphoglycerate dehydrogenase [Deinococcus proteolyticus MRP]
 gi|324316558|gb|ADY27670.1| D-3-phosphoglycerate dehydrogenase [Deinococcus proteolyticus MRP]
          Length = 534

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 58/99 (58%), Gaps = 1/99 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ G++  +G  LG+ G+NIA+F LGRS 
Sbjct: 437 VFSDGKPRFIQIRGINLDAEVGEHMLYTRNRDVPGVIGSLGTALGDLGVNIANFTLGRSA 496

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ + +D  +  +  + L  +     V+   F +
Sbjct: 497 Q-GDAIAIIYLDEPLPAAAAQALRDSGKFIQVRPLHFEL 534


>gi|149186566|ref|ZP_01864878.1| phosphoglycerate dehydrogenase [Erythrobacter sp. SD-21]
 gi|148829793|gb|EDL48232.1| phosphoglycerate dehydrogenase [Erythrobacter sp. SD-21]
          Length = 537

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I  +  + ++   M+ IVN D  G +  +G++LGE GINI  F+LGR  
Sbjct: 441 LFGADAPRLVEIFGVRIEAELDGHMLYIVNEDAPGFIGRIGSLLGENGINIGTFNLGRRA 500

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  I N V++K      ++ V    F
Sbjct: 501 AGGEAVLLLSVDQPIPNEVVKKACALEGVKTVMPLAF 537


>gi|85373221|ref|YP_457283.1| D-3-phosphoglycerate dehydrogenase [Erythrobacter litoralis
           HTCC2594]
 gi|84786304|gb|ABC62486.1| phosphoglycerate dehydrogenase [Erythrobacter litoralis HTCC2594]
          Length = 527

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I  +  +  +   M+ IVN D  G +  +G +LGE+GINI  F+LGR  
Sbjct: 431 LFGSDAPRLVEIFGVRIEAQLEGHMLYIVNEDAPGFIGRIGTLLGEHGINIGTFNLGRRS 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  I   V++       ++ V    F
Sbjct: 491 AGGEAVLLLSVDQPIPQDVVKAACALDGVKTVMPLSF 527


>gi|188579907|ref|YP_001923352.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium populi BJ001]
 gi|179343405|gb|ACB78817.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium populi BJ001]
          Length = 535

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ I  D     LM+ + N D  G V   G++LG+ G+N+A F LGR  
Sbjct: 439 VFNDGKPRVIEIRGIGIDAPFAPLMLYVRNHDKPGFVGSFGSVLGDAGVNLATFALGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIETIPQVKRVRLVRF 535


>gi|87200693|ref|YP_497950.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87136374|gb|ABD27116.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 540

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +G+PR ++I  I  + D+   M+ IVN+D  G +  +G +LG+  INI  FHLGR +
Sbjct: 443 LFGNGQPRLVEIFGIGIEADLDGDMLYIVNSDAPGFIGRIGTLLGQNTINIGTFHLGRRE 502

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +   VL++      +R VK  +F
Sbjct: 503 AGGEAVLLLSLDNPVSEDVLKEAREIQGVRVVKALKF 539


>gi|148261633|ref|YP_001235760.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|326405123|ref|YP_004285205.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium multivorum AIU301]
 gi|146403314|gb|ABQ31841.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|325051985|dbj|BAJ82323.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium multivorum AIU301]
          Length = 528

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   KPR ++++ I  + D GR M+ + N D  G +     IL E GINIA FHLGR++
Sbjct: 432 LFGGAKPRLVEVKGIKVEADFGRHMLYVTNRDKPGFIAQCSAILAEKGINIATFHLGRTE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  + ID ++ +  L  +     +    Q  F
Sbjct: 492 KGGDAVCLISIDETLPDDALAAIRALPQVMQATQISF 528


>gi|217977921|ref|YP_002362068.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
 gi|217503297|gb|ACK50706.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
          Length = 531

 Score =  134 bits (338), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF  GKPR I +  I  D  +  +MI + N D  G V    +ILG  G+NIA F LGR +
Sbjct: 432 VFHAGKPRIISVNGIEVDAVVAPVMIYVSNDDKPGFVGRFTSILGAAGLNIATFALGRDR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++ + +DG++ + VL  +     +R VK   F
Sbjct: 492 EGGSAVALIAVDGAVPDEVLADIRAAPGVREVKALHF 528


>gi|209965081|ref|YP_002297996.1| D-3-phosphoglycerate dehydrogenase [Rhodospirillum centenum SW]
 gi|209958547|gb|ACI99183.1| D-3-phosphoglycerate dehydrogenase [Rhodospirillum centenum SW]
          Length = 525

 Score =  133 bits (336), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 57/97 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   KPR ++I+++  + ++   M+ I N D  G +  +G  LG+ G+NIA FHLGR+ 
Sbjct: 429 LFGGDKPRLVEIEDVPIEAEVTPNMLFIRNEDKPGFIGKLGTALGDAGVNIATFHLGRTA 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + E AI+ +C+D  + + ++E++    ++   K   F
Sbjct: 489 AGETAIALVCVDQPLGDDLVERIRALPSVVRAKALTF 525


>gi|323135941|ref|ZP_08071024.1| D-3-phosphoglycerate dehydrogenase [Methylocystis sp. ATCC 49242]
 gi|322399032|gb|EFY01551.1| D-3-phosphoglycerate dehydrogenase [Methylocystis sp. ATCC 49242]
          Length = 528

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DGKPR  +I +I  D +    MI   N D  G +     +LGE  +NIA F LGR  
Sbjct: 432 VFHDGKPRIARIGDIGIDAEFAPSMIYTENEDRPGFIGRFAGLLGEAKVNIATFALGRDM 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++ + IDG +   VL  +     ++      F
Sbjct: 492 PGGCAVALVAIDGELPEDVLAAIRDLPGVKQALTLRF 528


>gi|116071264|ref|ZP_01468533.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. BL107]
 gi|116066669|gb|EAU72426.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. BL107]
          Length = 528

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G+++GE+ +NIA   +GR  
Sbjct: 432 VFADGELRITSIDEFPVNVSPSRHMLFTRHRDMPGIIGHLGSMMGEHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I   +L+K++    I+       
Sbjct: 492 VRGDAVMVLSIDDPIPAELLQKITAIDGIQEAHPVTL 528


>gi|312115664|ref|YP_004013260.1| D-3-phosphoglycerate dehydrogenase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220793|gb|ADP72161.1| D-3-phosphoglycerate dehydrogenase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 526

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPR I+I  +  D +    M+  VNAD  G +  +G +LG+ G+NIA F+LGR  
Sbjct: 430 VFSDGKPRVIQINHVPMDAEFAPNMLFTVNADKPGHIGALGTLLGDEGVNIATFNLGREA 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++ + +D  + ++ ++K      +    +  F
Sbjct: 490 QGGKAMALVTVDEPVSDATIQKALALPHVVRAARLSF 526


>gi|78184104|ref|YP_376539.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9902]
 gi|78168398|gb|ABB25495.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9902]
          Length = 528

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G+++GE+ +NIA   +GR  
Sbjct: 432 VFADGELRITSIDEYPVNVSPSRHMLFTRHRDMPGIIGHLGSMMGEHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I   +L+K++    I+       
Sbjct: 492 VRGDAVMVLSIDDPIPADLLQKITAIDGIQEAHPVTL 528


>gi|294678963|ref|YP_003579578.1| phosphoglycerate dehydrogenase [Rhodobacter capsulatus SB 1003]
 gi|294477783|gb|ADE87171.1| phosphoglycerate dehydrogenase [Rhodobacter capsulatus SB 1003]
          Length = 531

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 62/98 (63%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++GR M+   N D+ GI+  +G +LGE  +N+A+F LGR+ +
Sbjct: 433 FSDGKPRFIQIKGINVDAEVGRHMLYTTNKDVPGIIGKLGTLLGENKVNLANFTLGRAAA 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+   +D ++   V+ +L      + VK  EFN+
Sbjct: 493 GGEAIAIAYLDEALDAKVVSELEATGLFQQVKPLEFNI 530


>gi|307294836|ref|ZP_07574678.1| D-3-phosphoglycerate dehydrogenase [Sphingobium chlorophenolicum
           L-1]
 gi|306879310|gb|EFN10528.1| D-3-phosphoglycerate dehydrogenase [Sphingobium chlorophenolicum
           L-1]
          Length = 526

 Score =  130 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + +PR +++  I  + D+   M+ IVN D  G +  +G+ LGE  +NI  FHLGR  
Sbjct: 429 LFGNAQPRLVELFGIKVEADLAGDMLYIVNQDAPGFIGRLGSTLGEANVNIGTFHLGRRN 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +DG++  +VL  +     ++ VK   F
Sbjct: 489 QGGEAVLLLSLDGAVSEAVLSDICKLAGVKTVKLLRF 525


>gi|258511215|ref|YP_003184649.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477941|gb|ACV58260.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 529

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 50/97 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +  PR +++     D  I  ++I   + D  G++  +G +LG+  INIA   +GR +
Sbjct: 433 VLGEYGPRIVELDGYPIDTPIQGILIYTRHEDRPGMIGRIGTLLGDRDINIAGMQVGRRE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +   V+++++ +  IR V+  E 
Sbjct: 493 TGGEAVMLLSVDKRVPQDVIDEIAKHPGIRLVRAIEL 529


>gi|163796990|ref|ZP_02190946.1| Phosphoglycerate dehydrogenase and related dehydrogenase [alpha
           proteobacterium BAL199]
 gi|159177737|gb|EDP62288.1| Phosphoglycerate dehydrogenase and related dehydrogenase [alpha
           proteobacterium BAL199]
          Length = 525

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 51/95 (53%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
              KPR +++Q I  + D GR M+ + N D  G +  +G+ LG +G+NIA FHLGR    
Sbjct: 431 GGTKPRLVEVQGIAIEADFGRHMLYVRNYDKPGFIGALGSALGNHGVNIATFHLGRRDVG 490

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             AI+ + +D +I  ++L ++     +  V    F
Sbjct: 491 GEAIALVEVDQAIDAALLTEVQSLPHVVRVNALSF 525


>gi|258593832|emb|CBE70173.1| D-3-phosphoglycerate dehydrogenase [NC10 bacterium 'Dutch
           sediment']
          Length = 526

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 51/96 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +FS  +PR ++I E   +      ++   N D+ G++  +G +LG++ +NIA   LGR Q
Sbjct: 430 LFSRREPRVVRINEFRLEAIPEGYLLIFSNLDVPGVIGTIGTLLGKHRVNIAGMQLGREQ 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               A+S + +D  +   V++++     I FVK  +
Sbjct: 490 PGGRAVSVVNVDNPVPAHVIDEIRRLPNIVFVKLVK 525


>gi|148557578|ref|YP_001265160.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas wittichii RW1]
 gi|148502768|gb|ABQ71022.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas wittichii RW1]
          Length = 525

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 54/97 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F++ +PR ++I  +  + D+G  M+ IVN D  G +  +G+ LGE  +NI  FHLGR  
Sbjct: 429 LFANAEPRLVEIYGVKVEADLGGTMLYIVNVDAPGFIGRLGSTLGEANVNIGTFHLGRRS 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  + +++  K++    ++  K   F
Sbjct: 489 AGGEAVLLLSVDTPVDDALKAKIAQLPGVKTAKALSF 525


>gi|218289859|ref|ZP_03494049.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239999|gb|EED07185.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 529

 Score =  130 bits (328), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +  PR +++     D  I  ++I   + D  G++  +G +LG+  INIA   +GR +
Sbjct: 433 VLGEYGPRIVELDGYPIDTPIQGILIYTRHEDRPGMIGRIGTLLGDRDINIAGMQVGRRE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D S+   V+++++ +  IR V+  E 
Sbjct: 493 TGGEAVMLLSVDKSVPQDVIDEIAKHPGIRLVRSIEL 529


>gi|262276980|ref|ZP_06054773.1| phosphoglycerate dehydrogenase [alpha proteobacterium HIMB114]
 gi|262224083|gb|EEY74542.1| phosphoglycerate dehydrogenase [alpha proteobacterium HIMB114]
          Length = 526

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 46/95 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
            GKPR + ++ I  + ++ +  + I N D  G +  +  IL +  INIA F+LGR  S  
Sbjct: 431 GGKPRIVNVKGIKIEAELAKHNLYISNEDKPGFISNLSKILSDNNINIATFNLGRKDSGG 490

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            AI+ +  D  I   VL+ +     +   K   FN
Sbjct: 491 EAIALISTDNPIEEKVLDGIKKLPLVIQAKTLTFN 525


>gi|33865069|ref|NP_896628.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 8102]
 gi|33638753|emb|CAE07048.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 8102]
          Length = 528

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V     M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRITSIDEFPVNVTPSSHMLFTRHRDMPGIIGQLGSMLGEHNVNIAAMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++L+ ++    I+       
Sbjct: 492 VRGDAVMVLSIDDPIPAALLQTITAIEGIQEAHPVSL 528


>gi|116073644|ref|ZP_01470906.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9916]
 gi|116068949|gb|EAU74701.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9916]
          Length = 528

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTTIDEFPVNVPPSRHMLFTRHRDMPGIIGQLGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++L  ++    I+       
Sbjct: 492 VRGDAVMVLSIDDPIPPTLLANINAIDGIQEAHPVTL 528


>gi|296284464|ref|ZP_06862462.1| D-3-phosphoglycerate dehydrogenase [Citromicrobium bathyomarinum
           JL354]
          Length = 528

 Score =  130 bits (327), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I  I  + ++   MI +VN D  G +  +G++LG  GINI  F+LGR Q
Sbjct: 432 LFGREAPRLVEIFGIGIEAELDGHMIYVVNDDAPGFIGRIGSLLGNRGINIGTFNLGRKQ 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  + ++++ +      +R V    F
Sbjct: 492 AGGEAVLLLSLDQPVDDALIAEAEALEGVRTVTALSF 528


>gi|103486109|ref|YP_615670.1| D-3-phosphoglycerate dehydrogenase [Sphingopyxis alaskensis RB2256]
 gi|98976186|gb|ABF52337.1| D-3-phosphoglycerate dehydrogenase [Sphingopyxis alaskensis RB2256]
          Length = 528

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + +PR +++  I  + D+   M+ IVN D  G +  +G+ LG+ G+NI  FHLGR  
Sbjct: 432 LFGNNEPRLVEMFGIKVEADLDGDMLYIVNEDAPGFIGRIGSTLGDAGLNIGTFHLGRRA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +   +L ++     ++ VK  +F
Sbjct: 492 AGGEAVLLLSLDSPMPEPLLWQVCQLPGVKMVKGLKF 528


>gi|322419774|ref|YP_004198997.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M18]
 gi|320126161|gb|ADW13721.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M18]
          Length = 532

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 49/92 (53%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +K+++   D      M+ +  AD  GI+  +G ILG++ INIA  +LGR +   
Sbjct: 435 EGIPRIVKLRDYQMDFRPEEHMLLLAYADRPGIIGKIGTILGKHEINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            A+  L +D ++   V+E++       F+K  
Sbjct: 495 EAMVILSLDSAVPADVVEEVREATDATFIKPL 526


>gi|87123644|ref|ZP_01079494.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9917]
 gi|86168213|gb|EAQ69470.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9917]
          Length = 528

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRVTSIDEFPVNVPPSRHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  S+L  +     I+       
Sbjct: 492 VRGDAVMVLSIDDPIPPSLLATIHAINGIQEAHPVTL 528


>gi|85707813|ref|ZP_01038879.1| phosphoglycerate dehydrogenase [Erythrobacter sp. NAP1]
 gi|85689347|gb|EAQ29350.1| phosphoglycerate dehydrogenase [Erythrobacter sp. NAP1]
          Length = 534

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I  I  + D+   M+ +VN D  G +  +G +LG  GINI  F+LGR  
Sbjct: 438 LFGKDAPRLVEIFGIGIEADLDGNMLYVVNDDKPGFIGRIGTLLGSQGINIGTFNLGRRD 497

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D      V+ +      ++ VK   F
Sbjct: 498 AGGEAVLLLSLDDEPSADVMAEAEKVEGVKMVKALSF 534


>gi|332188569|ref|ZP_08390288.1| phosphoglycerate dehydrogenase [Sphingomonas sp. S17]
 gi|332011413|gb|EGI53499.1| phosphoglycerate dehydrogenase [Sphingomonas sp. S17]
          Length = 516

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F D  PR +++  I  + D+   M+ +VN D  G +  +G  LGE G+NI  FHLGR  
Sbjct: 420 LFGDQAPRLVELFGIKVEADLAGPMLYVVNEDAPGFIGRLGTTLGEAGVNIGTFHLGRRS 479

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D ++   +L K+     ++      F
Sbjct: 480 AGGEAVLLLSVDEAVDAELLAKVKSLPGVKTAMGLVF 516


>gi|88807419|ref|ZP_01122931.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7805]
 gi|88788633|gb|EAR19788.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7805]
          Length = 528

 Score =  129 bits (325), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTNIDEFPVNVPPSRHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++L  +     I+       
Sbjct: 492 VRGDAVMVLSIDDPIPPALLATIHGINGIQEAHPVTL 528


>gi|148242943|ref|YP_001228100.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. RCC307]
 gi|147851253|emb|CAK28747.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. RCC307]
          Length = 528

 Score =  128 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRITSIDEFPLNVPPSRHMLFTRHRDMPGIIGNLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  I +S L  +     I+       
Sbjct: 492 VRGDAVMVLSLDDPIPSSTLTSVKDINGIQEAHPVTL 528


>gi|260434318|ref|ZP_05788288.1| phosphoglycerate dehydrogenase [Synechococcus sp. WH 8109]
 gi|260412192|gb|EEX05488.1| phosphoglycerate dehydrogenase [Synechococcus sp. WH 8109]
          Length = 528

 Score =  128 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I     +V     M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRITSIDAFPVNVTPSSHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I   +L+ ++    I+       
Sbjct: 492 VRGDAVMVLSIDDPIPADLLQTITAIDGIQEAHPVTL 528


>gi|294010170|ref|YP_003543630.1| D-3-phosphoglycerate dehydrogenase [Sphingobium japonicum UT26S]
 gi|292673500|dbj|BAI95018.1| D-3-phosphoglycerate dehydrogenase [Sphingobium japonicum UT26S]
          Length = 526

 Score =  128 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + +PR +++  I  + D+   M+ IVN D  G +  +G+ LGE  +NI  FHLGR  
Sbjct: 429 LFGNAQPRLVELFGIKVEADLAGDMLYIVNQDAPGFIGRLGSTLGEAQVNIGTFHLGRRN 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +DG++  +VL  +     ++ VK   F
Sbjct: 489 QGGEAVLLLSLDGAVNEAVLSDICKLAGVKTVKLLRF 525


>gi|78213665|ref|YP_382444.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9605]
 gi|78198124|gb|ABB35889.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9605]
          Length = 528

 Score =  128 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I     +V     M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRITSIDAFPVNVTPSSHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I   +L+ ++    I+       
Sbjct: 492 VRGDAVMVLSIDDPIPADLLQTITAIDGIQEAHPVTL 528


>gi|39996300|ref|NP_952251.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens PCA]
 gi|39983180|gb|AAR34574.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens PCA]
 gi|298505310|gb|ADI84033.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens KN400]
          Length = 542

 Score =  128 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 51/93 (54%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++ + D      M+ +  AD  G++  +G I+G++ INIA  +LGRS+   
Sbjct: 436 EGLPRIVRLRDYSMDFAPEEHMLLLHYADRPGMIGKIGTIMGQHEINIASMNLGRSEKKG 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  L +D ++   VLE++       F+K   
Sbjct: 496 EAMVILSLDSAVPPQVLEEVRAATDATFIKAIH 528


>gi|318042229|ref|ZP_07974185.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CB0101]
          Length = 528

 Score =  128 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRITTIDEFPVNVAPSRHMLFTRHRDMPGIIGNLGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  +  S+L  +     I+       
Sbjct: 492 VRGDAVMVLSLDDPLPASLLATIHGIEGIQEAHPVTL 528


>gi|317969029|ref|ZP_07970419.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CB0205]
          Length = 528

 Score =  128 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E    V   + M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTTIDEFPVSVTPSKHMLFTRHRDMPGIIGHIGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  +   +L  +     I+       
Sbjct: 492 VRGDAVMVLSLDDPLPADLLAGIHAIEGIQQAHPVTL 528


>gi|148240317|ref|YP_001225704.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7803]
 gi|147848856|emb|CAK24407.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7803]
          Length = 528

 Score =  128 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTNIDEFPVNVPPSRHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++L  +     I+       
Sbjct: 492 VRGDAVMVLSIDDPIPPALLATIHGINGIQEAHPVTL 528


>gi|114800302|ref|YP_761802.1| D-3-phosphoglycerate dehydrogenase [Hyphomonas neptunium ATCC
           15444]
 gi|114740476|gb|ABI78601.1| D-3-phosphoglycerate dehydrogenase [Hyphomonas neptunium ATCC
           15444]
          Length = 531

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/93 (34%), Positives = 54/93 (58%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GKPR ++++ +  + D   + + + N D  G +  +G +LGE  +NIA FHLGR ++   
Sbjct: 439 GKPRIVEVKGMALEGDFSPVTLYVNNIDKPGFIGALGQMLGEAKVNIATFHLGRQEAGGE 498

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI+ + ID +   S++EKL     +R+VK   F
Sbjct: 499 AIALIGIDSTPPASLVEKLDALPQVRYVKVLSF 531


>gi|33863698|ref|NP_895258.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9313]
 gi|33635281|emb|CAE21606.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9313]
          Length = 532

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++G  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 436 VFANGDLRITTIDEFPVNVSPSRHMLLTRHRDMPGIIGQLGSVLGEHNVNIASMQVGRRI 495

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  S+L  +     I+       
Sbjct: 496 VRGDAVMVLSIDDPIPPSLLVTIHAINGIKEAHPVTL 532


>gi|124022234|ref|YP_001016541.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9303]
 gi|123962520|gb|ABM77276.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9303]
          Length = 528

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++G  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFANGDLRITTIDEFPVNVSPSRHMLLTRHRDMPGIIGQLGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  S+L  +     I+       
Sbjct: 492 VRGDAVMVLSIDDPIPPSLLVTIHAINGIKEAHPVTL 528


>gi|288819163|ref|YP_003433511.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
 gi|288788563|dbj|BAI70310.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
 gi|308752746|gb|ADO46229.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
          Length = 530

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/95 (34%), Positives = 50/95 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V     PR  +I     DV+   +M+   N D+ G++  VG+ILG+ G+NIA F LGR +
Sbjct: 434 VLEGHVPRIFRIDNYRVDVEPEGIMLIFENKDVPGVIGKVGSILGDAGVNIAGFRLGREK 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
               A+  L +D  +   +L +LS    + FVKQ 
Sbjct: 494 RGGIALGILNLDDPVPEEILHELSKLPEVLFVKQV 528


>gi|239827548|ref|YP_002950172.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. WCH70]
 gi|239807841|gb|ACS24906.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. WCH70]
          Length = 525

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 47/89 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +       D      ++ I + D  G++  VGN+LGE+ +NIA   +GR Q+   AI 
Sbjct: 435 RIVHFDGFTIDFAPDGHLLYIQHQDRPGMIGKVGNVLGEHQVNIATMQVGREQAGGKAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  I +++L+KL+    I  VK+ E
Sbjct: 495 MLSLDKPIDDALLQKLAEIEDIETVKRLE 523


>gi|167629222|ref|YP_001679721.1| d-3-phosphoglycerate dehydrogenase [Heliobacterium modesticaldum
           Ice1]
 gi|167591962|gb|ABZ83710.1| d-3-phosphoglycerate dehydrogenase [Heliobacterium modesticaldum
           Ice1]
          Length = 526

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 48/93 (51%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            KPRF+ I   + D+     M+ + + D   I+  +G I+GE+ +NIA  HLGR     +
Sbjct: 433 NKPRFVSIDGYDMDMAPEGHMLVVPHTDKPRIIGQLGTIIGEHNVNIAGMHLGRKDFGGN 492

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           A++ L IDG +  +VL  L+    +  VK    
Sbjct: 493 AVAILTIDGPVPAAVLTDLAKIDGVADVKYVNL 525


>gi|312110403|ref|YP_003988719.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y4.1MC1]
 gi|311215504|gb|ADP74108.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y4.1MC1]
          Length = 524

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 47/89 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +       D      ++ I + D  G++  VGNILGE+ INIA   +GR Q+   AI 
Sbjct: 435 RIVHFDGFTIDFAPEGHLLYIQHQDRPGMIGKVGNILGEHQINIATMQVGRQQAGGKAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  I +++L+KL+    I  VK+ E
Sbjct: 495 MLSLDKPIDDALLQKLTEIEDIETVKRVE 523


>gi|113954952|ref|YP_731454.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9311]
 gi|113882303|gb|ABI47261.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9311]
          Length = 528

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRVTSIDEFPVNVPPSRHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++L  +     I+       
Sbjct: 492 VRGDAVMVLSIDDPIPPALLTTIHGINGIQEAHPVTL 528


>gi|222056517|ref|YP_002538879.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. FRC-32]
 gi|221565806|gb|ACM21778.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. FRC-32]
          Length = 540

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 50/93 (53%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++ + D      M+ +   D  G++  +G I+G +GINIA  +LGR +   
Sbjct: 436 EGAPRIVRLRDYSMDFAPDEHMLLLNYTDRPGMIGQIGTIMGTHGINIASMNLGRREKKG 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  L +D ++   V+E++   +   +++   
Sbjct: 496 EAMVILSLDSAVPPEVVEEMKTAIDATYIRAIH 528


>gi|295398990|ref|ZP_06808972.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294978456|gb|EFG54052.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 524

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 47/89 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +       D      ++ I + D  G++  VGNILGE+ INIA   +GR Q+   AI 
Sbjct: 435 RIVHFDGFTIDFAPEGHLLYIQHQDRPGMIGKVGNILGEHQINIATMQVGRQQAGGKAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  I +++L+KL+    I  VK+ E
Sbjct: 495 MLSLDKPIDDTLLQKLTEIEDIETVKRVE 523


>gi|159903950|ref|YP_001551294.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9211]
 gi|159889126|gb|ABX09340.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9211]
          Length = 528

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 432 VFADGDLRITCIDEFPVNVAPSRHMLFTRHRDMPGIIGKIGSLLGVHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I + +L+ +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPSELLKSILQIQGINEAHPVTL 528


>gi|94496033|ref|ZP_01302612.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas sp. SKA58]
 gi|94424725|gb|EAT09747.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas sp. SKA58]
          Length = 517

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 50/97 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   +PR +++  I  + D+G  M+ IVN D  G +  +G+ LGE  +NI  FHLGR  
Sbjct: 420 LFGHAQPRLVELFGIKVEADLGGTMLYIVNQDAPGFIGRLGSTLGEANVNIGTFHLGRRD 479

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +DG++   +  ++     +  VK   F
Sbjct: 480 QGGEAVLLLSVDGTVTEPLRWEICNLTGVNQVKLLRF 516


>gi|15614165|ref|NP_242468.1| D-3-phosphoglycerate dehydrogenase [Bacillus halodurans C-125]
 gi|10174219|dbj|BAB05321.1| D-3-phosphoglycerate dehydrogenase [Bacillus halodurans C-125]
          Length = 540

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 43/91 (47%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR +KI   N D      +I I + D  G++  +G +L E+ +NIA   +GR +    AI
Sbjct: 450 PRIVKINGFNVDFVPEGHLIYIQHNDRPGVIGKMGQLLAEHNVNIATMQVGRQEEGGDAI 509

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + +D    + V+E L     I F  + E 
Sbjct: 510 MMVAVDKVATDEVIEALKAVDEIHFADRIEL 540


>gi|254430175|ref|ZP_05043878.1| phosphoglycerate dehydrogenase [Cyanobium sp. PCC 7001]
 gi|197624628|gb|EDY37187.1| phosphoglycerate dehydrogenase [Cyanobium sp. PCC 7001]
          Length = 528

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTSIDEFPVNVTPSRHMLFTRHRDMPGIIGQIGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  I  S+L  ++    I+       
Sbjct: 492 VRGDAVMVLSLDDPIPTSLLACVNDIDGIQEAHPVTL 528


>gi|148265877|ref|YP_001232583.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
 gi|146399377|gb|ABQ28010.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
          Length = 539

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 46/92 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++   D      M+ +   D  G++  +G ILG   INIA  +LGR +   
Sbjct: 435 EGAPRIVRLRDYAMDFSPEGHMLLLNYIDRPGMIGRIGTILGTRDINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            A+  L +D ++   V+E+L       F++  
Sbjct: 495 EAMVILSLDSAVPPDVVEELRNATNATFIRPL 526


>gi|73662348|ref|YP_301129.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72494863|dbj|BAE18184.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 538

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 33/100 (33%), Positives = 49/100 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +   PR ++I +   D    R  + I + D  GIV   G ILGEYGINIA  HLGR  
Sbjct: 432 VLNGYGPRIVRINDYPVDFKPERHQLVINHNDRPGIVGRTGQILGEYGINIASMHLGRIN 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
              +A+  L ID  + + V++ L        ++  E  ++
Sbjct: 492 QGGNALMILSIDHPVTDDVIDGLYEIEGFNLIRSVELEIE 531


>gi|78779836|ref|YP_397948.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9312]
 gi|78713335|gb|ABB50512.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9312]
          Length = 528

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I N +L+ +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTIIEVEGITSANPVTL 528


>gi|78223581|ref|YP_385328.1| D-3-phosphoglycerate dehydrogenase [Geobacter metallireducens
           GS-15]
 gi|78194836|gb|ABB32603.1| D-3-phosphoglycerate dehydrogenase [Geobacter metallireducens
           GS-15]
          Length = 541

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 47/93 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +K+++   D      M+ +   D  G++  +G I+G + INIA  +LGR +   
Sbjct: 435 EGSPRIVKLRDYQVDFAPDEHMLSLTYEDRPGMIGKIGTIMGAHDINIASMNLGRREKRG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  L +D ++   V+E++       F+K   
Sbjct: 495 EAMVILSLDSAVPPFVVEEVRKATDATFIKPIH 527


>gi|196248716|ref|ZP_03147416.1| amino acid-binding ACT domain protein [Geobacillus sp. G11MC16]
 gi|196211592|gb|EDY06351.1| amino acid-binding ACT domain protein [Geobacillus sp. G11MC16]
          Length = 310

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 46/89 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +    +  D      ++ I + D  G++  VGNILG + +NIA   +GR ++   A+ 
Sbjct: 221 RIVHFDGVAIDFAPEGHLLYIQHQDRPGMIGKVGNILGAHDVNIATMQVGRQEAGGKAMM 280

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  + ++VL+ L+    I  VK+ E
Sbjct: 281 ILSLDKPVDDAVLKTLAQIDDIETVKRLE 309


>gi|253700874|ref|YP_003022063.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M21]
 gi|251775724|gb|ACT18305.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M21]
          Length = 532

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 47/92 (51%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +K+++   D      M+ +   D  GI+  +G ILG + INIA  +LGR +   
Sbjct: 435 EGIPRIVKLRDYQMDFRPEEHMLLMAYGDRPGIIGKIGTILGTHEINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            A+  L +D ++   V+E++       FVK  
Sbjct: 495 EAMVILSLDSAVTPEVVEEVRGATDATFVKPL 526


>gi|123969087|ref|YP_001009945.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           AS9601]
 gi|123199197|gb|ABM70838.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. AS9601]
          Length = 528

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I N +L+ +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTIIEVEGITNANPVTL 528


>gi|56420782|ref|YP_148100.1| D-3-phosphoglycerate dehydrogenase [Geobacillus kaustophilus
           HTA426]
 gi|56380624|dbj|BAD76532.1| phosphoglycerate dehydrogenase [Geobacillus kaustophilus HTA426]
          Length = 510

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 45/89 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +    +  D      ++ I + D  G++  VGN+LG + +NIA   +GR ++   A+ 
Sbjct: 421 RIVHFDGVAIDFAPEGHLLYIQHQDRPGMIGKVGNVLGAHDVNIATMQVGRQEAGGKAMM 480

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  + + VL+ L+    I  VK+ E
Sbjct: 481 ILSLDKPVDDEVLQALAQIDDIETVKRLE 509


>gi|289549238|ref|YP_003474226.1| D-3-phosphoglycerate dehydrogenase [Thermocrinis albus DSM 14484]
 gi|289182855|gb|ADC90099.1| D-3-phosphoglycerate dehydrogenase [Thermocrinis albus DSM 14484]
          Length = 530

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 48/95 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +   R ++I     DV+   +++   N D+ G++  VG+ILG   +NIA F LGR +
Sbjct: 434 VLEESLLRLVRIDSYMVDVEPEGILLIFENKDVPGVIGKVGSILGRANVNIAGFRLGREK 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
               A+  L +D  +   VL +L     I FV+Q 
Sbjct: 494 KGGIALGILNLDDPVPEEVLAELKAVPEIFFVRQV 528


>gi|148263798|ref|YP_001230504.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
 gi|146397298|gb|ABQ25931.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
          Length = 541

 Score =  125 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 49/93 (52%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++ + D      M+ +   D  G++  +G I+G + INIA  +LGR +   
Sbjct: 436 EGAPRIVRLRDYSMDFAPAEHMLLLNYEDRPGMIGKIGTIMGAHSINIASMNLGRREEKG 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  L +D ++   V+E++ +     F++   
Sbjct: 496 EAMVILSLDSAVPLEVMEEVRIATEATFIRAIH 528


>gi|261417914|ref|YP_003251596.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC61]
 gi|297529583|ref|YP_003670858.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. C56-T3]
 gi|319767274|ref|YP_004132775.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC52]
 gi|261374371|gb|ACX77114.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC61]
 gi|297252835|gb|ADI26281.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. C56-T3]
 gi|317112140|gb|ADU94632.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC52]
          Length = 524

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 45/89 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +    +  D      ++ I + D  G++  VGN+LG + +NIA   +GR ++   A+ 
Sbjct: 435 RIVHFDGVAIDFAPEGHLLYIQHQDRPGMIGKVGNVLGAHDVNIATMQVGRQEAGGKAMM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  + + VL+ L+    I  VK+ E
Sbjct: 495 ILSLDKPVDDEVLQALAQIDDIETVKRLE 523


>gi|288556042|ref|YP_003427977.1| D-3-phosphoglycerate dehydrogenase [Bacillus pseudofirmus OF4]
 gi|288547202|gb|ADC51085.1| D-3-phosphoglycerate dehydrogenase [Bacillus pseudofirmus OF4]
          Length = 540

 Score =  125 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 43/89 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R + I   N D      ++ I + D  G++  +G +L E+ +NIA   +GR Q    AI 
Sbjct: 451 RIVSINGFNVDFVPQGHLLYIQHNDKPGVIGRIGQLLAEHDVNIATMQVGRKQEGGEAIM 510

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            + +D ++   VL+ +     I+F  + E
Sbjct: 511 MITVDKTVEEDVLKAVRKIEDIQFADKIE 539


>gi|212638896|ref|YP_002315416.1| D-3-phosphoglycerate dehydrogenase [Anoxybacillus flavithermus WK1]
 gi|212560376|gb|ACJ33431.1| Phosphoglycerate dehydrogenase [Anoxybacillus flavithermus WK1]
          Length = 549

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 46/91 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +       D      ++ I + D  G++  VGNILG++ +NIA   +GR ++   AI 
Sbjct: 435 RIVHFNGFAIDFAPEGHLLYIQHHDKPGMIGKVGNILGDHQVNIATMQVGRQEAGGKAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D  + ++++E L     I  VK+ E+ 
Sbjct: 495 MLSLDKPLDDALVETLEQISDIDVVKRLEYK 525


>gi|296445352|ref|ZP_06887310.1| D-3-phosphoglycerate dehydrogenase [Methylosinus trichosporium
           OB3b]
 gi|296257113|gb|EFH04182.1| D-3-phosphoglycerate dehydrogenase [Methylosinus trichosporium
           OB3b]
          Length = 528

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D +PR + I  +  +      MI + N D  G +     +LGE G+NIA   LGR +
Sbjct: 432 VFHDDEPRIVAIDGVRLETAFAPRMIFVSNEDRPGFMGLFAGLLGEAGVNIATCALGRDR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A + + +D       + +++    +RF    EF
Sbjct: 492 PGGSARALVGVDEPAPERAMARIAALPGVRFAAALEF 528


>gi|197118344|ref|YP_002138771.1| D-3-phosphoglycerate dehydrogenase [Geobacter bemidjiensis Bem]
 gi|197087704|gb|ACH38975.1| D-3-phosphoglycerate dehydrogenase [Geobacter bemidjiensis Bem]
          Length = 532

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 47/92 (51%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +K+++   D      M+ +   D  GI+  +G ILG + INIA  +LGR +   
Sbjct: 435 EGIPRIVKLRDYQMDFRPEEHMLLMAYGDRPGIIGKIGTILGTHEINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            A+  L +D ++   V+E++       FVK  
Sbjct: 495 EAMVILSLDSAVTPEVVEEVRGATDATFVKPL 526


>gi|46198894|ref|YP_004561.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB27]
 gi|46196518|gb|AAS80934.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB27]
          Length = 521

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V   G+PR + I +   +V     M+  VN D  G+V  VG +LGE G+NIA   LGR  
Sbjct: 425 VVIGGRPRLVGIDDYALEVVPEGYMLVCVNYDRPGVVGQVGTLLGEAGVNIAGMQLGRDV 484

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D      VLE L     +  V   E 
Sbjct: 485 PGGRALFVLTVDQKPSPEVLEALRALPVLERVDLVEL 521


>gi|330813822|ref|YP_004358061.1| D-3-phosphoglycerate dehydrogenase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486917|gb|AEA81322.1| D-3-phosphoglycerate dehydrogenase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 527

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 46/94 (48%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GKPR ++++ I  D  +    + I N D  G +  +  +L +  INI  F+LGR +S   
Sbjct: 432 GKPRIVEVKGIEIDAGLSAHNLYISNEDKPGFIRDLSKVLADNKINIGTFNLGRKKSGGE 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
           A++ +  D  I  +V+E +     +   K   FN
Sbjct: 492 AVALISTDSEIEKTVIESIKKIPLVIQAKYLSFN 525


>gi|55980921|ref|YP_144218.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB8]
 gi|55772334|dbj|BAD70775.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB8]
          Length = 521

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V   G+PR + I +   +V     M+  VN D  G+V  VG +LGE G+NIA   LGR  
Sbjct: 425 VVIGGRPRLVGIDDYALEVVPEGYMLVCVNYDRPGVVGQVGTLLGEAGVNIAGMQLGRDV 484

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D      VLE L     +  V   E 
Sbjct: 485 PGGRALFVLTVDQKPSPEVLEALRALPVLERVDLVEL 521


>gi|118580120|ref|YP_901370.1| D-3-phosphoglycerate dehydrogenase [Pelobacter propionicus DSM
           2379]
 gi|118502830|gb|ABK99312.1| D-3-phosphoglycerate dehydrogenase [Pelobacter propionicus DSM
           2379]
          Length = 539

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 49/95 (51%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++ + D      M+ +   D+ G++  +G I+G + INIA  +LGR +   
Sbjct: 435 EGAPRIVRLRDFSIDFSPEEHMLLLHYIDLPGMIGRIGTIMGTHDINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            A+  L +D ++   V+E++       F+K     
Sbjct: 495 EAMVILSLDSAVPLQVVEEIRTATDASFIKPLHLK 529


>gi|117924723|ref|YP_865340.1| D-3-phosphoglycerate dehydrogenase [Magnetococcus sp. MC-1]
 gi|117608479|gb|ABK43934.1| D-3-phosphoglycerate dehydrogenase [Magnetococcus sp. MC-1]
          Length = 527

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 56/97 (57%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+  +PR I + EI  +     L++ + N D  G++  VG +LGE G+NI+ FHLGR Q
Sbjct: 431 LFNGTEPRLISMDEIPIEAQPEGLLLFVANDDTPGLIGRVGTLLGEAGVNISSFHLGREQ 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI+F+ +D  +   ++++L     +R VK   +
Sbjct: 491 AGGRAIAFINVDSEVPAPLMQQLHETANVREVKLIRY 527


>gi|138895825|ref|YP_001126278.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermodenitrificans
           NG80-2]
 gi|134267338|gb|ABO67533.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermodenitrificans
           NG80-2]
          Length = 465

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 46/89 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +    +  D      ++ I + D  G++  VGNILG + +NIA   +GR ++   A+ 
Sbjct: 376 RIVHFDGVAIDFAPEGHLLYIQHQDRPGMIGKVGNILGAHDVNIATMQVGRQEAGGKAMM 435

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  + ++VL+ L+    I  VK+ E
Sbjct: 436 ILSLDKPVDDAVLKTLAQIDDIETVKRLE 464


>gi|15606928|ref|NP_214309.1| D-3-phosphoglycerate dehydrogenase [Aquifex aeolicus VF5]
 gi|2984165|gb|AAC07698.1| D-3-phosphoglycerate dehydrogenase [Aquifex aeolicus VF5]
          Length = 533

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V     PR  +I     D++   +++   N D+ G++  +G+ILGE  INIA F LGR +
Sbjct: 437 VLEGQIPRITEIDRYKVDIEPEGILLVFENKDVPGVIGKIGSILGEANINIAGFRLGREK 496

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  L +D      VL ++     I FVK    
Sbjct: 497 KGGIAIGILNLDEPASEEVLSRIKEIPEILFVKHIVL 533


>gi|126696878|ref|YP_001091764.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9301]
 gi|126543921|gb|ABO18163.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9301]
          Length = 528

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I N +L+ +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTIIEVDGITNANPVTL 528


>gi|218295353|ref|ZP_03496166.1| D-3-phosphoglycerate dehydrogenase [Thermus aquaticus Y51MC23]
 gi|218243985|gb|EED10511.1| D-3-phosphoglycerate dehydrogenase [Thermus aquaticus Y51MC23]
          Length = 521

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 33/92 (35%), Positives = 43/92 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V   GKPR + I +   +V     M+  VN D  G+V  VG +LGE G+NIA   LGR  
Sbjct: 425 VVIGGKPRLVGIDDYALEVVPEGYMLVCVNYDRPGVVGQVGTLLGEAGVNIAGMQLGRDV 484

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D      VLE L     +  V
Sbjct: 485 PGGRALFVLTVDQKPAPEVLEALRALPVLERV 516


>gi|33861910|ref|NP_893471.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|33640278|emb|CAE19813.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
          Length = 528

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG++ +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRFMLITRHRDMPGIIGKLGSLLGDHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++LE +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPTNLLESILEVEGITSSDPVTL 528


>gi|87301209|ref|ZP_01084050.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 5701]
 gi|87284177|gb|EAQ76130.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 5701]
          Length = 528

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRITTIDEFPVNVMPTRHMLITRHRDMPGIIGNIGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  I  S+L  +     I+       
Sbjct: 492 VRGDAVMVLSLDDPIPPSLLISIHGINGIQEAHPVTL 528


>gi|197106733|ref|YP_002132110.1| D-3-phosphoglycerate dehydrogenase [Phenylobacterium zucineum HLK1]
 gi|196480153|gb|ACG79681.1| D-3-phosphoglycerate dehydrogenase [Phenylobacterium zucineum HLK1]
          Length = 524

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 50/93 (53%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G PR I+++ ++ D      M+ + N D  G +  +G +LG+  INIA F+LGR  + + 
Sbjct: 432 GAPRIIEVKGMDLDAPFAPQMLYVNNLDKPGFIGALGALLGDAKINIATFNLGRIDAGDD 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI+ + +D +   ++L K+     ++  +   F
Sbjct: 492 AIALVGVDQAPDEALLAKIQKLPHVKEARALRF 524


>gi|123966748|ref|YP_001011829.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9515]
 gi|123201114|gb|ABM72722.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9515]
          Length = 528

 Score =  124 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG++ +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRFMLITRHRDMPGIIGKLGSLLGDHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++LE +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPTNLLESILEVEGITSSDPVTL 528


>gi|33240885|ref|NP_875827.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
 gi|33238414|gb|AAQ00480.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 528

 Score =  124 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +DG+ R   I E   +V   R M+   + D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 432 VLADGELRISSIDEFPINVSPSRYMLFTRHRDMPGIIGKLGSLLGTHNVNIAAMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I + +L  +     I       F
Sbjct: 492 VRGEAVMVLSIDDPIPSELLTSILAVEGINQAHAVTF 528


>gi|320450108|ref|YP_004202204.1| phosphoglycerate dehydrogenase [Thermus scotoductus SA-01]
 gi|320150277|gb|ADW21655.1| phosphoglycerate dehydrogenase [Thermus scotoductus SA-01]
          Length = 521

 Score =  124 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 42/88 (47%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GKPR + I +   +V     M+  +N D  G+V  VG +LGE G+NIA   LGR      
Sbjct: 429 GKPRLVGIDDYALEVVPEGYMLVCINYDRPGVVGQVGTLLGEAGVNIAGMQLGRDVPGGR 488

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFV 92
           A+  L +D      VLE L     +  V
Sbjct: 489 ALFVLTVDEKPSPEVLEALRALPVLERV 516


>gi|241762175|ref|ZP_04760258.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373425|gb|EER63025.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 527

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R ++I  I  + ++   M+ IVN D  G +  +G +LG+ G+NI  FHLGR  
Sbjct: 430 LFGSEGTRLVEIFGIKVEANLSGDMLYIVNDDAPGFIGRLGTLLGKAGVNIGTFHLGRRN 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +    + K++    +R VK   F
Sbjct: 490 TGGEAVLLLSVDSPVTAGKMAKVAELSGVREVKSLHF 526


>gi|260753763|ref|YP_003226656.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258553126|gb|ACV76072.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 527

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R ++I  I  + ++   M+ IVN D  G +  +G +LG+ G+NI  FHLGR  
Sbjct: 430 LFGSEGTRLVEIFGIKVEANLSGDMLYIVNDDAPGFIGRLGTLLGKAGVNIGTFHLGRRN 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +    + K++    +R VK   F
Sbjct: 490 TGGEAVLLLSVDSPVTAGKMAKVAELSGVREVKSLHF 526


>gi|56552581|ref|YP_163420.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56544155|gb|AAV90309.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 527

 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R ++I  I  + ++   M+ IVN D  G +  +G +LG+ G+NI  FHLGR  
Sbjct: 430 LFGSEGTRLVEIFGIKIEANLSGDMLYIVNDDAPGFIGRLGTLLGKAGVNIGTFHLGRRN 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +    + K++    +R VK   F
Sbjct: 490 TGGEAVLLLSVDSPVTAGKMAKVAELSGVREVKSLHF 526


>gi|322368216|ref|ZP_08042785.1| D-3-phosphoglycerate dehydrogenase [Haladaptatus paucihalophilus
           DX253]
 gi|320552232|gb|EFW93877.1| D-3-phosphoglycerate dehydrogenase [Haladaptatus paucihalophilus
           DX253]
          Length = 527

 Score =  123 bits (310), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 43/98 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+D  PR ++I     D      M+   N D  G++ F+G +LGE+  NIA     R  
Sbjct: 428 LFADDDPRIVRIDGYRVDAIPHGHMLVARNQDKPGVIGFIGTVLGEHDTNIAGMFNARET 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A+S   +D  +  +  E L  +  I  V+    N
Sbjct: 488 DGGEALSVYNLDSEVSTAAKEALEADERIIEVRNIALN 525


>gi|16127445|ref|NP_422009.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 gi|221236257|ref|YP_002518694.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
 gi|13424897|gb|AAK25177.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 gi|220965430|gb|ACL96786.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
          Length = 526

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 49/93 (52%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G PR ++++ +  D      M+ + N D  G +  +G +LGE G+NIA F+LGR  + E 
Sbjct: 434 GAPRIVEVKGMELDAAFSPAMLYVNNLDKPGFIGALGMLLGEAGVNIATFNLGRVSADED 493

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI+ + +D +    +L K+     ++  +   F
Sbjct: 494 AIALVGVDQAPDAGLLAKIQALPHVKEARALTF 526


>gi|295688138|ref|YP_003591831.1| D-3-phosphoglycerate dehydrogenase [Caulobacter segnis ATCC 21756]
 gi|295430041|gb|ADG09213.1| D-3-phosphoglycerate dehydrogenase [Caulobacter segnis ATCC 21756]
          Length = 526

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 49/93 (52%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G PR ++++ +  D      M+ I N D  G +  +G +LGE G+NIA F+LGR  + E 
Sbjct: 434 GAPRIVEVKGMELDAAFSPAMLYINNLDKPGFIGALGMMLGEAGVNIATFNLGRLAADED 493

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI+ + +D +    +L K+     ++  +   F
Sbjct: 494 AIALVGVDQAPSADLLAKIEALPHVKESRALTF 526


>gi|167648422|ref|YP_001686085.1| D-3-phosphoglycerate dehydrogenase [Caulobacter sp. K31]
 gi|167350852|gb|ABZ73587.1| D-3-phosphoglycerate dehydrogenase [Caulobacter sp. K31]
          Length = 526

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 50/93 (53%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G PR ++++ +  D      M+ I N D  G +  +G +LGE G+NIA F+LGR  + E 
Sbjct: 434 GAPRMVEVKGMELDAGFAPAMLYINNLDKPGFIGALGMLLGEAGVNIATFNLGRLSADED 493

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI+ + +D +   ++L K+     ++  +   F
Sbjct: 494 AIALVGVDQAPDEALLAKIQALPHVKEARALTF 526


>gi|108803680|ref|YP_643617.1| D-3-phosphoglycerate dehydrogenase [Rubrobacter xylanophilus DSM
           9941]
 gi|108764923|gb|ABG03805.1| D-3-phosphoglycerate dehydrogenase [Rubrobacter xylanophilus DSM
           9941]
          Length = 527

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 43/92 (46%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +PR ++      D+   R M+ I N D+ G++  VG ILGE+GINI +  +GR +    A
Sbjct: 435 QPRLVEALGYTLDIVPERHMLFIRNEDVPGMIGKVGTILGEHGINIGNMAVGRGEPGSRA 494

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              + +D  +   V+E L         +    
Sbjct: 495 AMAVTVDEPVPPEVVESLLNIPGFNDARAVTL 526


>gi|254294765|ref|YP_003060788.1| D-3-phosphoglycerate dehydrogenase [Hirschia baltica ATCC 49814]
 gi|254043296|gb|ACT60091.1| D-3-phosphoglycerate dehydrogenase [Hirschia baltica ATCC 49814]
          Length = 525

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 50/94 (53%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G+ R + ++++  +      ++ I N D  G +  +G+ILGE G+NIA F+LGR +   
Sbjct: 432 NGQSRIVAVKDMALEAKFRPFILFINNNDEAGFIGSLGSILGEAGVNIATFNLGREEQGG 491

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            AI+ + ID  +    + K+     +R+ K   F
Sbjct: 492 DAIAMVGIDQDVPAEAMAKIEALTQVRYAKVLRF 525


>gi|189425146|ref|YP_001952323.1| D-3-phosphoglycerate dehydrogenase [Geobacter lovleyi SZ]
 gi|189421405|gb|ACD95803.1| D-3-phosphoglycerate dehydrogenase [Geobacter lovleyi SZ]
          Length = 535

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 50/93 (53%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++   D      M+ +  AD  G++  +G I+G++ INI   +LGRS+   
Sbjct: 435 EGAPRIVRLRDYAMDFTPEEHMLLLHYADRPGMIGKIGTIMGKHEINIGSMNLGRSEKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  L ID ++  +V+E++       F++   
Sbjct: 495 EAMVILSIDSAVSQAVIEEIKQATEATFIRAIH 527


>gi|285808609|gb|ADC36128.1| putative D-3-phosphoglycerate dehydrogenase [uncultured bacterium
           253]
          Length = 533

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 46/90 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R  +I   + +      M+ + N D+ G++  VG ILGE+ +NI+ FHLGR +    A++
Sbjct: 443 RITEIDGFHIEAIPRGHMLVMRNRDVPGVIGRVGTILGEHDVNISRFHLGRRERGGEAMA 502

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            + +D ++    L  L     I  V++ E 
Sbjct: 503 VIEVDSTVAPKALAALRSQEEILLVREIEL 532


>gi|218461199|ref|ZP_03501290.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli Kim 5]
          Length = 463

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 49/71 (69%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 393 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGGAGVNIANFQLGRDK 452

Query: 61  STEHAISFLCI 71
               AI+ L +
Sbjct: 453 QGGDAIALLYV 463


>gi|226312009|ref|YP_002771903.1| D-3-phosphoglycerate dehydrogenase [Brevibacillus brevis NBRC
           100599]
 gi|226094957|dbj|BAH43399.1| D-3-phosphoglycerate dehydrogenase [Brevibacillus brevis NBRC
           100599]
          Length = 527

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +KI +   DV     ++ I + D  G++  VG+ILGE  +NIA   +GR      AI 
Sbjct: 438 RIVKIDDFAIDVAPEGYLLYIHHNDRPGVIGRVGSILGENSVNIATMQVGRRDIGGDAIM 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  +   +L+ +     ++ V Q E 
Sbjct: 498 MLSVDKPLTPELLDTMGELAEVKSVTQIEL 527


>gi|254526871|ref|ZP_05138923.1| phosphoglycerate dehydrogenase [Prochlorococcus marinus str. MIT
           9202]
 gi|221538295|gb|EEE40748.1| phosphoglycerate dehydrogenase [Prochlorococcus marinus str. MIT
           9202]
          Length = 528

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ + + I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELKIMSIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I N +L+ +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTIIEVEGITNANPVTL 528


>gi|157413916|ref|YP_001484782.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9215]
 gi|157388491|gb|ABV51196.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9215]
          Length = 528

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ + + I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELKIMSIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I N +L+ +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTIIEVEGITNANPVTL 528


>gi|225174433|ref|ZP_03728432.1| D-3-phosphoglycerate dehydrogenase [Dethiobacter alkaliphilus AHT
           1]
 gi|225170218|gb|EEG79013.1| D-3-phosphoglycerate dehydrogenase [Dethiobacter alkaliphilus AHT
           1]
          Length = 525

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 46/98 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+    R +KI + N +V   R M+     D+ G++   G  LGE  INIA   +GR  
Sbjct: 428 LFNKDDIRIVKIDKYNIEVVPSRYMLVTKYMDMPGVIGRFGITLGESNINIAGMQVGRQS 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A+  L +D  +   V++KL     I  ++  + +
Sbjct: 488 IGGEAVMALQVDCPVPEDVIKKLEKLDAIVSIRFVKLD 525


>gi|77918032|ref|YP_355847.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
 gi|77544115|gb|ABA87677.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
          Length = 534

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 50/94 (53%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G+PR +++++   D      M+ I   D  G++  +G ILGE+ INIA  +LGR +   
Sbjct: 434 EGQPRIVRLRDYQVDFAPEEHMLVITYRDQPGMIGKIGQILGEHDINIAAMNLGRQEKLG 493

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++ + V+ ++   V   F+K    
Sbjct: 494 EAMVILSLDSAVASHVVAEIGSVVDATFIKYLHL 527


>gi|328950683|ref|YP_004368018.1| D-3-phosphoglycerate dehydrogenase [Marinithermus hydrothermalis
           DSM 14884]
 gi|328451007|gb|AEB11908.1| D-3-phosphoglycerate dehydrogenase [Marinithermus hydrothermalis
           DSM 14884]
          Length = 521

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 43/92 (46%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +PR + I +   +V     ++  VN D  G+V  VG +LGE G+NIA   LGR      A
Sbjct: 430 QPRLVGIDDYPLEVVPEGHLLVCVNHDRPGVVGRVGTLLGEAGVNIAGMQLGRDAPGGRA 489

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +  L +D      VLE L+    +  V   E 
Sbjct: 490 LFVLTVDERPSPEVLEALARLEVLERVDVVEL 521


>gi|319892782|ref|YP_004149657.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162478|gb|ADV06021.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464187|gb|ADX76340.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           ED99]
          Length = 531

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/98 (35%), Positives = 47/98 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +   PR ++I +   D       + I + D  GIV   G ILGE+G+NIA  HLGRSQ
Sbjct: 432 VLNGFGPRIVRINDYPVDFKPEHYQLVIHHFDRPGIVGKTGQILGEHGVNIASMHLGRSQ 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A+  L ID  I  +V E L      + V Q   +
Sbjct: 492 IGGDAMMILSIDHPINETVREALLKIDGFQSVLQVTLD 529


>gi|77920705|ref|YP_358520.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
 gi|77546788|gb|ABA90350.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
          Length = 535

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 50/95 (52%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G P+ +K+++ N D      M+ I  AD  G++  +G ILGE GINI   +LGR   + 
Sbjct: 435 EGIPKIVKMRDFNTDFQPEEHMLVISYADKPGLIGKIGTILGEAGINIGSMNLGRRAKSG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            A+  L +D      VLE+L+ ++   F++     
Sbjct: 495 EAMVVLSLDTPAPAEVLEQLATSIDAAFIRSIHME 529


>gi|300709559|ref|YP_003735373.1| D-3-phosphoglycerate dehydrogenase [Halalkalicoccus jeotgali B3]
 gi|299123242|gb|ADJ13581.1| D-3-phosphoglycerate dehydrogenase [Halalkalicoccus jeotgali B3]
          Length = 537

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 44/98 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+D  PR ++I +   D      M+   N D  G + F+G +LGE GINIA     R  
Sbjct: 431 LFADDDPRIVRIDDYRVDAIPHGHMLVARNYDEPGTIGFIGTVLGENGINIAGMFNAREA 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               AI+   +D  +   +L +L  +  I   +    +
Sbjct: 491 IGGEAITVYDLDEEVGEELLAQLEDDERIIEARYITLD 528


>gi|260891940|ref|YP_003238037.1| D-3-phosphoglycerate dehydrogenase [Ammonifex degensii KC4]
 gi|260864081|gb|ACX51187.1| D-3-phosphoglycerate dehydrogenase [Ammonifex degensii KC4]
          Length = 527

 Score =  120 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 41/90 (45%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +PR ++I     D      ++ I + D   I+  +G ++G + INIA   +GR +    A
Sbjct: 436 EPRVVEIDGYRVDAVPEGYVLFIPHLDRPRIIGRIGTLIGAHDINIAAMQVGRKEIGGKA 495

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           I  L +D  +    L +++    +  VK  
Sbjct: 496 IMLLSVDSPVPEETLREIAKVENVLDVKML 525


>gi|147676347|ref|YP_001210562.1| D-3-phosphoglycerate dehydrogenase [Pelotomaculum thermopropionicum
           SI]
 gi|146272444|dbj|BAF58193.1| phosphoglycerate dehydrogenase and related dehydrogenases
           [Pelotomaculum thermopropionicum SI]
          Length = 526

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 41/96 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R + I   + D      M+ I + D   I+  VGN++G + INI+   +GR  
Sbjct: 430 IFGKVDQRIVSIDGYHVDAVPEGHMLYIPHIDKPRIIGPVGNLIGTHNINISGMQVGRKV 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               A+  L ID  +    + +++    +  VK   
Sbjct: 490 IGGKAVMLLNIDSPVPEETMAEIAKIDGVLGVKSVS 525


>gi|295696411|ref|YP_003589649.1| D-3-phosphoglycerate dehydrogenase [Bacillus tusciae DSM 2912]
 gi|295412013|gb|ADG06505.1| D-3-phosphoglycerate dehydrogenase [Bacillus tusciae DSM 2912]
          Length = 527

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR ++I   + DV     ++   + D  GI+  VG++LG  G+NIA   +GR +
Sbjct: 431 LFNGLGPRIVQIDGYSVDVAPQGTLLITRHIDQPGIIGQVGSLLGAAGVNIAAMQVGRKE 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  +    L  +     I  V+    
Sbjct: 491 LGGQAVMVLAVDKPVDAETLANIGQVPGILAVRDVSL 527


>gi|294085874|ref|YP_003552634.1| phosphoglycerate dehydrogenase and related dehydrogenase
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665449|gb|ADE40550.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 527

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 50/97 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +    K R +++Q I  + D    ++ + N D  G +  +G + G+YG+NIA FHLGR  
Sbjct: 429 LVGGDKARIVEVQHIAVESDFPAHLLYLRNYDKPGFIGDLGTLCGKYGVNIATFHLGRRD 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++ + IDG + +S+L  L     +  V   +F
Sbjct: 489 VGGEAVALVEIDGELPDSMLGDLRALKQVVRVDALQF 525


>gi|52080816|ref|YP_079607.1| D-3-phosphoglycerate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|52786187|ref|YP_092016.1| D-3-phosphoglycerate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|319645226|ref|ZP_07999459.1| SerA protein [Bacillus sp. BT1B_CT2]
 gi|52004027|gb|AAU23969.1| phosphoglycerate dehydrogenase SerA [Bacillus licheniformis ATCC
           14580]
 gi|52348689|gb|AAU41323.1| SerA [Bacillus licheniformis ATCC 14580]
 gi|317393035|gb|EFV73829.1| SerA protein [Bacillus sp. BT1B_CT2]
          Length = 525

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 41/90 (45%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R + +   + D      ++ I + D  G +  VG ILG++ INIA   +GR +    AI 
Sbjct: 435 RIVALNGFDIDFYPAGHLVYIHHQDKPGAIGHVGRILGDHDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  + + +L +L     I  VK  + 
Sbjct: 495 MLSFDRHLEDDILAELKNIPDIVSVKAIDL 524


>gi|206890990|ref|YP_002248773.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742928|gb|ACI21985.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 529

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 53/99 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S   PR ++I +I+ ++     MI + N D  G++  +G +LG+  INI H H GR +
Sbjct: 430 LLSRKDPRIVQINDISMEIIPEGNMIFLRNHDRPGVIGNIGTLLGQNNINIGHMHFGRKE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   A S + +D ++ + ++EK+     +  V+    +V
Sbjct: 490 AGGIAFSVISVDATLTDDIIEKIKQLPNVLEVRPVYISV 528


>gi|195953161|ref|YP_002121451.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobaculum sp. Y04AAS1]
 gi|195932773|gb|ACG57473.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobaculum sp. Y04AAS1]
          Length = 527

 Score =  120 bits (301), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 49/93 (52%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
            +  PR ++I     DV+   +M+   N D  G++  +G+ILG+  +NIA F LGR +  
Sbjct: 433 ENQIPRILQIDRFYVDVEPEGVMLVFENKDAPGVIGTIGSILGQANVNIAGFRLGREKKG 492

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  L +D  + + VLEKL     I  +KQ 
Sbjct: 493 GLALGVLNLDSKVSDEVLEKLKRIPQIISMKQV 525


>gi|124026487|ref|YP_001015602.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL1A]
 gi|123961555|gb|ABM76338.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. NATL1A]
          Length = 528

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DG      I E   +    R M+   + D+ GI+  +G++LG+Y +NIA   +GR  
Sbjct: 432 VFGDGDLGITSIDEYPINFVPSRHMLFTRHRDMPGIIGQIGSLLGKYNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I + +L  +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPSELLGSILSMQGINEAHSVTL 528


>gi|72382765|ref|YP_292120.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL2A]
 gi|72002615|gb|AAZ58417.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL2A]
          Length = 528

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DG      I E   +    R M+   + D+ GI+  +G++LG+Y +NIA   +GR  
Sbjct: 432 VFGDGDLGITSIDEYPINFVPSRHMLFTRHRDMPGIIGQIGSLLGKYNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I + +L  +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPSELLGSILSMQGINEAHSVTL 528


>gi|224417936|ref|ZP_03655942.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|253827274|ref|ZP_04870159.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|313141477|ref|ZP_07803670.1| d-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|253510680|gb|EES89339.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|313130508|gb|EFR48125.1| d-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
          Length = 527

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 2/97 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++  P+ ++I     D+     MI   N D  G++ FVG  L ++ INIA F LGR  
Sbjct: 433 VFNENTPKIVEINHFELDIAPKGRMILFRNNDTPGVIGFVGTTLAKHNINIADFRLGR-- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  + N V+++L+       +K    
Sbjct: 491 YGKEALAVILVDDEVSNEVIKELAGIEACLSIKYVVL 527


>gi|253576381|ref|ZP_04853711.1| phosphoglycerate dehydrogenase [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844274|gb|EES72292.1| phosphoglycerate dehydrogenase [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 529

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I +   DV     +I I + D  GI+  VG +LG+  +NIA   +GR      AI 
Sbjct: 439 RIVQIDKFPVDVAPEGHLIFISHNDKPGIIGHVGTLLGKNVVNIASMQVGRKLVGGEAIM 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++   VL++L+    I   +   F
Sbjct: 499 VLTVDKAVTKEVLDELTKLPEINKAQHIIF 528


>gi|257052425|ref|YP_003130258.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
 gi|256691188|gb|ACV11525.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
          Length = 520

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 45/98 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F D +PR ++I     D      M+   N D  G++  +G++ GEY +NIA     R  
Sbjct: 423 LFGDNEPRLVEIDGFRVDATPYGHMLISRNRDEPGVIGALGSVFGEYDVNIAGMANARES 482

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A+S   +D  +   +LE+L  +  +  V   + +
Sbjct: 483 IDGEAMSVYNLDDPVTPELLEELESDTRVTGVTAIDLD 520


>gi|237752566|ref|ZP_04583046.1| d-3-phosphoglycerate dehydrogenase [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376055|gb|EEO26146.1| d-3-phosphoglycerate dehydrogenase [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 527

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 2/93 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++  P+ + I     D++    MI   N D  G++ FVG  L ++ INIA F LGR  
Sbjct: 433 VFNENTPKIVNINNFALDIEPKGKMILFRNDDTPGVIGFVGTTLAKHNINIADFRLGR-- 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
             + A++ + +D +I  SVL++L+       +K
Sbjct: 491 YGKEALALIIVDDAISQSVLDELASLEACISIK 523


>gi|313125075|ref|YP_004035339.1| d-3-phosphoglycerate dehydrogenase [Halogeometricum borinquense DSM
           11551]
 gi|312291440|gb|ADQ65900.1| D-3-phosphoglycerate dehydrogenase [Halogeometricum borinquense DSM
           11551]
          Length = 534

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 1/99 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR ++I     D      M+   N D  G++ F+G +LGE  +NIA     R  
Sbjct: 432 LFAGEDPRIVRIDGYRVDAIPHGQMLVARNYDKPGVIGFIGTVLGENDVNIAGMFNARRS 491

Query: 61  S-TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
           +    A++   +D  I   V EKL  +  I  VK    N
Sbjct: 492 ADGGEALTVYNLDDPIPEEVSEKLLADERITDVKYLTLN 530


>gi|163781587|ref|ZP_02176587.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882807|gb|EDP76311.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 530

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 48/95 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V      R ++I +   D++   +++   N D+ G++  +G++LG   +NIA F LGR +
Sbjct: 434 VLEGQLLRIVQIDKYRVDIEPEGILLVFENKDVPGVIGKIGSVLGSASVNIAGFRLGREK 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
               A+  L +D  +   V+E L     I FVKQ 
Sbjct: 494 KGGIALGILNLDDQVPEHVIEDLRGIPEILFVKQV 528


>gi|78044181|ref|YP_361480.1| D-3-phosphoglycerate dehydrogenase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996296|gb|ABB15195.1| D-3-phosphoglycerate dehydrogenase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 525

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + +PR ++I +   DV      + + + D   ++  VG ILGE GINIA   LGR  
Sbjct: 429 LFRNNEPRIVQIDQYRVDVVPEGYKLFVPHKDQPLMIGKVGIILGEKGINIAGMQLGRIT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D       ++ ++    I  VK    
Sbjct: 489 PGGDAVMVLSLDHPADGDSIKAIAAIPGIYEVKAVSL 525


>gi|31790358|gb|AAP58615.1| putative D-3-phosphoglycerate dehydrogenase [uncultured
           Acidobacteria bacterium]
          Length = 561

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R  +I   + +      M+ + N D+ G++  VG ILGE G+NI+HFHLGR +    A++
Sbjct: 471 RITEIDGFHIEALPHGHMLVMRNRDVPGVIGRVGTILGERGVNISHFHLGRRERGGEAMA 530

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            + +D +     L+ L     I  V   E 
Sbjct: 531 VIEVDAAADAETLDALRSLQDILSVCVIEL 560


>gi|303244898|ref|ZP_07331224.1| D-3-phosphoglycerate dehydrogenase [Methanothermococcus okinawensis
           IH1]
 gi|302484715|gb|EFL47653.1| D-3-phosphoglycerate dehydrogenase [Methanothermococcus okinawensis
           IH1]
          Length = 523

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 47/94 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   +I     D+    ++  I + D  G+V  VG +LG+YG+NIA   +GR +   
Sbjct: 430 DGNPVLREINGYKVDIKPEGIICVIKHIDRPGMVGKVGLLLGDYGVNIAGMQVGRKEPGG 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            +I  L +D  I + V+EKL     I+  K  + 
Sbjct: 490 ESIMVLNVDHMIPDEVIEKLKKLENIKDAKIIDL 523


>gi|110667020|ref|YP_656831.1| D-3-phosphoglycerate dehydrogenase [Haloquadratum walsbyi DSM
           16790]
 gi|109624767|emb|CAJ51173.1| phosphoglycerate dehydrogenase [Haloquadratum walsbyi DSM 16790]
          Length = 534

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 1/98 (1%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ- 60
           F+ G+PR +KI     D      M+   NAD  G++ F+G++LGE+ INIA     R   
Sbjct: 431 FTGGEPRIVKIDGYRVDAVPHGKMLVARNADKPGVIGFIGSVLGEHNINIAGMFNARRDI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D S+   V+E+L  +  +  V+    N
Sbjct: 491 EGGEALTIYNLDDSVPTDVVERLLADERMIDVRYLTLN 528


>gi|85680324|gb|ABC72353.1| phosphoglycerate dehydrogenase [Haloquadratum walsbyi]
          Length = 536

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 1/98 (1%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ- 60
           F+ G+PR +KI     D      M+   NAD  G++ F+G++LGE+ INIA     R   
Sbjct: 433 FTGGEPRIVKIDGYRVDAVPHGKMLVARNADKPGVIGFIGSVLGEHNINIAGMFNARRDI 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D S+   V+E+L  +  +  V+    N
Sbjct: 493 EGGEALTIYNLDDSVPTDVVERLLADERMIDVRYLTLN 530


>gi|319956089|ref|YP_004167352.1| d-3-phosphoglycerate dehydrogenase [Nitratifractor salsuginis DSM
           16511]
 gi|319418493|gb|ADV45603.1| D-3-phosphoglycerate dehydrogenase [Nitratifractor salsuginis DSM
           16511]
          Length = 530

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +G  R + I     D++    MI   N D  G++  VG I+ E G+NI  F LGR  
Sbjct: 435 VFEEGIQRIVDIDGYTLDLEPKGRMILFKNNDEPGVIGDVGRIIAENGLNIGDFRLGRDS 494

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A++ + +DG I   ++++L+       VK    
Sbjct: 495 N-GQALAVVRVDGEIPKKLIDELAALPACISVKAVSL 530


>gi|194016714|ref|ZP_03055327.1| phosphoglycerate dehydrogenase [Bacillus pumilus ATCC 7061]
 gi|194011320|gb|EDW20889.1| phosphoglycerate dehydrogenase [Bacillus pumilus ATCC 7061]
          Length = 524

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R + I   N D      ++ I + D  G++  VG ILG++ +NIA   +GR +    AI 
Sbjct: 435 RVVSINGFNIDFYPDGHLVYIQHTDAPGVIGKVGQILGDHDVNIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  + + ++++L+    I  V+  + 
Sbjct: 495 MLSFDKHLEDEIVKELTEVHDILSVRLIDL 524


>gi|332178487|gb|AEE14176.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfobium narugense DSM
           14796]
          Length = 528

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 46/95 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SD KPR I+I     D      ++   + D  GI+   G ILG+  INIA   LGR+ 
Sbjct: 431 ILSDQKPRIIEIDSYRVDAFPEGYLLVSRHRDKPGIIGRFGTILGKNNINIAGMQLGRNL 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           ++  A+  L +D  + + VL +L     I  ++  
Sbjct: 491 TSGLAVMILSVDSEVNDDVLRELISGGDIEELRSI 525


>gi|224476814|ref|YP_002634420.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421421|emb|CAL28235.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 530

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +   PR ++I +   D       + I + D  GIV   G ILGEY INIA  HLGR++
Sbjct: 432 VLNGYGPRIVRINDYPVDFKPAEYQLIINHTDRPGIVGRTGQILGEYDINIASMHLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  + +D ++   +++ L      + ++  + 
Sbjct: 492 EGGDAMMIISVDHTVSEDIIKALFQIDGFKNIQFVDL 528


>gi|157692807|ref|YP_001487269.1| D-3-phosphoglycerate dehydrogenase [Bacillus pumilus SAFR-032]
 gi|157681565|gb|ABV62709.1| phosphoglycerate dehydrogenase [Bacillus pumilus SAFR-032]
          Length = 524

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R + I   N D      ++ I + D  G++  VG ILG++ +NIA   +GR +    AI 
Sbjct: 435 RVVSINGFNIDFYPDGHLVYIQHTDAPGVIGKVGQILGDHDVNIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  + + ++++L+    I  V+  + 
Sbjct: 495 MLSFDKHLEDEIVKELTEVHDILSVRLIDL 524


>gi|251771412|gb|EES51991.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum
           ferrodiazotrophum]
          Length = 537

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R + +  +  +V    +M+ + N D  G+V  VG++LG +GINI+    GR  
Sbjct: 436 IFQKKDFRIVSLDSLPVEVVPDPIMLYLTNQDQPGVVGLVGSLLGSHGINISRMQFGRDF 495

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+S + +D     +VLE++  N  I  +K    
Sbjct: 496 PGGKAVSMIGVDSEPPAAVLEEIRKNPKIIALKLLRL 532


>gi|242242988|ref|ZP_04797433.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis W23144]
 gi|242233589|gb|EES35901.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis W23144]
          Length = 531

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I + + D    +  +   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VFAGFGPRIVRINDYSLDFKPNQYQLVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRND 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           +   A+  L ID      V++ L+       +
Sbjct: 493 AGGDALMILSIDQQASEEVIKILNETSGFNKI 524


>gi|312135806|ref|YP_004003144.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor owensensis
           OL]
 gi|311775857|gb|ADQ05344.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor owensensis
           OL]
          Length = 531

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 45/89 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    +DG++ +  +EKL     I  V
Sbjct: 498 KAVMVCEVDGALPDEAVEKLKSTDGILRV 526


>gi|319401036|gb|EFV89255.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis FRI909]
          Length = 531

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I + + D    +  +   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VFAGFGPRIVRINDYSLDFKPNQYQLVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRND 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           +   A+  L ID      V++ L+       +
Sbjct: 493 AGGDALMILSIDQQASEEVIKILNETSGFNKI 524


>gi|27468319|ref|NP_764956.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis ATCC
           12228]
 gi|57867245|ref|YP_188860.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           RP62A]
 gi|251811113|ref|ZP_04825586.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282875855|ref|ZP_06284722.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis SK135]
 gi|293366330|ref|ZP_06613010.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27315865|gb|AAO05000.1|AE016748_234 D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis ATCC
           12228]
 gi|57637903|gb|AAW54691.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           RP62A]
 gi|251805333|gb|EES57990.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281294880|gb|EFA87407.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis SK135]
 gi|291319568|gb|EFE59934.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329737454|gb|EGG73708.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU028]
 gi|329737488|gb|EGG73741.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU045]
          Length = 531

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I + + D    +  +   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VFAGFGPRIVRINDYSLDFKPNQYQLVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRND 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           +   A+  L ID      V++ L+       +
Sbjct: 493 AGGDALMILSIDQQASEEVIKILNETSGFNKI 524


>gi|312137068|ref|YP_004004405.1| d-3-phosphoglycerate dehydrogenase [Methanothermus fervidus DSM
           2088]
 gi|311224787|gb|ADP77643.1| D-3-phosphoglycerate dehydrogenase [Methanothermus fervidus DSM
           2088]
          Length = 526

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 41/85 (48%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            KP+ I I     DV+    M+ +   D+ G +  +G  LGE+ INIA   +GR +    
Sbjct: 432 NKPKIININGYKVDVEPKGNMMIVKYRDLPGTIGAIGTKLGEHDINIAIMQVGREKPGGE 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTI 89
           A+  L +D  +   VLE++     +
Sbjct: 492 AVMVLKVDQKVPEDVLEEVKSLKNV 516


>gi|308069541|ref|YP_003871146.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Paenibacillus polymyxa
           E681]
 gi|305858820|gb|ADM70608.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Paenibacillus polymyxa
           E681]
          Length = 530

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 43/91 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++ +   DV      + I + D  GI+  VG +LGE G+NIA   +GR      AI 
Sbjct: 440 RIVRLNQFPVDVAPEAHFLLISHNDKPGIIGRVGTLLGENGVNIASMQVGRKIVGGEAIM 499

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D ++   VL +L     +   ++   +
Sbjct: 500 ILTVDKAVPKDVLIQLVGLPELNTAQEVVLD 530


>gi|304319942|ref|YP_003853585.1| putative phosphoglycerate dehydrogenase [Parvularcula bermudensis
           HTCC2503]
 gi|303298845|gb|ADM08444.1| putative phosphoglycerate dehydrogenase [Parvularcula bermudensis
           HTCC2503]
          Length = 527

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 45/94 (47%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
            G+PR ++I  +  + +    M+ + N D  G +  +G +L    INIA F+LGR+    
Sbjct: 434 GGEPRAVRIGNVRLESNFAPHMLYVQNKDKPGFIGNLGKLLSSKDINIATFNLGRAAPGG 493

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A + L +D  + +  L+ LS    I   +   F
Sbjct: 494 TAYALLAVDQPLDDDTLKALSDLPQIDEARMLSF 527


>gi|302872524|ref|YP_003841160.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575383|gb|ADL43174.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 531

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 45/89 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    +DG++ +  +EKL     I  V
Sbjct: 498 KAVMVCEVDGALPDEAVEKLKNTDGILRV 526


>gi|297566778|ref|YP_003685750.1| D-3-phosphoglycerate dehydrogenase [Meiothermus silvanus DSM 9946]
 gi|296851227|gb|ADH64242.1| D-3-phosphoglycerate dehydrogenase [Meiothermus silvanus DSM 9946]
          Length = 521

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 40/89 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
            GKPR + + +   +V     M+   N D  G+V  VG +LG  G+NIA   LGR     
Sbjct: 428 GGKPRLVGVDDYRLEVVPEGFMLICTNRDQPGVVGKVGTLLGGSGVNIAGMQLGRDAPGG 487

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+  L ID      VL+ L     +  V
Sbjct: 488 KALFVLAIDERPSEEVLDALRGLDVLERV 516


>gi|301122067|ref|XP_002908760.1| phosphoserine aminotransferase, putative [Phytophthora infestans
           T30-4]
 gi|262099522|gb|EEY57574.1| phosphoserine aminotransferase, putative [Phytophthora infestans
           T30-4]
          Length = 3635

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   + RF+   ++  D      M+   N D  G++  V ++L ++ INI +F L R +
Sbjct: 461 VFGKSQLRFVSFDDLPMDAIPSGSMLLFNNTDQPGVLHKVTSVLAKHQINIGNFGLAREK 520

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNV---TIRFVKQFEFN 98
           +T  A+S L +D +I + V+++L        +R V   E N
Sbjct: 521 ATAAAVSVLNVDEAIPDVVMDELEALGMLTDLRRVNLLELN 561


>gi|312621616|ref|YP_004023229.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202083|gb|ADQ45410.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 531

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 44/89 (49%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    IDG + +  +EKL     I  V
Sbjct: 498 KAVMVCEIDGELPDEAVEKLKNTDGILRV 526


>gi|242309369|ref|ZP_04808524.1| d-3-phosphoglycerate dehydrogenase [Helicobacter pullorum MIT
           98-5489]
 gi|239523940|gb|EEQ63806.1| d-3-phosphoglycerate dehydrogenase [Helicobacter pullorum MIT
           98-5489]
          Length = 117

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 2/97 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++  P+ ++I     D++    MI   N D  G++  VG  L +Y INIA F LGR  
Sbjct: 23  VFNEDTPKIVEINHFEMDIEPKGRMILFRNNDTPGVIGHVGTTLAKYNINIADFRLGR-- 80

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  + N V+++LS       +K    
Sbjct: 81  YGKEALAVILVDDEVSNEVIKELSSIKACLAIKYVVL 117


>gi|323440732|gb|EGA98441.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus O11]
          Length = 534

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|282911349|ref|ZP_06319151.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282325044|gb|EFB55354.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|312437820|gb|ADQ76891.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH60]
          Length = 534

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|298694992|gb|ADI98214.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED133]
          Length = 534

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|283470989|emb|CAQ50200.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 534

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|257431137|ref|ZP_05607514.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257278085|gb|EEV08733.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 68-397]
          Length = 534

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|82751311|ref|YP_417052.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus RF122]
 gi|82656842|emb|CAI81271.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus RF122]
          Length = 534

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|222530091|ref|YP_002573973.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456938|gb|ACM61200.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor bescii DSM
           6725]
          Length = 531

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 44/89 (49%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    IDG + +  +EKL     I  V
Sbjct: 498 KAVMVCEIDGELPDEAIEKLKNTDGILRV 526


>gi|15924714|ref|NP_372248.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15927301|ref|NP_374834.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus N315]
 gi|148268202|ref|YP_001247145.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150394270|ref|YP_001316945.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156980041|ref|YP_001442300.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253315102|ref|ZP_04838315.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732373|ref|ZP_04866538.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|255006509|ref|ZP_05145110.2| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257794107|ref|ZP_05643086.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9781]
 gi|258415811|ref|ZP_05682082.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9763]
 gi|258420640|ref|ZP_05683579.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9719]
 gi|258438290|ref|ZP_05689574.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9299]
 gi|258443748|ref|ZP_05692087.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A8115]
 gi|258445959|ref|ZP_05694135.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6300]
 gi|258448361|ref|ZP_05696478.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6224]
 gi|258454159|ref|ZP_05702130.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5937]
 gi|269203362|ref|YP_003282631.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282893218|ref|ZP_06301452.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8117]
 gi|282927853|ref|ZP_06335464.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A10102]
 gi|295406034|ref|ZP_06815842.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8819]
 gi|296276628|ref|ZP_06859135.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297245040|ref|ZP_06928917.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8796]
 gi|13701519|dbj|BAB42813.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus N315]
 gi|14247496|dbj|BAB57886.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|147741271|gb|ABQ49569.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946722|gb|ABR52658.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156722176|dbj|BAF78593.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253723895|gb|EES92624.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|257788079|gb|EEV26419.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9781]
 gi|257839404|gb|EEV63877.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9763]
 gi|257843244|gb|EEV67654.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9719]
 gi|257848334|gb|EEV72325.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9299]
 gi|257851154|gb|EEV75097.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A8115]
 gi|257855201|gb|EEV78140.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6300]
 gi|257858329|gb|EEV81214.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6224]
 gi|257863611|gb|EEV86368.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5937]
 gi|262075652|gb|ACY11625.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282590363|gb|EFB95442.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A10102]
 gi|282764536|gb|EFC04662.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8117]
 gi|285817406|gb|ADC37893.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 04-02981]
 gi|294969031|gb|EFG45052.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8819]
 gi|297178120|gb|EFH37368.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8796]
 gi|315130640|gb|EFT86626.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329727559|gb|EGG64015.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21172]
          Length = 534

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|84489937|ref|YP_448169.1| D-3-phosphoglycerate dehydrogenase [Methanosphaera stadtmanae DSM
           3091]
 gi|84373256|gb|ABC57526.1| SerA [Methanosphaera stadtmanae DSM 3091]
          Length = 524

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  + + + I I + +  + +   M  I   D+ G +  +G ILG+Y INIA   +GR  
Sbjct: 428 VVENNEAKIISIDDYDVRLTLEGKMAIIKYVDLPGTIGKIGKILGDYKINIAEMQVGRQT 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  L +D  I   V+ KL  +  I FVK  + 
Sbjct: 488 EGGEAIMVLKVDQEITEEVVSKLEDDNDIDFVKPVKL 524


>gi|21283395|ref|NP_646483.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49486548|ref|YP_043769.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|297207564|ref|ZP_06923999.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300911645|ref|ZP_07129089.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|21204835|dbj|BAB95531.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49244991|emb|CAG43452.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|296887581|gb|EFH26479.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300887066|gb|EFK82267.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH70]
          Length = 534

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|49483964|ref|YP_041188.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|253734492|ref|ZP_04868657.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257425837|ref|ZP_05602261.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428503|ref|ZP_05604901.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257436736|ref|ZP_05612780.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282904293|ref|ZP_06312181.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C160]
 gi|282906118|ref|ZP_06313973.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282909033|ref|ZP_06316851.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282914518|ref|ZP_06322304.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282919486|ref|ZP_06327221.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282924864|ref|ZP_06332530.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C101]
 gi|283958473|ref|ZP_06375924.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293503596|ref|ZP_06667443.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510612|ref|ZP_06669317.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M809]
 gi|293537153|ref|ZP_06671833.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|295428293|ref|ZP_06820922.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297590744|ref|ZP_06949382.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|49242093|emb|CAG40792.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|253727546|gb|EES96275.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257271531|gb|EEV03677.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275344|gb|EEV06831.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257284087|gb|EEV14210.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282313230|gb|EFB43626.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317296|gb|EFB47670.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282321699|gb|EFB52024.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282327297|gb|EFB57592.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331410|gb|EFB60924.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282595911|gb|EFC00875.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C160]
 gi|283790622|gb|EFC29439.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290919998|gb|EFD97066.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095262|gb|EFE25527.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466503|gb|EFF09024.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M809]
 gi|295127693|gb|EFG57330.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297575630|gb|EFH94346.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|302333388|gb|ADL23581.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|315195627|gb|EFU26014.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS00]
 gi|323442972|gb|EGB00594.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus O46]
 gi|329733088|gb|EGG69425.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21193]
          Length = 534

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|257433819|ref|ZP_05610177.1| LOW QUALITY PROTEIN: D-3-phosphoglycerate dehydrogenase
           [Staphylococcus aureus subsp. aureus E1410]
 gi|257281912|gb|EEV12049.1| LOW QUALITY PROTEIN: D-3-phosphoglycerate dehydrogenase
           [Staphylococcus aureus subsp. aureus E1410]
          Length = 294

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 194 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 253

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 254 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 293


>gi|57652022|ref|YP_186607.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87160337|ref|YP_494364.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195533|ref|YP_500339.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|151221829|ref|YP_001332651.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|161509939|ref|YP_001575598.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221142358|ref|ZP_03566851.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|258450882|ref|ZP_05698935.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5948]
 gi|262049037|ref|ZP_06021915.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus D30]
 gi|262051787|ref|ZP_06024004.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 930918-3]
 gi|294849885|ref|ZP_06790624.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9754]
 gi|304380684|ref|ZP_07363355.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|57286208|gb|AAW38302.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87126311|gb|ABD20825.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87203091|gb|ABD30901.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|150374629|dbj|BAF67889.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|160368748|gb|ABX29719.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|257861418|gb|EEV84226.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5948]
 gi|259160281|gb|EEW45308.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 930918-3]
 gi|259162854|gb|EEW47418.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus D30]
 gi|269941202|emb|CBI49590.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TW20]
 gi|294823224|gb|EFG39654.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9754]
 gi|302751550|gb|ADL65727.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304340791|gb|EFM06720.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|315197191|gb|EFU27530.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320141667|gb|EFW33502.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143821|gb|EFW35594.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|329314397|gb|AEB88810.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329726965|gb|EGG63422.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21189]
          Length = 534

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|118443172|ref|YP_879194.1| D-3-phosphoglycerate dehydrogenase [Clostridium novyi NT]
 gi|118133628|gb|ABK60672.1| D-3-phosphoglycerate dehydrogenase [Clostridium novyi NT]
          Length = 530

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 48/94 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V S+ + + ++IQ    DV     M+ + N D+ G++  VG I+G  GIN+A   +GR  
Sbjct: 434 VSSNHEGKIVEIQGYEVDVKPSTHMVFVQNKDVPGVIGQVGTIIGMEGINVATMQVGRKA 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
             E+A+  L +D  + +  ++K      I  VK 
Sbjct: 494 KGENALMILNVDSEVSDESIKKFKEVQDIIEVKA 527


>gi|282916984|ref|ZP_06324742.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283770802|ref|ZP_06343694.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
 gi|282319471|gb|EFB49823.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283460949|gb|EFC08039.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
          Length = 534

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|289523971|ref|ZP_06440825.1| phosphoglycerate dehydrogenase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289502627|gb|EFD23791.1| phosphoglycerate dehydrogenase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 544

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 49/98 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +GK R + + +   D      ++   N D  G++  +G +LG+YG+NIA+F LGR  
Sbjct: 445 VTEEGKKRIVGVDDYEIDFVPEGWVLLFSNHDRPGVIGKIGTLLGDYGVNIANFALGRKN 504

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            +  AI+ L +D SI    +EK+  +  + +       
Sbjct: 505 GSGLAIAALQLDSSIPKEAMEKIQKDADLIWAHLINLK 542


>gi|295706456|ref|YP_003599531.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium DSM 319]
 gi|294804115|gb|ADF41181.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium DSM 319]
          Length = 524

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 44/91 (48%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR + I   + D      ++ I ++D  G++  VG +LG+  INIA   +GR Q    AI
Sbjct: 434 PRIVNIDSFDIDFYPEGHLLYIRHSDQPGVIGNVGKVLGDLRINIATMQVGRKQKGGEAI 493

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             L  D  + +SV+  L     I  +++ E 
Sbjct: 494 MMLTFDKLLDDSVIASLKQTSEIVTIQRIEL 524


>gi|284024770|ref|ZP_06379168.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 132]
          Length = 534

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|282924414|ref|ZP_06332087.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9765]
 gi|282592915|gb|EFB97918.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9765]
          Length = 534

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|291279254|ref|YP_003496089.1| D-3-phosphoglycerate dehydrogenase [Deferribacter desulfuricans
           SSM1]
 gi|290753956|dbj|BAI80333.1| D-3-phosphoglycerate dehydrogenase [Deferribacter desulfuricans
           SSM1]
          Length = 540

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R +   +   D+      +   N D  G++  VG ILGE  INIA F L R Q
Sbjct: 445 VFNNKEGRIVLFDDFRIDIIPEGTFLYFRNIDRPGVIGKVGTILGENNINIAGFELAR-Q 503

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+F+ +D  I  SVL ++     +  V   E 
Sbjct: 504 KGGEAIAFVSVDNEIPESVLSEIKKIDGMLEVNLVEL 540


>gi|312792696|ref|YP_004025619.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179836|gb|ADQ40006.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 531

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 45/89 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGRIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    IDG++ +  +EKL     I  V
Sbjct: 498 KAVMVCEIDGALPDEAVEKLKNTDGILRV 526


>gi|291294575|ref|YP_003505973.1| D-3-phosphoglycerate dehydrogenase [Meiothermus ruber DSM 1279]
 gi|290469534|gb|ADD26953.1| D-3-phosphoglycerate dehydrogenase [Meiothermus ruber DSM 1279]
          Length = 521

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 30/89 (33%), Positives = 40/89 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
            GKPR + I +   +      M+  +N D  G+V  VG +LGE  INIA   LGR     
Sbjct: 428 GGKPRIVGIDDHTVEAVPRGFMLVCINRDRPGVVGKVGTLLGENNINIAGMQLGRDNPGG 487

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+  L ID     +VL  L     +  V
Sbjct: 488 KALFVLAIDERPGEAVLSALRGLDVLERV 516


>gi|169830231|ref|YP_001716213.1| D-3-phosphoglycerate dehydrogenase [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637075|gb|ACA58581.1| D-3-phosphoglycerate dehydrogenase [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 526

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 40/97 (41%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR + I     D      M+ I + D   I+  VG ++G++ +NIA   +GR  
Sbjct: 430 LFRGNDPRVVFIDGYRVDAVTEGHMLIIPHIDRPRIIGAVGTLIGQHDVNIAAMQVGRKV 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  +    LE +     I  V+    
Sbjct: 490 IGGRAVMVLMIDSPVPPETLEAIRRVDGILDVRMVSL 526


>gi|258424138|ref|ZP_05687020.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9635]
 gi|257845759|gb|EEV69791.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9635]
          Length = 534

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 50/100 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTK 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|116620780|ref|YP_822936.1| D-3-phosphoglycerate dehydrogenase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223942|gb|ABJ82651.1| D-3-phosphoglycerate dehydrogenase [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 525

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 55/94 (58%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            KPR +++  I  +  +   +I + N D+ G++  VG +LG+  INIA+F LGR + T  
Sbjct: 430 DKPRLLQVDGIYCEAALCGFLIVMKNQDVPGVIGHVGTVLGKNCINIANFSLGRREGTPE 489

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
           A++ +  DG +  SVL +L  +  ++F +  EF+
Sbjct: 490 AVALVSTDGLVPESVLLQLKEHAAVKFARSVEFH 523


>gi|222481126|ref|YP_002567363.1| D-3-phosphoglycerate dehydrogenase [Halorubrum lacusprofundi ATCC
           49239]
 gi|222454028|gb|ACM58293.1| D-3-phosphoglycerate dehydrogenase [Halorubrum lacusprofundi ATCC
           49239]
          Length = 534

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 43/98 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+    R ++I     D      M+   N D  G++  +G +LG+Y +NIA  +  R  
Sbjct: 429 LFAGEDARIVRIDGFRVDAVPYGHMLVARNTDEPGVIGLIGTVLGDYDVNIAGMYNARET 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D  + +  +E L  +  I  V +   +
Sbjct: 489 QGGEALTVYNLDQDVPDEAIEALLADDRIVEVTEITLD 526


>gi|170077862|ref|YP_001734500.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7002]
 gi|169885531|gb|ACA99244.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7002]
          Length = 525

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG  R   I     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGDIRITSINGFPINVPPTGYMLFTLHRDVPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   VL +++    IR  
Sbjct: 489 VRGDAVMVLSLDDPLPEGVLSEITKVTGIRDA 520


>gi|76800791|ref|YP_325799.1| D-3-phosphoglycerate dehydrogenase [Natronomonas pharaonis DSM
           2160]
 gi|76556656|emb|CAI48227.1| phosphoglycerate dehydrogenase [Natronomonas pharaonis DSM 2160]
          Length = 526

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 42/98 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+D   R +++     D   G  M+   N D  G++  +G ++G Y +NIA     R  
Sbjct: 428 LFADDDARIVRVDGYRVDAIPGGKMMVARNTDEPGVIGHIGTVMGTYDVNIAGMFNARET 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D  + +   E+L  +  I   K    N
Sbjct: 488 HGGEALTVYNVDQEVPDEAREELESDDRIIETKYISLN 525


>gi|150399650|ref|YP_001323417.1| D-3-phosphoglycerate dehydrogenase [Methanococcus vannielii SB]
 gi|150012353|gb|ABR54805.1| D-3-phosphoglycerate dehydrogenase [Methanococcus vannielii SB]
          Length = 523

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 45/87 (51%)

Query: 9   FIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISF 68
           F +I     D+     +  I + D  G+V  VG ILGE+GINIA   +GR +   H+I F
Sbjct: 435 FREINGYRMDIKPEGTICIIKHIDRPGMVGKVGLILGEHGINIAGMQVGRKEPGGHSIMF 494

Query: 69  LCIDGSILNSVLEKLSVNVTIRFVKQF 95
           L ID  I   V++++     +R V+  
Sbjct: 495 LDIDHMIPEEVMDEIKKIENVRAVRAI 521


>gi|302390824|ref|YP_003826644.1| D-3-phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM
           5501]
 gi|302202901|gb|ADL11579.1| D-3-phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM
           5501]
          Length = 527

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D   R ++I     +      ++   + D  G+V  +G +LGE  INIA+  LGR  
Sbjct: 431 VFDDTDLRIVEINGYRVNAISEGNLLITNHTDKPGVVGKIGTLLGENDINIANMQLGRHD 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  + ID  + + V EKL     I  +K+   
Sbjct: 491 AGGEAVMVMGIDNELNSEVKEKLLTIDGISDIKEVNL 527


>gi|312878276|ref|ZP_07738197.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311794944|gb|EFR11352.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 531

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 45/89 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGRIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    IDG++ +  +EKL     I  V
Sbjct: 498 KAVMVCEIDGALPDEAVEKLKNTDGILRV 526


>gi|312126868|ref|YP_003991742.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776887|gb|ADQ06373.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 531

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 44/89 (49%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLIIQNIDKPGMIGRIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    IDG + +  +EKL     I  V
Sbjct: 498 KAVMVCEIDGELPDEAVEKLRNTDGILRV 526


>gi|124514290|gb|EAY55804.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum rubarum]
          Length = 535

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF     R + + ++  +V    +MI ++N D  G+V  VG +LG + +NI+    GR  
Sbjct: 434 VFQRKDYRIVSLDDLPVEVVPEPIMIYLINQDQPGVVGSVGTVLGTHKVNISRMQFGRDF 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+S + +D +I   +LE+L     +  +K    
Sbjct: 494 PGGKAVSMIGVDQNIDAKLLEELRALPNVLSLKVLHL 530


>gi|302038732|ref|YP_003799054.1| d-3-phosphoglycerate dehydrogenase [Candidatus Nitrospira defluvii]
 gi|300606796|emb|CBK43129.1| D-3-phosphoglycerate dehydrogenase [Candidatus Nitrospira defluvii]
          Length = 530

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 48/93 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           ++    PR I+I +   +V     ++ I N D  G++  VG+ILG++ INIA     R +
Sbjct: 430 LYHRKDPRIIEIDQFKVEVVPDNHLLLIQNEDRPGVIGTVGHILGDHNINIARMQCSREE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
               A+    +D  +  SVL++++ +  I  VK
Sbjct: 490 RGGKALQIFGLDAPLPKSVLDQITNSKHILSVK 522


>gi|257052567|ref|YP_003130400.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
 gi|256691330|gb|ACV11667.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
          Length = 528

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 45/97 (46%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F+DG+PR + I     +      M+ + NAD  G++ F+G +LGEY +NIA     R   
Sbjct: 426 FADGEPRIVSIDRYWVEAIPHGHMLIVRNADEPGVIGFIGTVLGEYDVNIAGMFNAREAI 485

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
              A+S   +D      VL  L+ +  I      E N
Sbjct: 486 GGEALSVYNLDDEPGEDVLAALNDDDRILETTVVELN 522


>gi|305674943|ref|YP_003866615.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|305413187|gb|ADM38306.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 525

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  + + ++++L+    I  VK  + 
Sbjct: 495 MLSFDRHLEDKIVKELTEVPDIVSVKLIDL 524


>gi|325294449|ref|YP_004280963.1| D-3-phosphoglycerate dehydrogenase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064897|gb|ADY72904.1| D-3-phosphoglycerate dehydrogenase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 529

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  D  P+ ++I    FD+      + I N D+ G++  +G+ILG+Y +NIA F LGR +
Sbjct: 433 VMDDQFPKIVEINGFLFDLTPKGKFLLIKNFDVPGVIGKLGSILGKYNVNIAGFQLGRIE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A   + +D  +    + ++     I  VKQ   
Sbjct: 493 RGKEAKGVILVDNDVPQEAINEIKKIPEILEVKQINL 529


>gi|152990413|ref|YP_001356135.1| D-3-phosphoglycerate dehydrogenase [Nitratiruptor sp. SB155-2]
 gi|151422274|dbj|BAF69778.1| D-3-phosphoglycerate dehydrogenase [Nitratiruptor sp. SB155-2]
          Length = 529

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +   R + I     DV+    MI   N D+ G++  VG IL ++ INIA F LGR  
Sbjct: 434 IFEENVQRIVDINNFALDVEPKGKMILFKNTDVPGVIGEVGMILAKHNINIADFRLGRDN 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
              HA++ + +D  +   VL++LS       V
Sbjct: 494 H-GHALAVIIVDDDVSKEVLKELSNLKACISV 524


>gi|410116|gb|AAA67502.1| phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 419

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 329 RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 388

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  + + ++++L+    I  VK  + 
Sbjct: 389 MLSFDRHLEDKIVKELTNVPDIVSVKLIDL 418


>gi|146296326|ref|YP_001180097.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409902|gb|ABP66906.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 531

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 45/89 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    IDG++ +  +EKL     I  V
Sbjct: 498 KAVMVCEIDGALPDEAVEKLKSVDGILRV 526


>gi|310642598|ref|YP_003947356.1| d-3-phosphoglycerate dehydrogenase [Paenibacillus polymyxa SC2]
 gi|309247548|gb|ADO57115.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus polymyxa SC2]
          Length = 530

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 42/91 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++ +   DV      + I + D  GI+  VG +LGE  +NIA   +GR      AI 
Sbjct: 440 RIVRLNQFPVDVAPEAHFLLISHNDKPGIIGRVGTLLGENSVNIASMQVGRKIVGGEAIM 499

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D ++   VL +L     +   ++   +
Sbjct: 500 ILTVDKAVPKDVLIQLVGLPELNTAQEVVLD 530


>gi|294501109|ref|YP_003564809.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium QM B1551]
 gi|294351046|gb|ADE71375.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium QM B1551]
          Length = 524

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 44/91 (48%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR I I   + D      ++ I ++D  G++  VG +LG+  INIA   +GR Q    AI
Sbjct: 434 PRIINIDSFDIDFYPEGHLLYIRHSDQPGVIGNVGKVLGDLRINIATMQVGRKQKGGEAI 493

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             L  D  + +SV+  L     I  +++ E 
Sbjct: 494 MMLTFDKLLDDSVISSLKQTSEIVTIQRIEL 524


>gi|150402759|ref|YP_001330053.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C7]
 gi|150033789|gb|ABR65902.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C7]
          Length = 523

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 46/87 (52%)

Query: 9   FIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISF 68
           F +I     D+     +  I + D  G+V  VG +LGE+GINIA   +GR +   H+I F
Sbjct: 435 FREINGYRMDIKPEGTICIIKHIDRPGMVGKVGVLLGEHGINIAGMQVGRREPGGHSIMF 494

Query: 69  LCIDGSILNSVLEKLSVNVTIRFVKQF 95
           L +D  I + V+E++     +R VK  
Sbjct: 495 LDVDHMISDDVMEEIQKIENVRAVKSI 521


>gi|206602883|gb|EDZ39364.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum sp. Group II
           '5-way CG']
          Length = 535

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF     R + + ++  +V    +MI ++N D  G+V  VG +LG + +NI+    GR  
Sbjct: 434 VFQRKDYRIVSLDDLPVEVVPEPIMIYLINQDQPGVVGSVGTVLGTHKVNISRMQFGRDF 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+S + +D +I + +LE+L     +  +K    
Sbjct: 494 PGGKAVSMIGVDQNIDSKLLEELRALPNVLSLKVLHL 530


>gi|261406015|ref|YP_003242256.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. Y412MC10]
 gi|261282478|gb|ACX64449.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. Y412MC10]
          Length = 530

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++ +   D+     +I I + D  GI+  VG +LGE  +NIA   +GR      AI 
Sbjct: 440 RIVRLDKFPVDISPEGHLILISHNDKPGIIGRVGTLLGENDVNIASMQVGRKVIGGEAIM 499

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  +   VL KL+    +   +Q   
Sbjct: 500 LLTVDKDVPKDVLIKLTGLSELNTAQQIAL 529


>gi|289581556|ref|YP_003480022.1| D-3-phosphoglycerate dehydrogenase [Natrialba magadii ATCC 43099]
 gi|289531109|gb|ADD05460.1| D-3-phosphoglycerate dehydrogenase [Natrialba magadii ATCC 43099]
          Length = 528

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 45/98 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR +++     D      M+   N D  G++  +G ++G++G+NIA     R  
Sbjct: 428 LFAGDDPRIVRVDGYRVDAIPHGKMVVTRNTDEPGVIGLIGTVMGKHGVNIAGMFNAREA 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D  + ++  ++L+ +  I  V     N
Sbjct: 488 HGGEALTVYNVDSQVPDAAKDELNEDDRIIGVDYITLN 525


>gi|329929876|ref|ZP_08283552.1| phosphoglycerate dehydrogenase [Paenibacillus sp. HGF5]
 gi|328935854|gb|EGG32315.1| phosphoglycerate dehydrogenase [Paenibacillus sp. HGF5]
          Length = 530

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++ +   D+     +I I + D  GI+  VG +LGE  +NIA   +GR      AI 
Sbjct: 440 RIVRLDKFPVDISPEGHLILISHNDKPGIIGRVGTLLGENDVNIASMQVGRKVIGGEAIM 499

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  +   VL KL+    +   +Q   
Sbjct: 500 LLTVDKDVPKDVLIKLTGLSELNTAQQIAL 529


>gi|56752495|ref|YP_173196.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           6301]
 gi|81300310|ref|YP_400518.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           7942]
 gi|56687454|dbj|BAD80676.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           6301]
 gi|81169191|gb|ABB57531.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           7942]
          Length = 546

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  DG+ R   + E   +V   R M+   + D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 450 LLGDGEIRITNVDEFPVNVPPSRYMLFTRHRDMPGIIGKIGSLLGSFNVNIASMQVGRRI 509

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    I   
Sbjct: 510 VRGDAVMVLSLDDPLPEGILAEITKVAGISDA 541


>gi|317121362|ref|YP_004101365.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter marianensis DSM
           12885]
 gi|315591342|gb|ADU50638.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter marianensis DSM
           12885]
          Length = 571

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 43/93 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG PR + +  +  D+     ++   + D  G++  VG++LG   INIA   + R Q   
Sbjct: 443 DGLPRLVHLDGLPLDMVPAPRLLLTRHHDRPGMIGKVGSLLGAREINIAAMQVARRQVRG 502

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            AI  L +D  +  ++L ++     +   +  +
Sbjct: 503 EAIMVLALDDPVPAALLAEIRRLPGMEEARLVQ 535


>gi|315646394|ref|ZP_07899512.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus vortex V453]
 gi|315278037|gb|EFU41357.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus vortex V453]
          Length = 530

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++ +   D+     +I I + D  GI+  VG +LGE  +NIA   +GR      AI 
Sbjct: 440 RIVRLDKFPVDISPEGHLILISHNDKPGIIGRVGTLLGENDVNIASMQVGRKVIGGEAIM 499

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  +   VL KL+    +   +Q   
Sbjct: 500 LLTVDKDVPKDVLIKLTGLAELNTAQQIAL 529


>gi|254412600|ref|ZP_05026373.1| D-3-phosphoglycerate dehydrogenase [Microcoleus chthonoplastes PCC
           7420]
 gi|196180335|gb|EDX75326.1| D-3-phosphoglycerate dehydrogenase [Microcoleus chthonoplastes PCC
           7420]
          Length = 527

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+     I E   +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 LLSDGEIHITSIDEFPINVPPSHHMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  +   +L +++    IR  
Sbjct: 491 VRGDAVMVLSIDDPLPEGILTEITKVPGIRDA 522


>gi|88604291|ref|YP_504469.1| D-3-phosphoglycerate dehydrogenase [Methanospirillum hungatei JF-1]
 gi|88189753|gb|ABD42750.1| D-3-phosphoglycerate dehydrogenase [Methanospirillum hungatei JF-1]
          Length = 528

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 41/93 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V   G  R + I     D+     +I   + D  G++     ILGE+ INIA   +GR Q
Sbjct: 432 VLYKGGARIVSIAGYTMDMVPEGAVIISRHLDRPGVIGRASTILGEHQINIAGMQVGRFQ 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
             E AI  L +DG +   V+E +     I   K
Sbjct: 492 PGEEAIMVLNVDGDVPEEVMEAIRGMPGIYSAK 524


>gi|45359151|ref|NP_988708.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis S2]
 gi|45048026|emb|CAF31144.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis S2]
          Length = 523

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 45/87 (51%)

Query: 9   FIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISF 68
           F +I     D+     +  I + D  G+V  VG +LGE+GINIA   +GR +   H+I F
Sbjct: 435 FREINGYRMDIKPEGTICIIKHIDRPGMVGKVGVLLGEHGINIAGMQVGRREPGGHSIMF 494

Query: 69  LCIDGSILNSVLEKLSVNVTIRFVKQF 95
           L ID  I + VL+++     +R  K  
Sbjct: 495 LDIDHMISDEVLDEIRKMENVRAAKSI 521


>gi|149176983|ref|ZP_01855592.1| phosphoglycerate dehydrogenase [Planctomyces maris DSM 8797]
 gi|148844238|gb|EDL58592.1| phosphoglycerate dehydrogenase [Planctomyces maris DSM 8797]
          Length = 541

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 51/98 (52%), Gaps = 2/98 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR-- 58
           +F     R  ++ E   D  +   ++   + D+ G++ ++G +LG + +NIAH  LGR  
Sbjct: 432 IFGQDFLRLTRLDEFYLDGYLDGNLLIYRHNDVPGLIGYIGTVLGNHNVNIAHMALGRLQ 491

Query: 59  SQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           +Q    AI+ L +DG +  + + ++S +  +  VK  +
Sbjct: 492 NQPGGEAIAVLNVDGEVPEAAIAEVSSHKDVSCVKLIK 529


>gi|296109202|ref|YP_003616151.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus infernus ME]
 gi|295434016|gb|ADG13187.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus infernus ME]
          Length = 523

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 48/90 (53%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           S+ KP  ++I+    +     +++ I + D  G++  VG ILGEYGINIA   +GR +  
Sbjct: 429 SNNKPIILEIEGYEVNFIPESVVLIIRHIDKPGMIGKVGTILGEYGINIAEMQVGRKEPG 488

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             ++  + +D ++   VL+K+     I+  
Sbjct: 489 GDSVMLIKLDHNVPEEVLKKIKEIENIKDA 518


>gi|221310225|ref|ZP_03592072.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221319470|ref|ZP_03600764.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323746|ref|ZP_03605040.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. SMY]
          Length = 525

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  + + ++++L+    I  VK  + 
Sbjct: 495 MLSFDRHLEDKIVKELTNVPDIVSVKLIDL 524


>gi|221314548|ref|ZP_03596353.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|255767495|ref|NP_390188.2| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|321311779|ref|YP_004204066.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis BSn5]
 gi|251757445|sp|P35136|SERA_BACSU RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|225185123|emb|CAB14239.2| 3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291484735|dbj|BAI85810.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp. natto
           BEST195]
 gi|320018053|gb|ADV93039.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis BSn5]
          Length = 525

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  + + ++++L+    I  VK  + 
Sbjct: 495 MLSFDRHLEDKIVKELTNVPDIVSVKLIDL 524


>gi|229543101|ref|ZP_04432161.1| D-3-phosphoglycerate dehydrogenase [Bacillus coagulans 36D1]
 gi|229327521|gb|EEN93196.1| D-3-phosphoglycerate dehydrogenase [Bacillus coagulans 36D1]
          Length = 541

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 46/90 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +K+ +   D+   + ++ I + DI G++  VG+ILG    NI    +GR +    AI 
Sbjct: 438 RIVKLNDYRVDLRPEQHLLYIRHLDIPGMIGQVGSILGSNDTNIGTMQVGRKEIGGEAIM 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D +    VL++L   + I+ V+  E 
Sbjct: 498 VLTLDKTASRQVLDQLKEVIGIKAVQTLEL 527


>gi|15678988|ref|NP_276105.1| D-3-phosphoglycerate dehydrogenase [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|3122860|sp|O27051|SERA_METTH RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|2622068|gb|AAB85466.1| phosphoglycerate dehydrogenase [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 525

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 41/91 (45%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +P  I I     DV     MI     D+ G +  +G  LG++GINIA   +GR +    A
Sbjct: 434 EPTIIGINGYRVDVKPEGTMIIARYRDLPGTIGAIGTKLGQHGINIATMQVGRKEIGGEA 493

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           +  L +D S+   V+E++     +      E
Sbjct: 494 VMVLKVDQSVPAEVIEEVKKLDNVDDAVAIE 524


>gi|167465145|ref|ZP_02330234.1| phosphoglycerate dehydrogenase [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 527

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 37/90 (41%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I     D      ++ + + D  GI+  VG +LG    NIA   +GR      AI 
Sbjct: 438 RIVRIDRFPVDFAPDGHILLVSHNDKPGIIGKVGTLLGTKDFNIATMQVGREIIGGSAIM 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L ID  +   VL++      I  V+    
Sbjct: 498 VLTIDRPVSQDVLDQFVRLPEIVNVRALTL 527


>gi|1146196|gb|AAC83943.1| phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 525

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  + + ++++L+    I  VK  + 
Sbjct: 495 MLSFDRHLEDKIVKELTNVPDIVSVKLIDL 524


>gi|149193714|ref|ZP_01870812.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Caminibacter mediatlanticus
           TB-2]
 gi|149135667|gb|EDM24145.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Caminibacter mediatlanticus
           TB-2]
          Length = 522

 Score =  113 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +  PR ++ +  + + +    MI   N D+ G++  VG  L ++ INIA F LGR++   
Sbjct: 430 ENHPRVVEFKGFDLEFEPKGKMIFFKNTDVPGVIGEVGMTLAKHNINIADFRLGRNKE-G 488

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A++ + +D  +   VL +L        V
Sbjct: 489 QAMAVIIVDNDVNEEVLNELKKLKAALSV 517


>gi|322381790|ref|ZP_08055744.1| D-3-phosphoglycerate dehydrogenase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321154178|gb|EFX46500.1| D-3-phosphoglycerate dehydrogenase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 535

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 37/90 (41%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I     D      ++ + + D  GI+  VG +LG    NIA   +GR      AI 
Sbjct: 446 RIVRIDRFPVDFAPDGHILLVSHNDKPGIIGKVGTLLGTKDFNIATMQVGREIIGGSAIM 505

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L ID  +   VL++      I  V+    
Sbjct: 506 VLTIDRPVSQDVLDQFVRLPEIVNVRALTL 535


>gi|159031923|dbj|BAF91727.1| 3-phosphoglycerate dehydrogenase [Aphanothece halophytica]
          Length = 526

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SD + R   +     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLSDQEMRITNVDGFPINVPPNNYMLFTLHRDMPGIIGKIGSLLGGFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  +   VL+++     IR     + 
Sbjct: 490 VRGDAVMVLSIDDPLPEGVLDEIMKVPGIRDAYTIKL 526


>gi|317182310|dbj|BAJ60094.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F57]
          Length = 524

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 1/92 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFASHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A++ + +D  +   VLE+L        V
Sbjct: 489 QK-EALALIIVDEEVSLKVLEELKNIPACLSV 519


>gi|154151703|ref|YP_001405321.1| D-3-phosphoglycerate dehydrogenase [Candidatus Methanoregula boonei
           6A8]
 gi|154000255|gb|ABS56678.1| D-3-phosphoglycerate dehydrogenase [Methanoregula boonei 6A8]
          Length = 534

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 42/92 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF  G+ R + + +   D+     +I   + D  G++     ILG+  INIA   +GR  
Sbjct: 433 VFVKGRSRIVSVDKYTMDLIPEGYVIVSRHLDKPGVIGRASTILGKCNINIAGMQVGRIN 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + E A+  L +D  +   V++++     I   
Sbjct: 493 AGEEALMVLNVDSEVPEDVMKEIRSMPGIFSA 524


>gi|297619680|ref|YP_003707785.1| D-3-phosphoglycerate dehydrogenase [Methanococcus voltae A3]
 gi|297378657|gb|ADI36812.1| D-3-phosphoglycerate dehydrogenase [Methanococcus voltae A3]
          Length = 525

 Score =  113 bits (285), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 47/94 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG+  F KI   + DV     +  I + D  G+V  VG +LGEYGINIA   +GR +   
Sbjct: 432 DGEVVFRKINGYDIDVKPEGDLCVIRHIDRPGMVGKVGVLLGEYGINIAKMQVGRKEPGG 491

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           H+I  L +D +I   V+ KL     +R  K    
Sbjct: 492 HSIMILDVDHTISEDVMSKLKEMDNVRTAKMVTL 525


>gi|282163065|ref|YP_003355450.1| D-3-phosphoglycerate dehydrogenase [Methanocella paludicola SANAE]
 gi|282155379|dbj|BAI60467.1| D-3-phosphoglycerate dehydrogenase [Methanocella paludicola SANAE]
          Length = 526

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +   R + I     + +    MI  ++ D  G++  VG ILG+  INIA   +GR  
Sbjct: 430 IFGNKDARIVGIDNYRIEANPAGYMIVTMHKDRPGVIGNVGTILGKNDINIAGMVVGREA 489

Query: 61  STEHAISFLCIDGSILNSVLEKL---SVNVTIRFVK 93
               AI  L +D ++   VL+++   +     R+VK
Sbjct: 490 VRGEAIMILNVDDAVPQPVLKEMIEKAGLYDARYVK 525


>gi|221633751|ref|YP_002522977.1| D-3-phosphoglycerate dehydrogenase [Thermomicrobium roseum DSM
           5159]
 gi|221157124|gb|ACM06251.1| phosphoglycerate dehydrogenase SerA [Thermomicrobium roseum DSM
           5159]
          Length = 745

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 20/81 (24%), Positives = 37/81 (45%)

Query: 9   FIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISF 68
            +++   + +  +   M+   + D  GI+  +G ILG Y +NIA   +GR      AI  
Sbjct: 633 IMEVDRFSLERPLAGHMLITHHLDRPGIIGRIGTILGRYEVNIAGMQVGRRARGGEAIMV 692

Query: 69  LCIDGSILNSVLEKLSVNVTI 89
           L +D  I  + L ++     +
Sbjct: 693 LNVDDPIPEAALNEILQIPDV 713


>gi|323489160|ref|ZP_08094392.1| D-3-phosphoglycerate dehydrogenase [Planococcus donghaensis MPA1U2]
 gi|323397047|gb|EGA89861.1| D-3-phosphoglycerate dehydrogenase [Planococcus donghaensis MPA1U2]
          Length = 528

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +    R +K+ +   DV     ++ + + D  G++  VG +LG+  +NIA   +GRS 
Sbjct: 432 LLNGQGARIVKVDDYLVDVVPEGHLLYVSHNDRPGVIGRVGTLLGQENVNIATMQVGRSI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  L ID S   S LE+L+    I+ V     
Sbjct: 492 VGGSAIMMLSIDKSAETSSLEQLAKLDEIQAVTAINL 528


>gi|329727877|gb|EGG64327.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU144]
          Length = 531

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   P  ++I + + D    +  +   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VFAGFGPSIVRINDYSLDFKPNQYQLVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRND 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           +   A+  L ID      V++ L+       +
Sbjct: 493 AGGDALMILSIDQQASEEVIKILNETSGFNKI 524


>gi|119491306|ref|ZP_01623360.1| D-3-phosphoglycerate dehydrogenase [Lyngbya sp. PCC 8106]
 gi|119453470|gb|EAW34632.1| D-3-phosphoglycerate dehydrogenase [Lyngbya sp. PCC 8106]
          Length = 527

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 39/85 (45%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R   I     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR      A+ 
Sbjct: 438 RITNIDGFPINVPPTHHMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKIVRGEAVM 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFV 92
            L ID  +   +L ++     IR  
Sbjct: 498 VLSIDDPLPEGLLSEIMKVPGIRDA 522


>gi|15791207|ref|NP_281031.1| D-3-phosphoglycerate dehydrogenase [Halobacterium sp. NRC-1]
 gi|169236963|ref|YP_001690163.1| D-3-phosphoglycerate dehydrogenase [Halobacterium salinarum R1]
 gi|10581831|gb|AAG20511.1| phosphoglycerate dehydrogenase [Halobacterium sp. NRC-1]
 gi|167728029|emb|CAP14817.1| phosphoglycerate dehydrogenase [Halobacterium salinarum R1]
          Length = 527

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 43/98 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR ++I     +      M+   N D  G++ F+G +LG   +NIA     R  
Sbjct: 428 LFAGDDPRLVEIDGFRVEAAPNGHMLVARNHDTPGVIGFIGGVLGTAEVNIAGMFNAREA 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D  +    L++L+ +  I  V   E N
Sbjct: 488 RGGEALTVYNLDADVPARALDELAGDDRIVDVTSIELN 525


>gi|113477612|ref|YP_723673.1| D-3-phosphoglycerate dehydrogenase [Trichodesmium erythraeum
           IMS101]
 gi|110168660|gb|ABG53200.1| D-3-phosphoglycerate dehydrogenase [Trichodesmium erythraeum
           IMS101]
          Length = 527

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 41/92 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +    + R   I     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 LLGKDEIRITNIDGFPINVPPSPYMLLTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L ++     IR  
Sbjct: 491 VRGDAVMVLSVDDPLPEEILTEILKEPGIRNA 522


>gi|315453857|ref|YP_004074127.1| D-3-phosphoglycerate dehydrogenase [Helicobacter felis ATCC 49179]
 gi|315132909|emb|CBY83537.1| D-3-phosphoglycerate dehydrogenase [Helicobacter felis ATCC 49179]
          Length = 525

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 1/92 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFS+   +   I     D+     MI   N D  G++  VG+ L ++GINIA F LGR+ 
Sbjct: 430 VFSEDILKITNIDGFEMDIQPQGTMILFKNTDKPGVIGNVGHTLAKHGINIADFRLGRNA 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A++ + +D  I +++L  L        V
Sbjct: 490 KK-EALAVILVDTPINSAILHDLQEVPHCLGV 520


>gi|56963608|ref|YP_175339.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
 gi|56909851|dbj|BAD64378.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
          Length = 533

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 43/95 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
            +  PR + I   + DV     ++ I + D  G++  +G +L ++ +NIA   +GR  + 
Sbjct: 439 HEYGPRIVSINGFSVDVVAEGHILYIQHFDRPGVIGKMGQLLAKHDVNIATMQVGRKSAG 498

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             AI  + +D  +  +V++ L     I      + 
Sbjct: 499 GEAIMIVQVDKHVDQTVIDGLLTFDEIAIANVIDL 533


>gi|320101741|ref|YP_004177332.1| D-3-phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
 gi|319749023|gb|ADV60783.1| D-3-phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
          Length = 544

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 43/97 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   + R + +     D D+  +M+   + D  G++  +G ++G + +NIA  ++GR+ 
Sbjct: 437 LFGRQRMRLVGLGPYQIDCDLEGVMLIFTHLDRPGLIGSIGTLMGNHNVNIAQMNVGRAV 496

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  + +D       LE L     +  V   + 
Sbjct: 497 KGGEAIGVVNLDSIPPEEALEALRALPDLYSVTVIQL 533


>gi|304315109|ref|YP_003850256.1| phosphoglycerate dehydrogenase [Methanothermobacter marburgensis
           str. Marburg]
 gi|302588568|gb|ADL58943.1| phosphoglycerate dehydrogenase [Methanothermobacter marburgensis
           str. Marburg]
          Length = 525

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 41/91 (45%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +P  I I     DV     MI     D+ G +  +G  LGE+ INIA   +GR +    A
Sbjct: 434 EPTIIGINGYRVDVKPEGTMIIARYRDLPGTIGAIGTKLGEHQINIATMQVGRKEIGGEA 493

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           +  L +D S+ + V++++     +      E
Sbjct: 494 VMVLKVDQSVPSEVIDEVKKLDNVDDAVAIE 524


>gi|284163372|ref|YP_003401651.1| D-3-phosphoglycerate dehydrogenase [Haloterrigena turkmenica DSM
           5511]
 gi|284013027|gb|ADB58978.1| D-3-phosphoglycerate dehydrogenase [Haloterrigena turkmenica DSM
           5511]
          Length = 528

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 43/98 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR +++     D      M+   N D  G++  +G+++G++ +NIA     R  
Sbjct: 428 LFAGDDPRIVRVDGYRVDAIPHGKMVVTRNTDEPGVIGLIGSVMGDHDVNIAGMFNARET 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D  I +   E+L  +  I  +     N
Sbjct: 488 IGGEALTVYNVDSEIPDGAREELEADERIIGLNYITLN 525


>gi|154686553|ref|YP_001421714.1| D-3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens
           FZB42]
 gi|154352404|gb|ABS74483.1| SerA [Bacillus amyloliquefaciens FZB42]
          Length = 525

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++   N D++    ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVELNGFNIDLNPAGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  + + V+ +L+    I  VK  + 
Sbjct: 495 MLSFDKHLDDKVVNELTSIQDIVSVKLIDL 524


>gi|134046847|ref|YP_001098332.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C5]
 gi|132664472|gb|ABO36118.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C5]
          Length = 523

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 45/87 (51%)

Query: 9   FIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISF 68
           F +I     D+     +  I + D  G+V  VG +LGE+GINIA   +GR +   H+I F
Sbjct: 435 FREINGYRMDIKPEGTICIIKHIDRPGMVGKVGVLLGEHGINIAGMQVGRREPGGHSIMF 494

Query: 69  LCIDGSILNSVLEKLSVNVTIRFVKQF 95
           L +D  I + V+ +++    +R  K  
Sbjct: 495 LDVDHMISDEVMAEITKMENVRAAKSI 521


>gi|257386858|ref|YP_003176631.1| D-3-phosphoglycerate dehydrogenase [Halomicrobium mukohataei DSM
           12286]
 gi|257169165|gb|ACV46924.1| D-3-phosphoglycerate dehydrogenase [Halomicrobium mukohataei DSM
           12286]
          Length = 529

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 44/97 (45%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F+   PR ++I +   D      M+   N D  G + F+G +LGE  INIA    GR   
Sbjct: 430 FAGEDPRIVRIDDHRVDAVPHGHMLVARNRDEPGTIGFIGTVLGESDINIAGMFNGREVI 489

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
              A+S   +D    + VL++L+ +  I   K    +
Sbjct: 490 GGEALSVYNLDEPPTSDVLDRLNGDDRIIETKYISLD 526


>gi|37521708|ref|NP_925085.1| D-3-phosphoglycerate dehydrogenase [Gloeobacter violaceus PCC 7421]
 gi|35212706|dbj|BAC90080.1| D-3-phosphoglycerate dehydrogenase [Gloeobacter violaceus PCC 7421]
          Length = 526

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 43/92 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + ++ + R   I E    V   R M+  ++ D+ GI+  VG+ LG Y +NIA   +GR  
Sbjct: 430 LLAEDELRITNIDEFPISVAPSRYMLITLHRDMPGIIGKVGSFLGSYNVNIAGMQVGRKL 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  + +D  +   +L ++     IR  
Sbjct: 490 VRGDAVMMVSLDDPLPEGLLGEIESVPGIRKA 521


>gi|23100081|ref|NP_693547.1| D-3-phosphoglycerate dehydrogenase [Oceanobacillus iheyensis
           HTE831]
 gi|22778312|dbj|BAC14582.1| phosphoglycerate dehydrogenase [Oceanobacillus iheyensis HTE831]
          Length = 528

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 23/91 (25%), Positives = 43/91 (47%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR +++ E   D+     M+ I + D  G++  +G+ + ++ INIA   + RS     AI
Sbjct: 438 PRLVRVDEYRVDITPEGHMVVIQHRDQPGVIGRMGSTIAKHDINIATMQVDRSDIGGDAI 497

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             L ID  + +  L ++     I+ V   + 
Sbjct: 498 MILTIDRHLADEALNEIESLDEIKSVTAIDL 528


>gi|328552773|gb|AEB23265.1| D-3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens
           TA208]
 gi|328912429|gb|AEB64025.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens LL3]
          Length = 525

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++   N D+     ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVELNGFNIDLHPAGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  + + V+ +L+    I  VK  + 
Sbjct: 495 MLSFDKHLDDKVVNELASIQDIVSVKLIDL 524


>gi|304406983|ref|ZP_07388637.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus curdlanolyticus
           YK9]
 gi|304343970|gb|EFM09810.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus curdlanolyticus
           YK9]
          Length = 530

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 42/91 (46%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I     DV     +I I + D  GI+  VG +LG   +NIA   +GR      AI
Sbjct: 439 PRIVQIDSYPVDVAPEGNLILISHNDKPGIIGRVGTLLGSNDVNIAAMQVGRKLVGGAAI 498

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             L +D     SV+E+++    +   K+   
Sbjct: 499 MVLTVDKGAAKSVIEEVAQLSDLNSAKEIHL 529


>gi|300866531|ref|ZP_07111221.1| D-3-phosphoglycerate dehydrogenase [Oscillatoria sp. PCC 6506]
 gi|300335488|emb|CBN56381.1| D-3-phosphoglycerate dehydrogenase [Oscillatoria sp. PCC 6506]
          Length = 527

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  + + R   + E   +V   R M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 VLGEDEIRITSVDEFPVNVSPSRHMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRRI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L ++     IR  
Sbjct: 491 VRGDAVMVLSLDDPLPEGILAEIIKLAGIRDA 522


>gi|134297895|ref|YP_001111391.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum reducens MI-1]
 gi|134050595|gb|ABO48566.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum reducens MI-1]
          Length = 526

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR + I     +      M+ + + D  GIV  VG ++G+  INIA   +GR +
Sbjct: 430 LFQGNDPRIVNIDGFRINAATQGHMLVVPHIDKPGIVGKVGTVVGDMAINIAGMQVGRIE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  + +D ++  + LE+L+    I  VK    
Sbjct: 490 LGGKAIMVMMVDNTLPTNALEQLATIDGILEVKMVSL 526


>gi|220908749|ref|YP_002484060.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7425]
 gi|219865360|gb|ACL45699.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7425]
          Length = 652

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +    + R   I +   +V   R M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 556 LLGADELRITDIDDFPINVPPTRHMLLTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKM 615

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
              +A+  L +D  +   +L +++    IR  
Sbjct: 616 VRGNAVMVLSLDDPLPEGLLTEITKVSGIRDA 647


>gi|67920676|ref|ZP_00514196.1| D-3-phosphoglycerate dehydrogenase [Crocosphaera watsonii WH 8501]
 gi|67858160|gb|EAM53399.1| D-3-phosphoglycerate dehydrogenase [Crocosphaera watsonii WH 8501]
          Length = 525

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+ R   +     +V     M+  V+ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGEIRITDVDGFPINVPPSNYMLFTVHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    IR  
Sbjct: 489 VRGDAVMALSLDDPLPEGLLNEITKVDGIRDA 520


>gi|34557674|ref|NP_907489.1| D-3-phosphoglycerate dehydrogenase [Wolinella succinogenes DSM
           1740]
 gi|34483391|emb|CAE10389.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Wolinella succinogenes]
          Length = 528

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   R ++I     D++    MI   N D+ G++  +G  L ++ INIA F LGR+ 
Sbjct: 433 VFDENVQRIVEINGFGLDIEPKGRMILFKNTDVPGVIGMIGTTLAKHQINIADFRLGRNN 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++ + +D  +   V+E+L        ++    
Sbjct: 493 HN-QALAVIIVDDDVKKEVIEELRAIKACLGIENVVL 528


>gi|308174098|ref|YP_003920803.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens DSM 7]
 gi|307606962|emb|CBI43333.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens DSM 7]
          Length = 525

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++   N D+     ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVELNGFNIDLHPAGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  + + V+ +L+    I  VK  + 
Sbjct: 495 MLSFDKHLDDKVVNELASIQDIVSVKLIDL 524


>gi|224437370|ref|ZP_03658342.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
 gi|313143835|ref|ZP_07806028.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
 gi|313128866|gb|EFR46483.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
          Length = 526

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/93 (33%), Positives = 45/93 (48%), Gaps = 2/93 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D   R   I +  FD++    MI   N D+ G+V  VG+ILG Y +NIA F L R  
Sbjct: 432 VFEDRHLRITSINQFQFDIEPKGKMIFFKNTDVPGVVGLVGSILGNYKVNIADFRLARQN 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
               A++ + +D  + N  + +L        VK
Sbjct: 492 K--EAMAVILVDSDVPNEAINELEAIPACLGVK 522


>gi|323701688|ref|ZP_08113360.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum nigrificans
           DSM 574]
 gi|323533461|gb|EGB23328.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum nigrificans
           DSM 574]
          Length = 527

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 43/97 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR + I     +      M+ I + D  GIV  VG ++G+  INIA   +GR +
Sbjct: 431 LFQGNDPRVVNIDGYRINAATTGHMLVIPHIDKPGIVGKVGTLVGDKDINIAGMQVGRIE 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  + +D  +    L++++    I  VK    
Sbjct: 491 LGGKAIMVMMVDNIVPQCALDEMAKIDGILEVKMVSL 527


>gi|242374013|ref|ZP_04819587.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W1]
 gi|242348264|gb|EES39866.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W1]
          Length = 531

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 43/92 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +   PR ++I   + D    +  I   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VLAGFGPRIVRINNFSLDFKPNQYQIVTCHKDKPGIVGHTGNLLGNHGINIASMTLGRND 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID    + V++ L  +     +
Sbjct: 493 EGGEALMILSIDQQATDEVIKILEESGGFNKI 524


>gi|147920120|ref|YP_686117.1| D-3-phosphoglycerate dehydrogenase [uncultured methanogenic
           archaeon RC-I]
 gi|110621513|emb|CAJ36791.1| D-3-phosphoglycerate dehydrogenase [uncultured methanogenic
           archaeon RC-I]
          Length = 526

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 3/96 (3%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R ++IQ    D      MI   + D  G++  VG ILG+  INI+   +GR  
Sbjct: 430 IFGKSDARIVEIQGYRVDAVPSGTMIVTRHQDRPGVIGKVGMILGKLNINISGMVVGRDA 489

Query: 61  STEHAISFLCIDGSILNSVLEKL---SVNVTIRFVK 93
               A+  L +D  +  + L+++   +     ++VK
Sbjct: 490 VRGDAVMILTVDDEVPAATLKQMISEAELYDAKYVK 525


>gi|126657695|ref|ZP_01728849.1| phosphoglycerate dehydrogenase [Cyanothece sp. CCY0110]
 gi|126620912|gb|EAZ91627.1| phosphoglycerate dehydrogenase [Cyanothece sp. CCY0110]
          Length = 525

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+ R   +     +V     M+  V+ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGEIRITDVDGFPINVPPSNYMLFTVHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    IR  
Sbjct: 489 VRGDAVMALSLDDPLPEGLLTEITKVSGIRDA 520


>gi|322379237|ref|ZP_08053628.1| D-3-phosphoglycerate dehydrogenase [Helicobacter suis HS1]
 gi|321148377|gb|EFX42886.1| D-3-phosphoglycerate dehydrogenase [Helicobacter suis HS1]
          Length = 524

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 42/92 (45%), Gaps = 1/92 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   +   I     DV     MI   N D  G++  VG  L +Y INIA F LGR+ 
Sbjct: 429 VFADNLLKITNINGFEMDVKPQGTMILFKNTDKPGVIGNVGQTLAKYDINIADFRLGRNS 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             + A++ + +D SI   +L  L        V
Sbjct: 489 K-QEALAVILVDASISPKILHALQEIPYCLSV 519


>gi|172037049|ref|YP_001803550.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. ATCC 51142]
 gi|171698503|gb|ACB51484.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. ATCC 51142]
          Length = 525

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+ R   +     +V     M+  V+ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGEIRITDVDGFPINVPPSNYMLFTVHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    IR  
Sbjct: 489 VRGDAVMALSLDDPLPEGLLTEITKVSGIRDA 520


>gi|327399776|ref|YP_004340645.1| D-3-phosphoglycerate dehydrogenase [Hippea maritima DSM 10411]
 gi|327182405|gb|AEA34586.1| D-3-phosphoglycerate dehydrogenase [Hippea maritima DSM 10411]
          Length = 529

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 51/92 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   K R + +   + ++++   +I   N D  GI+  VG ILG++ INIA F LGR Q
Sbjct: 433 VFEPNKARIVYMDGFDMEIELTGNIIVFRNYDKPGIIGKVGEILGKHNINIADFRLGRKQ 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           +   A+SF+ +D  + +++L+++        +
Sbjct: 493 ALGEALSFIKVDQEVNDAILKEILSIDGAISI 524


>gi|312830102|emb|CBX34944.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ECT-R 2]
          Length = 534

 Score =  112 bits (282), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 49/100 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D   +V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPDMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           +   A+  L +D  + N+++++L        +   E  V 
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQVGEYNQIFTTELTVQ 533


>gi|55379323|ref|YP_137173.1| D-3-phosphoglycerate dehydrogenase [Haloarcula marismortui ATCC
           43049]
 gi|55232048|gb|AAV47467.1| D-3-phosphoglycerate dehydrogenase [Haloarcula marismortui ATCC
           43049]
          Length = 528

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 43/96 (44%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F   +PR ++I +   +      M+ + N D  G + F+G +LGE  INIA    GR   
Sbjct: 430 FGGEEPRIVRIDDHRIEAVPHGHMLVVRNRDEPGTIGFIGTVLGEADINIAGMFNGRETI 489

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              A+S   +D      ++E+L+ +  I      E 
Sbjct: 490 GGEALSVYNLDEQPPQDIIERLNDDSRIIETTYVEL 525


>gi|311068824|ref|YP_003973747.1| D-3-phosphoglycerate dehydrogenase [Bacillus atrophaeus 1942]
 gi|310869341|gb|ADP32816.1| D-3-phosphoglycerate dehydrogenase [Bacillus atrophaeus 1942]
          Length = 525

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVELNGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  +   V+ +LS    I  VK  + 
Sbjct: 495 MLSFDRHLEEKVVNELSDVADIVSVKLIDL 524


>gi|126179793|ref|YP_001047758.1| D-3-phosphoglycerate dehydrogenase [Methanoculleus marisnigri JR1]
 gi|125862587|gb|ABN57776.1| D-3-phosphoglycerate dehydrogenase [Methanoculleus marisnigri JR1]
          Length = 527

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 40/93 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V    + R + I     D+     ++   + D  G++     ILG   +NIA   +GR++
Sbjct: 431 VSGPNRARIVSIGGYMTDLTPTGHVVISRHTDKPGVIGKAATILGSVNVNIAGMQVGRNK 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
             E A+  L +D ++    ++++     I   K
Sbjct: 491 PGEEALMVLTVDSAVPADAMDEIKKIDGIHTAK 523


>gi|312128646|ref|YP_003993520.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778665|gb|ADQ08151.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 531

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEY INIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYDINIAQMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    +DG + N  +EKL     I  V
Sbjct: 498 KAVMVCEVDGIVPNEAIEKLKNTDGILRV 526


>gi|217966485|ref|YP_002351991.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 6724]
 gi|217335584|gb|ACK41377.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 6724]
          Length = 525

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 48/90 (53%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           S  + R + IQ+ + D+ + + M+   + D  GI+  VG +LG+  INIA   +GR +  
Sbjct: 431 SRNQERILAIQDYHLDLALSQYMLIAFHIDRPGIIGQVGTVLGKNNINIAAMQVGRKEIG 490

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  L ID  + + VL +L     I+ V
Sbjct: 491 KDAVMVLVIDNPVDDKVLRELKNIENIKEV 520


>gi|159905466|ref|YP_001549128.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C6]
 gi|159886959|gb|ABX01896.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C6]
          Length = 523

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 28/87 (32%), Positives = 44/87 (50%)

Query: 9   FIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISF 68
           F +I     D+     +  I + D  G+V  VG +LGE+GINIA   +GR +   H+I F
Sbjct: 435 FREINGYRMDIKPEGTICIIKHIDRPGMVGKVGVLLGEHGINIAGMQVGRREPGGHSIMF 494

Query: 69  LCIDGSILNSVLEKLSVNVTIRFVKQF 95
           L +D  I + V+ ++     +R  K  
Sbjct: 495 LDVDHMISDDVMAEIMKIENVRAAKSI 521


>gi|325181642|emb|CCA16093.1| phosphoserine aminotransferase putative [Albugo laibachii Nc14]
          Length = 964

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   +PR I + +++ D      M+   N D  G++  + ++L ++ INI  F L R  
Sbjct: 460 VFGKNQPRLIALNDLSVDCIPTGSMLMFQNQDQPGVLNSITSVLAKHDINIGCFGLARES 519

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              HA+  L +D  I N  +++L     +  ++    
Sbjct: 520 KEAHAVGILNLDDPIPNQAIQELDALDQLSNLRPVTL 556


>gi|158334453|ref|YP_001515625.1| D-3-phosphoglycerate dehydrogenase [Acaryochloris marina MBIC11017]
 gi|158304694|gb|ABW26311.1| D-3-phosphoglycerate dehydrogenase [Acaryochloris marina MBIC11017]
          Length = 527

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  + + R   I +   +V   R M+  V+ D+ GI+  +G+ LG + +NIA   +GR  
Sbjct: 430 ILGEDELRITNIDDFPINVVPTRHMLLTVHRDMPGIIGQIGSQLGSFNVNIASMQVGRKM 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   VL +++    IR  
Sbjct: 490 VRGSAVMVLSLDDPLPEGVLSEITNVEGIRDA 521


>gi|152992147|ref|YP_001357868.1| D-3-phosphoglycerate dehydrogenase [Sulfurovum sp. NBC37-1]
 gi|151424008|dbj|BAF71511.1| D-3-phosphoglycerate dehydrogenase [Sulfurovum sp. NBC37-1]
          Length = 529

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D   R I+I +   DV+    MI   N D  G++  VG IL E G+NI+ F LGR +
Sbjct: 434 VFDDTVQRIIEIDDYILDVEPKGTMIFFRNTDTPGVIGDVGRILAENGLNISDFRLGRDK 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             + A++ + +DG +   VL+ LS       V
Sbjct: 494 K-QQALAVVRVDGQVSKEVLDALSALKACISV 524


>gi|331270622|ref|YP_004397114.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           BKT015925]
 gi|329127172|gb|AEB77117.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           BKT015925]
          Length = 530

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S+ + + ++IQ    DV     M+ + N D+ G++  VG I+G   IN+A   +GR  
Sbjct: 434 LSSNHEGKLVEIQGYEVDVKPSTHMLFVQNKDVPGVIGQVGTIIGMENINVATMQVGRKA 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E A+  L +D  +    L K      I  VK    
Sbjct: 494 KGEIALMILNVDSEVAKESLNKFKEIENIIEVKSTRL 530


>gi|307352504|ref|YP_003893555.1| D-3-phosphoglycerate dehydrogenase [Methanoplanus petrolearius DSM
           11571]
 gi|307155737|gb|ADN35117.1| D-3-phosphoglycerate dehydrogenase [Methanoplanus petrolearius DSM
           11571]
          Length = 528

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 47/93 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V S  K R +KI E   D+  G  ++   + D+ G++     I+G+YG+NIA   +GR+Q
Sbjct: 432 VSSPEKLRIVKIGEYMTDMTPGGDVVISRHHDVPGVIGHFATIIGKYGVNIAGMQVGRNQ 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
             E A+  L +D  +    ++K+     +   K
Sbjct: 492 PGEEAVMVLNVDSEVPQEAMDKILKIEGVYTAK 524


>gi|166367810|ref|YP_001660083.1| D-3-phosphoglycerate dehydrogenase [Microcystis aeruginosa
           NIES-843]
 gi|166090183|dbj|BAG04891.1| D-3-phosphoglycerate dehydrogenase [Microcystis aeruginosa
           NIES-843]
          Length = 525

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S+G+ R   + E   +V     M+  ++ D+ GI+  +G +LG + +NIA   +GR  
Sbjct: 429 LLSNGEIRITDLDEFPINVPPSNHMLFTLHQDMPGIIGKIGALLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    IR  
Sbjct: 489 IRGDAVMALSLDDPLPEGLLSEITKVPGIRDA 520


>gi|314933875|ref|ZP_07841240.1| phosphoglycerate dehydrogenase [Staphylococcus caprae C87]
 gi|313654025|gb|EFS17782.1| phosphoglycerate dehydrogenase [Staphylococcus caprae C87]
          Length = 531

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 40/92 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +   PR ++I + + D       I   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VLAGFGPRIVRINDFSLDFKPNEYQIVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRNN 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID      V+  L        +
Sbjct: 493 EGGDALMILSIDQQASLDVINILRETGGFNRI 524


>gi|222445984|ref|ZP_03608499.1| hypothetical protein METSMIALI_01632 [Methanobrevibacter smithii
           DSM 2375]
 gi|261349477|ref|ZP_05974894.1| phosphoglycerate dehydrogenase [Methanobrevibacter smithii DSM
           2374]
 gi|222435549|gb|EEE42714.1| hypothetical protein METSMIALI_01632 [Methanobrevibacter smithii
           DSM 2375]
 gi|288861840|gb|EFC94138.1| phosphoglycerate dehydrogenase [Methanobrevibacter smithii DSM
           2374]
          Length = 524

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 40/92 (43%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
            P+ +K+ +   DV     M      D+ G +  +G  LGEYGINI    +GR +    A
Sbjct: 433 DPKILKVNDYWVDVKPEGHMFIAKYEDVPGSIGKIGTALGEYGINIGIMQVGRDEKGGRA 492

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           I  L +D  I   V++K+     +      E 
Sbjct: 493 IMILTLDKEIPKEVIKKIQDLDNVYDAIGLEL 524


>gi|223043512|ref|ZP_03613557.1| phosphoglycerate dehydrogenase [Staphylococcus capitis SK14]
 gi|222443000|gb|EEE49100.1| phosphoglycerate dehydrogenase [Staphylococcus capitis SK14]
          Length = 531

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 40/92 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +   PR ++I + + D       I   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VLAGFGPRIVRINDFSLDFKPNEYQIVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRNN 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID      V+  L        +
Sbjct: 493 EGGDALMILSIDQQASLDVINILRETGGFNRI 524


>gi|297584460|ref|YP_003700240.1| D-3-phosphoglycerate dehydrogenase [Bacillus selenitireducens
           MLS10]
 gi|297142917|gb|ADH99674.1| D-3-phosphoglycerate dehydrogenase [Bacillus selenitireducens
           MLS10]
          Length = 536

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 42/91 (46%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I E +F+   G+  + + + D  G++  VG +LG + +NIA   +GR      AI
Sbjct: 446 PRIVRINEFSFEFQPGKHTLFVQHNDRPGVIGKVGQLLGTHDVNIATMQVGRHSEGGKAI 505

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             L  D +    V+        +  V+  E 
Sbjct: 506 MLLGTDKACNGDVITAFETFDEVESVQTIEL 536


>gi|83588894|ref|YP_428903.1| D-3-phosphoglycerate dehydrogenase [Moorella thermoacetica ATCC
           39073]
 gi|83571808|gb|ABC18360.1| D-3-phosphoglycerate dehydrogenase [Moorella thermoacetica ATCC
           39073]
          Length = 525

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 42/93 (45%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+PR + +   + D      ++ I + D   I+  V   +G++G+NIA   +GR +    
Sbjct: 433 GEPRLVNLDGYSVDTIPAGHLLVIPHLDRPRIIGPVALAIGDHGVNIAAMQVGRRERGGQ 492

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           A+  + +D  +  + L+ +     +  V+    
Sbjct: 493 AVMLISVDSEVPRAALDAIRQVDGVLDVRYISL 525


>gi|206901901|ref|YP_002251552.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
 gi|206741004|gb|ACI20062.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
          Length = 525

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 48/90 (53%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           S G+ R + IQ+   D+ + + ++   + D  GI+  VG +LG+  INIA   +GR +  
Sbjct: 431 SRGQERVLAIQDYYLDLALSQYLLIAFHIDRPGIIGKVGTVLGKNNINIAAMQVGRKEIG 490

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  L ID  +   VL++L     I+ V
Sbjct: 491 KDAVMVLVIDNPVDEKVLKELREIENIKEV 520


>gi|94967146|ref|YP_589194.1| D-3-phosphoglycerate dehydrogenase [Candidatus Koribacter
           versatilis Ellin345]
 gi|94549196|gb|ABF39120.1| D-3-phosphoglycerate dehydrogenase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 531

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 2/99 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR-- 58
           V     PR +    I+ +  +   ++ I N DI G+V  VG ILGE+ +NIA+F LGR  
Sbjct: 433 VLHGNSPRLLSFDNIDVEAPLEGTLLVIRNRDIPGVVGRVGTILGEHEVNIANFALGRPS 492

Query: 59  SQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             S  +AI+ + +DG +   VL++L     I      +F
Sbjct: 493 GNSGGNAIAAVQVDGPLKEPVLQQLRQQKAILAANVVQF 531


>gi|310778370|ref|YP_003966703.1| D-3-phosphoglycerate dehydrogenase [Ilyobacter polytropus DSM 2926]
 gi|309747693|gb|ADO82355.1| D-3-phosphoglycerate dehydrogenase [Ilyobacter polytropus DSM 2926]
          Length = 530

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S+ + + ++++  +F+V     M+ + N D+ G++  VG + GE GINIA   +GR  
Sbjct: 434 ISSNAEGKLVELEGYDFEVKPTEYMLFVKNKDVPGVIGHVGTLAGEKGINIATMQVGRKT 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + AI  L ID  + ++ LE+      +   K    
Sbjct: 494 KGDTAIMILTIDEEVSSTTLEEFKKMDNVVTAKSVVL 530


>gi|328952982|ref|YP_004370316.1| D-3-phosphoglycerate dehydrogenase [Desulfobacca acetoxidans DSM
           11109]
 gi|328453306|gb|AEB09135.1| D-3-phosphoglycerate dehydrogenase [Desulfobacca acetoxidans DSM
           11109]
          Length = 526

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 39/97 (40%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   +PR ++I     +      M+ I N D  G++  +G  +G + INIA   +G+ +
Sbjct: 430 IFGRYEPRLVRINAFRLEAVPEGHMLFIYNTDRPGVIGAIGTTIGNHKINIARMTVGQEK 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                I  L  D S+    L  +     +      E 
Sbjct: 490 ERGQNIILLTTDTSVTPECLADVRALPHVASAHPLEL 526


>gi|289193097|ref|YP_003459038.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus sp.
           FS406-22]
 gi|288939547|gb|ADC70302.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus sp.
           FS406-22]
          Length = 524

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 45/89 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + KP  +++           ++  + + D  GI+  VG  LG+YGINIA   +GR +   
Sbjct: 431 NNKPVILEVDGYEVSFIPEGVLAIVKHIDRPGIIGRVGVTLGDYGINIAGMQVGRKEPGG 490

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            ++  + +D ++ + V+EKL     I+ +
Sbjct: 491 DSVMLINLDHTVPDEVVEKLKKIPNIKDI 519


>gi|150391963|ref|YP_001322012.1| D-3-phosphoglycerate dehydrogenase [Alkaliphilus metalliredigens
           QYMF]
 gi|149951825|gb|ABR50353.1| D-3-phosphoglycerate dehydrogenase [Alkaliphilus metalliredigens
           QYMF]
          Length = 526

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+    R + +    FDV     M+   N D  G++  +G++LGE  +NIA   + R  
Sbjct: 430 VFAKKDMRIVDVNGFVFDVTPTPYMLVANNTDKPGMIGKMGSLLGENNVNIATMQVSRKH 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A+ FL +D  +    L  ++    I  +K  + 
Sbjct: 490 KDKEAMMFLAVDSEVNKETLNIINKAEGILQIKFVKL 526


>gi|32265634|ref|NP_859666.1| D-3-phosphoglycerate dehydrogenase [Helicobacter hepaticus ATCC
           51449]
 gi|32261682|gb|AAP76732.1| D-3-phosphoglycerate dehydrogenase [Helicobacter hepaticus ATCC
           51449]
          Length = 526

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 2/93 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D   R   I    FD++    MI   N D+ G++  VG+ILG + +NI+ F L R  
Sbjct: 432 VFEDRHLRLTSINHFQFDIEPKGKMIFFKNTDVPGVIGLVGSILGNHQVNISDFRLARQN 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
               A++ + +D  + N V+ +L        +K
Sbjct: 492 K--EAMAVILVDSEVSNEVIGQLENIPACLSIK 522


>gi|296123070|ref|YP_003630848.1| D-3-phosphoglycerate dehydrogenase [Planctomyces limnophilus DSM
           3776]
 gi|296015410|gb|ADG68649.1| D-3-phosphoglycerate dehydrogenase [Planctomyces limnophilus DSM
           3776]
          Length = 546

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 44/99 (44%), Gaps = 2/99 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLG--R 58
           +F     R +++ + + D  +   ++   + D  G++  +G   G++ +NIAH  +G  R
Sbjct: 433 IFGRQFLRLVRVNQFHLDAYLDGTLLLYRHIDRPGVIGTIGTACGQHNVNIAHMAVGRER 492

Query: 59  SQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           ++    A++ L +D       L  +  N  +  V+    
Sbjct: 493 NEPGGEALAILNLDNEPSAEALAAVQANPAVTSVQLLRL 531


>gi|218247173|ref|YP_002372544.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8801]
 gi|257060245|ref|YP_003138133.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8802]
 gi|218167651|gb|ACK66388.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8801]
 gi|256590411|gb|ACV01298.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8802]
          Length = 525

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  DG+ R   +     +V     M+  V+ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLGDGEIRITDVDGFPINVPPSNYMLFTVHRDMPGIIGKIGSLLGGFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    IR  
Sbjct: 489 VRGDAVMALSLDDPLPEGLLSEITKVAGIRDA 520


>gi|86606026|ref|YP_474789.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. JA-3-3Ab]
 gi|86554568|gb|ABC99526.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. JA-3-3Ab]
          Length = 527

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 44/90 (48%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
            + + R  +I E   +V     M+  ++ D+ GI+  +G +LG Y +NIA   +GR    
Sbjct: 433 GEREVRITQIDEFPVNVPPSANMLMTLHRDMPGIIGRIGTLLGAYNVNIASMQVGRKIIR 492

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  L +D  + + +LE++     IR  
Sbjct: 493 GDAVMVLSLDDPLPDGILEEVLKQPGIRDA 522


>gi|198283146|ref|YP_002219467.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667460|ref|YP_002425374.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|198247667|gb|ACH83260.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218519673|gb|ACK80259.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 527

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  + + R +++  I+ ++ +   ++ I N D  G++  +G +LG  GINIA FHLGR +
Sbjct: 431 LVHEHQARLVQLDGIDVEMPLAGDLLYIQNRDEPGLIGRIGGLLGAAGINIAQFHLGREK 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+SF+ +D  +   +LE+++    +   +    
Sbjct: 491 PAGAALSFIAVDQPLTEVLLEQVASLPGVLAARMLRL 527


>gi|171909940|ref|ZP_02925410.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobium spinosum DSM
           4136]
          Length = 534

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 47/97 (48%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F  G PR +KI     +      ++ + N D  G++   G ILG++ +NIA+  L R++ 
Sbjct: 437 FFGGDPRIVKINGRRVEAKPEGTLLLLENDDRPGMIGAYGTILGQHQVNIANMSLSRNEE 496

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
              A++ L +D +  + V++ L     ++ V     +
Sbjct: 497 GGTAMTLLTLDTAPADVVIKDLETIPGVKRVYCMVLD 533


>gi|325958180|ref|YP_004289646.1| D-3-phosphoglycerate dehydrogenase [Methanobacterium sp. AL-21]
 gi|325329612|gb|ADZ08674.1| D-3-phosphoglycerate dehydrogenase [Methanobacterium sp. AL-21]
          Length = 525

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 41/88 (46%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            +P+ I I     DV+    M+     D  G++  +G  +G++ INIA   +GR +    
Sbjct: 433 DEPKIIMINGYQVDVETEGTMLISKYKDKPGVIGAIGTKIGKHNINIAKMQVGRKELGGE 492

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFV 92
           A+  L +D  +  +V+E+L     +   
Sbjct: 493 AVMVLKVDQQVPLNVIEELKQLEDVNDA 520


>gi|313673092|ref|YP_004051203.1| d-3-phosphoglycerate dehydrogenase [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939848|gb|ADR19040.1| D-3-phosphoglycerate dehydrogenase [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 540

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   R I I    FDV    + +   N D  G++  VG ILG + INIA F L R +
Sbjct: 445 VFNDNIGRVIFIDNFYFDVVPKGIFLYFNNYDRPGVIGKVGTILGNHNINIAGFELSRQK 504

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+F+ +D  I N VL+++     +   K  E 
Sbjct: 505 Q-GQAIAFVSVDNPIGNEVLKEILKIDGMIDAKVLEL 540


>gi|258517404|ref|YP_003193626.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257781109|gb|ACV65003.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 526

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 40/97 (41%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +        + I     DV     M+ + + D   I+  VG ++GE+ INIA   +GR +
Sbjct: 430 LLQGNVAHLVNIDGYRVDVVPSGHMLVVPHYDRPKIIGKVGTLIGEHDINIAAMQVGRKE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  + +  L  ++    I  VK    
Sbjct: 490 IGGKAVMVLTIDDVVPDDTLRAIAQVDGILDVKFVSL 526


>gi|268324733|emb|CBH38321.1| D-3-phosphoglycerate dehydrogenase [uncultured archaeon]
          Length = 542

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 40/97 (41%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR +KI     D      M+     D   ++  V  ILG++ INI    +GR +
Sbjct: 446 LFGKDDPRIVKIDGFWMDASPSGHMLICSFIDKPRVIGPVCTILGDHSINITGMRVGREK 505

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  +   ++E +     +  +K  + 
Sbjct: 506 KEGEAVMVLNVDNPVAGDIIEDIMKVENLIDIKLVKL 542


>gi|251796380|ref|YP_003011111.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. JDR-2]
 gi|247544006|gb|ACT01025.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. JDR-2]
          Length = 530

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I +   DV     +I I + D  GI+  VG +LG   +NIA   +GR      AI 
Sbjct: 440 RVVQIDKFPVDVTPEGNLILISHNDKPGIIGRVGTLLGNNDVNIATMQVGRQLVGGSAIM 499

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D +    +LE+L+    +   K+   
Sbjct: 500 VLTVDKNAGKDILEQLTSLSDLNTAKEITL 529


>gi|223940712|ref|ZP_03632551.1| D-3-phosphoglycerate dehydrogenase [bacterium Ellin514]
 gi|223890639|gb|EEF57161.1| D-3-phosphoglycerate dehydrogenase [bacterium Ellin514]
          Length = 526

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 48/95 (50%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +  +PR +++     +V    ++  + N D  GIV ++G ++G + +NIA   L R  + 
Sbjct: 432 AKKQPRIVRVNGQPVEVVPEGVLFLMTNKDRPGIVGYLGTLMGRHNVNIASMSLSRDIAG 491

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            HA++ L +D     + LE++  +  I  V+  + 
Sbjct: 492 GHALTVLNLDSVPSETALEEIRKDPDISNVRVVKL 526


>gi|86608852|ref|YP_477614.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557394|gb|ABD02351.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 526

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 44/90 (48%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
            + + R  +I E   +V     M+  ++ D+ GI+  +G +LG Y +NIA   +GR    
Sbjct: 432 GEREVRITQIDEFPVNVPPSANMLMTLHRDMPGIIGRIGTLLGAYNVNIASMQVGRKIIR 491

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  L +D  + + +LE++     IR  
Sbjct: 492 GDAVMVLSLDDPLPDGILEEVLKQPGIRDA 521


>gi|312880178|ref|ZP_07739978.1| D-3-phosphoglycerate dehydrogenase [Aminomonas paucivorans DSM
           12260]
 gi|310783469|gb|EFQ23867.1| D-3-phosphoglycerate dehydrogenase [Aminomonas paucivorans DSM
           12260]
          Length = 549

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 48/92 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +G+ R +++ +   D+     ++   N D  G++  VG +LG+ G+NIA+F LGR  
Sbjct: 449 VTEEGRQRVVRLDDYWLDLIPSGRLLLFQNHDRPGVIGKVGTLLGQAGVNIANFALGRKN 508

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            +  A++ L ID  +   +L  L  +  + + 
Sbjct: 509 GSGLALAALQIDQELGEELLSTLRHDGDLIWA 540


>gi|225849496|ref|YP_002729661.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643873|gb|ACN98923.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 529

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 48/94 (51%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F D  PR + +     D++   +++   N D+ G++  +G IL  + INIA F LGR + 
Sbjct: 434 FYDKLPRIMLVDNYWIDIEPSGVILMFENKDVPGVIGKLGTILARHNINIAGFRLGRLEK 493

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            + A+  L +D  +  +VLE++     I   KQ 
Sbjct: 494 GKIALGALQLDDKLNEAVLEEIHQIPEIIKAKQV 527


>gi|224372944|ref|YP_002607316.1| D-3-phosphoglycerate dehydrogenase [Nautilia profundicola AmH]
 gi|223588899|gb|ACM92635.1| D-3-phosphoglycerate dehydrogenase [Nautilia profundicola AmH]
          Length = 522

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +  PR ++ ++ + + +    MI   N D+ G++  VG  L +  INIA F LGR++   
Sbjct: 430 EEHPRIVEFKDFDLEFEPKGKMIFFKNTDVPGVIGEVGMTLAKNNINIADFRLGRNKE-G 488

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A++ + +D  +   VL +L        V
Sbjct: 489 QAMAVIIVDNEVNEDVLNELRNLKAALSV 517


>gi|254422032|ref|ZP_05035750.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7335]
 gi|196189521|gb|EDX84485.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7335]
          Length = 526

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +    + R I +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGGSEVRIIDMDGFPINVPPTQYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  +   +LE++     IR  
Sbjct: 490 VRGDAVMVLSIDDPLPAGILEEIKKEQGIRDA 521


>gi|296332953|ref|ZP_06875410.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|296149804|gb|EFG90696.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
          Length = 517

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 41/82 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR +    AI 
Sbjct: 435 RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTI 89
            L  D  + + ++++L+    I
Sbjct: 495 MLSFDRHLEDKIVKELTEVPDI 516


>gi|269121298|ref|YP_003309475.1| D-3-phosphoglycerate dehydrogenase [Sebaldella termitidis ATCC
           33386]
 gi|268615176|gb|ACZ09544.1| D-3-phosphoglycerate dehydrogenase [Sebaldella termitidis ATCC
           33386]
          Length = 528

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
            + + R ++I +   DV I   M+ + N D+ G++  VG ILGE  +NIA  H+GR ++ 
Sbjct: 436 GNNEERIVEINDYPIDVVISENMLLVENNDVPGVIGNVGRILGEEQVNIATMHVGRKEN- 494

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             AI  L +D  +    ++KL     IR VK    
Sbjct: 495 -SAIMLLTVDDVVEEKSIKKLEEFEQIRKVKYLNL 528


>gi|159027379|emb|CAO90566.1| serA [Microcystis aeruginosa PCC 7806]
          Length = 525

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S G+ R   + E   +V     M+  ++ D+ GI+  +G +LG + +NIA   +GR  
Sbjct: 429 LLSTGEIRITDLDEFPINVPPSNHMLFTLHQDMPGIIGKIGALLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    IR  
Sbjct: 489 IRGDAVMALSLDDPLPEGLLSEITKVPGIRDA 520


>gi|218441675|ref|YP_002380004.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7424]
 gi|218174403|gb|ACK73136.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7424]
          Length = 527

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 49/99 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S+G+ R   + E   +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSNGEIRITDLDEFPINVPPSNYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               A+  L +D  +   +L +++    IR     + ++
Sbjct: 489 VRGDAVMALSLDDPLPEGILSEITKVAGIRDAYTVKLSI 527


>gi|16330470|ref|NP_441198.1| D-3-phosphoglycerate dehydrogenase [Synechocystis sp. PCC 6803]
 gi|3122863|sp|P73821|SERA_SYNY3 RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|1652961|dbj|BAA17878.1| phosphoglycerate dehydrogenase [Synechocystis sp. PCC 6803]
          Length = 554

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 47/92 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S+G+ R   + E   +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 458 LLSNGEIRITDVDEFPINVPPNNYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 517

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               AI  L +D  + + +L +++    IR  
Sbjct: 518 VRGDAIMALSLDDPLPDGLLSEITKVAGIRDA 549


>gi|89099089|ref|ZP_01171968.1| phosphoglycerate dehydrogenase [Bacillus sp. NRRL B-14911]
 gi|89086219|gb|EAR65341.1| phosphoglycerate dehydrogenase [Bacillus sp. NRRL B-14911]
          Length = 524

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 41/91 (45%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR + +   N D      ++ I + D  G++  VG +LG++ INIA   +GR ++   AI
Sbjct: 434 PRIVFLNGFNIDFLPEGELLYIQHMDRPGVIGRVGKVLGDHSINIAAMQVGRKEAGGEAI 493

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             L  D  +  S  + L     I  ++    
Sbjct: 494 MVLSFDKPLGESSFKLLEGQEDIVSIRNISL 524


>gi|154147887|ref|YP_001406068.1| D-3-phosphoglycerate dehydrogenase [Campylobacter hominis ATCC
           BAA-381]
 gi|153803896|gb|ABS50903.1| phosphoglycerate dehydrogenase [Campylobacter hominis ATCC BAA-381]
          Length = 525

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D + R + I     D      MI   N D+ G++  V  IL +  INIA F LGR +
Sbjct: 430 VFNDDEERILNIDGFKTDFKPKGKMIIFKNTDVPGVIASVSAILAKDKINIADFRLGRGE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + +D  I  SVL++LS   T    +    
Sbjct: 490 D-GNALAVILVDEDISKSVLDELSALSTCLLARYVVL 525


>gi|22297868|ref|NP_681115.1| D-3-phosphoglycerate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
 gi|22294046|dbj|BAC07877.1| D-3-phosphoglycerate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
          Length = 527

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 43/92 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S  + R   I +    V   R M+  ++ D+ GI+  +G  LG + +NIA   +GR  
Sbjct: 431 LLSHNELRITSIDDFPISVAPTRYMLLTLHRDMPGIIGKIGTQLGSFNVNIASMQVGRKM 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
              +A+  + +D  +   +LE++     IR  
Sbjct: 491 VRGNAVMVISLDDPLPEGLLEEILKVPGIRDA 522


>gi|313682014|ref|YP_004059752.1| d-3-phosphoglycerate dehydrogenase [Sulfuricurvum kujiense DSM
           16994]
 gi|313154874|gb|ADR33552.1| D-3-phosphoglycerate dehydrogenase [Sulfuricurvum kujiense DSM
           16994]
          Length = 529

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F+D   R + I     DV+    MI   N D+ G++  VG +L  + +NIA F LGR++S
Sbjct: 435 FNDDVQRIVDINGFGVDVEPKGNMILFKNTDVPGVIGQVGTLLAAHEVNIADFRLGRNKS 494

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           +  A++ + +D ++ +  L++LS       V
Sbjct: 495 S-EALAVIIVDSAVNDKTLKELSNLNACISV 524


>gi|196233471|ref|ZP_03132314.1| D-3-phosphoglycerate dehydrogenase [Chthoniobacter flavus Ellin428]
 gi|196222467|gb|EDY16994.1| D-3-phosphoglycerate dehydrogenase [Chthoniobacter flavus Ellin428]
          Length = 530

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 47/96 (48%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F    PR +K+   + +     ++    N D  G+V  VG +LG++ +NIA   L R++ 
Sbjct: 435 FFGTTPRIVKVNGRHVEAKPEGVLFLFENRDRPGVVGHVGTLLGKHKVNIAGMSLSRNEE 494

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              A++ L +D     +++++L+    I  V+  + 
Sbjct: 495 GGEALTLLNLDSVPSEAIIKELTAGGDIHSVQVVQL 530


>gi|148654451|ref|YP_001274656.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus sp. RS-1]
 gi|148566561|gb|ABQ88706.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus sp. RS-1]
          Length = 524

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 38/91 (41%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+P  ++             M+   + D  G++  VG +LGE  +NIA   +GR    E 
Sbjct: 432 GEPHVVEADGFWVTFVPEGPMLFTYHRDRPGMIGKVGTLLGEADVNIASMDVGRLAPREQ 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           A+  L +D  +   V+ +L     I+     
Sbjct: 492 AMMVLRLDDPVPPHVIARLREEPDIQHATTL 522


>gi|148642517|ref|YP_001273030.1| D-3-phosphoglycerate dehydrogenase [Methanobrevibacter smithii ATCC
           35061]
 gi|148551534|gb|ABQ86662.1| D-3-phosphoglycerate dehydrogenase, SerA [Methanobrevibacter
           smithii ATCC 35061]
          Length = 524

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 39/92 (42%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
            P+ +K+ +   DV     M      D+ G +  +G  LGEYGINI    +GR +    A
Sbjct: 433 DPKILKVNDYWVDVKPEGHMFIAKYEDVPGSIGKIGTALGEYGINIGIMQVGRDEKGGRA 492

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           I  L +D  I   V++ +     +      E 
Sbjct: 493 IMILTLDKEIPKEVIKGIQDLDNVYDAIGLEL 524


>gi|313902560|ref|ZP_07835960.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter subterraneus
           DSM 13965]
 gi|313467126|gb|EFR62640.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter subterraneus
           DSM 13965]
          Length = 579

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 41/93 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR + +  +  D+     ++   + D  G++  VG +LG   INIA   + R Q   
Sbjct: 437 EGLPRLVHLDGLPLDMVPAPRLLLTRHHDRPGMIGKVGGLLGMGEINIAAMQVARRQVRG 496

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            AI  L +D  +  S+L ++     +   +   
Sbjct: 497 EAIMVLALDDPLPPSLLAEIRRLPGMEEARLVH 529


>gi|257461292|ref|ZP_05626389.1| phosphoglycerate dehydrogenase [Campylobacter gracilis RM3268]
 gi|257441320|gb|EEV16466.1| phosphoglycerate dehydrogenase [Campylobacter gracilis RM3268]
          Length = 535

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   + R + I     D      MI   N D+ G++  V  IL +  INIA F LGR +
Sbjct: 440 VFDGSEERIVNIGGFKTDFKPKGKMIIFKNTDVPGVIKSVSTILADENINIADFRLGRGE 499

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
               A++ + +D  +  S L+KL+   T   V+
Sbjct: 500 E-GDALAVILVDSEVQKSTLDKLAALQTCLMVR 531


>gi|283782491|ref|YP_003373246.1| D-3-phosphoglycerate dehydrogenase [Pirellula staleyi DSM 6068]
 gi|283440944|gb|ADB19386.1| D-3-phosphoglycerate dehydrogenase [Pirellula staleyi DSM 6068]
          Length = 542

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 47/99 (47%), Gaps = 2/99 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS- 59
           +F +  PR I++ +   +  +   ++   + D+ GI+  VG I G + +NI    +GR+ 
Sbjct: 432 LFGNNMPRLIRLGDYRLEAYLDGNLLIFTHHDVPGIIGAVGTIFGNHKVNIGQMSVGRAG 491

Query: 60  -QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                 A+  L +D     + ++++  +  I+ VK  E 
Sbjct: 492 IIPGGGAVGVLNLDNVPPQAAIDEVQQHPDIQSVKIIEL 530


>gi|209523822|ref|ZP_03272375.1| D-3-phosphoglycerate dehydrogenase [Arthrospira maxima CS-328]
 gi|209495854|gb|EDZ96156.1| D-3-phosphoglycerate dehydrogenase [Arthrospira maxima CS-328]
          Length = 527

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D + R   I +   +V   R M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 LLGDREIRVTNIDDFPINVPPTRYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  + + +L ++     IR  
Sbjct: 491 VRGEAVMVLSLDDPLPDGLLSEIMKVAGIRDA 522


>gi|284052483|ref|ZP_06382693.1| D-3-phosphoglycerate dehydrogenase [Arthrospira platensis str.
           Paraca]
 gi|291569633|dbj|BAI91905.1| D-3-phosphoglycerate dehydrogenase [Arthrospira platensis NIES-39]
          Length = 527

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D + R   I +   +V   R M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 LLGDREIRVTNIDDFPINVPPTRYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  + + +L ++     IR  
Sbjct: 491 VRGEAVMVLSLDDPLPDGLLSEIMKVAGIRDA 522


>gi|119717608|ref|YP_924573.1| D-3-phosphoglycerate dehydrogenase [Nocardioides sp. JS614]
 gi|119538269|gb|ABL82886.1| D-3-phosphoglycerate dehydrogenase [Nocardioides sp. JS614]
          Length = 536

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 44/94 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + K R +++   + D++    +  +   D  G+V  VG I+G+ GINIA   + R     
Sbjct: 442 NQKERLVEVNGFDVDLEPTEHLAFLTYEDRPGMVGTVGVIIGDAGINIAGMQVARDAKGG 501

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D +I   VL ++   +    V+  + 
Sbjct: 502 RALVALSVDTAIPAEVLAEMQHAIDAISVRAVDL 535


>gi|121535994|ref|ZP_01667786.1| D-3-phosphoglycerate dehydrogenase [Thermosinus carboxydivorans
           Nor1]
 gi|121305430|gb|EAX46380.1| D-3-phosphoglycerate dehydrogenase [Thermosinus carboxydivorans
           Nor1]
          Length = 528

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 45/98 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   + R + I     DVD    ++   + D  G+V  VG ILGE+ INIA   +GR++
Sbjct: 429 LFGKTEGRIVMIDGYRVDVDPQGWLLIGPHIDKPGMVGKVGTILGEHNINIAGMQVGRTE 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
                I  + ++  I   V+ K+     I   K   FN
Sbjct: 489 QAGTNIMVMAVESDIPTPVMLKIKAVDGILGAKLVNFN 526


>gi|220928617|ref|YP_002505526.1| D-3-phosphoglycerate dehydrogenase [Clostridium cellulolyticum H10]
 gi|219998945|gb|ACL75546.1| D-3-phosphoglycerate dehydrogenase [Clostridium cellulolyticum H10]
          Length = 535

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+  + R +       D +    ++ I N D+ GI+  +G ILG   INIA     R+ 
Sbjct: 439 VFAIQEIRVVDFFGYKLDFEPTPYVLAIQNVDVPGIIGQIGTILGASDINIAAMQWSRNH 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E A++F+ +D  +  +VLE L     +  V   +F
Sbjct: 499 KGEKAVAFVSVDCEVPANVLELLKKINGVLKVTLLKF 535


>gi|289550521|ref|YP_003471425.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus lugdunensis
           HKU09-01]
 gi|289180053|gb|ADC87298.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus lugdunensis
           HKU09-01]
          Length = 539

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 40/92 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V     PR I+I + + D       +   + D+ GIV   G +LG   INIA   LGR+ 
Sbjct: 434 VIEGFGPRIIRINDFSVDFQPNAYQLITYHNDVPGIVGRTGALLGREQINIASMSLGRNT 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  + +D  I + V++ L        +
Sbjct: 494 EGGQAMMIIAVDQPITDKVIQHLKQTQQFTKI 525


>gi|188996207|ref|YP_001930458.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931274|gb|ACD65904.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 529

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 47/92 (51%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           D  PR + +     D++   +++   N D+ G++  +G +L ++ +NIA F LGR +  +
Sbjct: 436 DKFPRIMMVDNYWIDIEPQGVILMFENKDVPGVIGKLGTLLAKHNVNIAGFRLGRLEKGK 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            A+  L +D  +   VLE++     I   KQ 
Sbjct: 496 IALGALQLDDRLNEEVLEEIHQIPEIIKAKQV 527


>gi|315658015|ref|ZP_07910888.1| phosphoglycerate dehydrogenase [Staphylococcus lugdunensis M23590]
 gi|315496905|gb|EFU85227.1| phosphoglycerate dehydrogenase [Staphylococcus lugdunensis M23590]
          Length = 539

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 40/92 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V     PR I+I + + D       +   + D+ GIV   G +LG   INIA   LGR+ 
Sbjct: 434 VIEGFGPRIIRINDFSVDFQPNAYQLITYHNDVPGIVGRTGALLGREQINIASMSLGRNT 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  + +D  I + V++ L        +
Sbjct: 494 EGGQAMMIIAVDQPITDKVIQHLKQTQQFTKI 525


>gi|156740285|ref|YP_001430414.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus castenholzii DSM
           13941]
 gi|156231613|gb|ABU56396.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus castenholzii DSM
           13941]
          Length = 524

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 38/91 (41%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+P  ++             M+   + D  G++  VG +LGE  +NIA   +GR    E 
Sbjct: 432 GEPHVVEADGFWVTFVPAGPMLFTYHRDRPGMIGKVGTLLGEADVNIASMDVGRLAPREQ 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           A+  L +D  +   V+ +L     I+     
Sbjct: 492 AMMVLRLDDPVPPHVIARLREEPDIQHATTL 522


>gi|51891147|ref|YP_073838.1| D-3-phosphoglycerate dehydrogenase [Symbiobacterium thermophilum
           IAM 14863]
 gi|51854836|dbj|BAD38994.1| phosphoglycerate dehydrogenase [Symbiobacterium thermophilum IAM
           14863]
          Length = 540

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 42/94 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG  RF+ +  ++ D+   R M+   + D  G+V   G  L    INIA  HLGR Q   
Sbjct: 441 DGGMRFVAVDGLHIDMAPSRHMLVSQHRDQPGMVGRFGMALAARDINIAGLHLGRHQPRG 500

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L ID      ++ +L   + +  V+    
Sbjct: 501 MALMLLQIDEPAPPDLVAELREAMAVDTVQAVTL 534


>gi|295836361|ref|ZP_06823294.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB74]
 gi|295825983|gb|EFG64595.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB74]
          Length = 531

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E   D+ +   M+ +  AD  G+V  VG +LGE GINIA   + R++    A++
Sbjct: 441 KIVAIGEHTVDLALADHMVVLRYADRPGVVGTVGRVLGEAGINIAGMQVSRAEEGGEALA 500

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D S+   VL +++        +    
Sbjct: 501 VLTVDDSVPADVLAEVAQETGATSARAVNL 530


>gi|256810586|ref|YP_003127955.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus fervens
           AG86]
 gi|256793786|gb|ACV24455.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus fervens
           AG86]
          Length = 525

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 45/90 (50%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           ++ KP  +++     +     ++  + + D  G +  V   LG+YGINIA   +GR +  
Sbjct: 430 ANNKPVILEVDGYEVNFIPEGVLAIVKHVDRPGTIGRVCITLGDYGINIAGMQVGRKEPG 489

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             ++  L +D ++ + V+EK+     I+ V
Sbjct: 490 GESVMLLNLDHTVPDEVVEKIKEIPNIKDV 519


>gi|318061963|ref|ZP_07980684.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. SA3_actG]
 gi|318077433|ref|ZP_07984765.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. SA3_actF]
          Length = 531

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E   D+ +   M+ +  AD  G+V  VG +LGE GINIA   + R++    A++
Sbjct: 441 KIVAIGEHTVDLALADHMVVLRYADRPGVVGTVGRVLGESGINIAGMQVSRAEEGGEALA 500

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D S+   VL +++        +  + 
Sbjct: 501 VLTVDDSVPADVLAEVAQETGATSARAVDL 530


>gi|292657076|ref|YP_003536973.1| D-3-phosphoglycerate dehydrogenase [Haloferax volcanii DS2]
 gi|291370333|gb|ADE02560.1| D-3-phosphoglycerate dehydrogenase [Haloferax volcanii DS2]
          Length = 525

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 1/98 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS- 59
           +F+   PR ++I     D      M+   N D  G++ F+G +LGE  +NIA     R  
Sbjct: 428 LFTGEDPRIVRINGYRLDAIPYGQMLVARNYDKPGVIGFIGTVLGENDVNIAGMFNARRA 487

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           ++   A++   +D  +  SV EKL  +  I  V     
Sbjct: 488 KAGGEALTVYNLDDDVPESVREKLLADARIIDVDLITL 525


>gi|302522080|ref|ZP_07274422.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB78]
 gi|302430975|gb|EFL02791.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB78]
          Length = 531

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E   D+ +   M+ +  AD  G+V  VG +LGE GINIA   + R++    A++
Sbjct: 441 KIVAIGEHTVDLALADHMVVLRYADRPGVVGTVGRVLGESGINIAGMQVSRAEEGGEALA 500

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D S+   VL +++        +  + 
Sbjct: 501 VLTVDDSVPADVLAEVAQETGATSARAVDL 530


>gi|219851104|ref|YP_002465536.1| D-3-phosphoglycerate dehydrogenase [Methanosphaerula palustris
           E1-9c]
 gi|219545363|gb|ACL15813.1| D-3-phosphoglycerate dehydrogenase [Methanosphaerula palustris
           E1-9c]
          Length = 532

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 42/93 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFS  + R + I     D+D    ++   + D  G++     ILG   +NIA   +GR +
Sbjct: 436 VFSKVRSRIVAIGGYTMDLDPTGFLVISRHLDKPGVIGRASTILGHCEVNIAGMQVGRIR 495

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
             E AI  L +D  + +  ++++     I   K
Sbjct: 496 PGEEAIMVLNVDSEVSDEAMDEIRSMPGIFSAK 528


>gi|307152719|ref|YP_003888103.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7822]
 gi|306982947|gb|ADN14828.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7822]
          Length = 525

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  +G+ R   + E   +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLGNGEIRITDLDEFPINVPPSNYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    IR  
Sbjct: 489 VRGDAVMALSLDDPLPEGILSEITKVAGIRDA 520


>gi|311030775|ref|ZP_07708865.1| D-3-phosphoglycerate dehydrogenase [Bacillus sp. m3-13]
          Length = 524

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 39/90 (43%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R + +   + D      ++ + + D  G++  +G I G++  NIA  H+GR      AI 
Sbjct: 435 RIVHMNGFDIDFAPSGHLLYVQHTDRPGVIGQLGLIFGKHETNIATMHVGRMLQGGKAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  +   +++++ +   I      E 
Sbjct: 495 MLSFDQPLEKVLVDEILLIPDISSAITLEL 524


>gi|219850460|ref|YP_002464893.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aggregans DSM
           9485]
 gi|219544719|gb|ACL26457.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aggregans DSM
           9485]
          Length = 525

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 40/93 (43%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+P  +++     D      ++   + D  G++  VG +LG   +NI+  ++GR    E 
Sbjct: 433 GEPHIVQMDGYFVDFVPQGSLLITYHHDQPGMIGKVGQLLGAADVNISGMYVGRRAPREQ 492

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           A+  L +D      V+E+++    I        
Sbjct: 493 AVMVLTLDEPAPPQVMEQVAAIPGIDAAYSVTL 525


>gi|284929797|ref|YP_003422319.1| D-3-phosphoglycerate dehydrogenase [cyanobacterium UCYN-A]
 gi|284810241|gb|ADB95938.1| D-3-phosphoglycerate dehydrogenase [cyanobacterium UCYN-A]
          Length = 525

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+ R   +     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGEIRITNVDLFPINVPPSNHMLFTIHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  + +D  + +S+L ++     IR     + 
Sbjct: 489 VRGDAVMAVSLDDPLPDSLLLEIMKVTGIRDAYTIKL 525


>gi|239928756|ref|ZP_04685709.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
 gi|291437078|ref|ZP_06576468.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
 gi|291339973|gb|EFE66929.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
          Length = 529

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + + + D+ +   M+ +   D  G+V  VG ILGE GINIA   + R+     A++
Sbjct: 439 KIVAVGDYDVDLALADHMVVLRYEDRPGVVGTVGRILGEAGINIAGMQVARAAVGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++  +VL +L+  +     +    
Sbjct: 499 VLTVDDTVSAAVLGELAAEIGATSARSVNL 528


>gi|163845877|ref|YP_001633921.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222523594|ref|YP_002568064.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus sp. Y-400-fl]
 gi|163667166|gb|ABY33532.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222447473|gb|ACM51739.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus sp. Y-400-fl]
          Length = 525

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 42/93 (45%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+P  +++     D      ++   + D  G++  VG +LG   +NI+  ++GR    E 
Sbjct: 433 GEPHIVQMDGYFVDFVPQGSLLITYHHDQPGMIGKVGQLLGAADVNISGMYVGRRAPRER 492

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           A+  L +D      V+E+++    I+     E 
Sbjct: 493 AVMVLTLDEPAPPQVMEQIATIPGIQAAFSVEL 525


>gi|298491116|ref|YP_003721293.1| D-3-phosphoglycerate dehydrogenase ['Nostoc azollae' 0708]
 gi|298233034|gb|ADI64170.1| D-3-phosphoglycerate dehydrogenase ['Nostoc azollae' 0708]
          Length = 526

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGDKEIHLTDVDGFPINVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  + + +L++++    IR  
Sbjct: 490 VRGDAVMALSIDDPLPDGILDEITKVPGIRDA 521


>gi|75909963|ref|YP_324259.1| D-3-phosphoglycerate dehydrogenase [Anabaena variabilis ATCC 29413]
 gi|75703688|gb|ABA23364.1| D-3-phosphoglycerate dehydrogenase [Anabaena variabilis ATCC 29413]
          Length = 526

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGDKEIHLTDVDGFPINVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  + + +L +++    IR  
Sbjct: 490 VRGDAVMALSIDDPLPDGILAEITKVPGIRDA 521


>gi|15669207|ref|NP_248012.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus jannaschii
           DSM 2661]
 gi|3122874|sp|Q58424|SERA_METJA RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|1591676|gb|AAB99020.1| phosphoglycerate dehydrogenase (serA) [Methanocaldococcus
           jannaschii DSM 2661]
          Length = 524

 Score =  108 bits (270), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 42/89 (47%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + KP  +++           ++  I + D  G +  V   LG+YGINIA   +GR +   
Sbjct: 431 NNKPVILEVDGYEVSFIPEGVLAIIKHIDRPGTIGRVCITLGDYGINIASMQVGRKEPGG 490

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            ++  L +D ++   V+EK+     I+ V
Sbjct: 491 ESVMLLNLDHTVPEEVIEKIKEIPNIKDV 519


>gi|218679036|ref|ZP_03526933.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli CIAT 894]
          Length = 231

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/62 (54%), Positives = 45/62 (72%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 156 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 215

Query: 61  ST 62
           + 
Sbjct: 216 AG 217


>gi|237756137|ref|ZP_04584709.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237691701|gb|EEP60737.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 529

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 47/92 (51%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           D  PR + +     D++   +++   N D+ G++  +G +L ++ +NIA F LGR +  +
Sbjct: 436 DKFPRIMMVDNYWIDIEPQGVILMFENKDVPGVIGKLGTLLAKHNVNIAGFRLGRLEKGK 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            A+  L +D  +   +LE++     I   KQ 
Sbjct: 496 IALGALQLDDRLNEEILEEIHQIPEIIKAKQV 527


>gi|261403538|ref|YP_003247762.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus vulcanius
           M7]
 gi|261370531|gb|ACX73280.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus vulcanius
           M7]
          Length = 524

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 43/89 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + KP  + +   + +      +  I + D  G +  V  +LG+YGINIA   +GR +   
Sbjct: 431 NNKPVILDVDGYDVNFIPEGALAIIKHIDRPGTIGRVCILLGDYGINIAGMQVGRKEPGG 490

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            ++  L +D ++   V+EK+     I+ V
Sbjct: 491 ESVMLLNLDHTVPEDVIEKIKEIPNIKDV 519


>gi|150400998|ref|YP_001324764.1| D-3-phosphoglycerate dehydrogenase [Methanococcus aeolicus
           Nankai-3]
 gi|150013701|gb|ABR56152.1| D-3-phosphoglycerate dehydrogenase [Methanococcus aeolicus
           Nankai-3]
          Length = 523

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 42/94 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G P   +I     D+    ++  I + D  GI+     +LG+YG+NIA   +GR +   
Sbjct: 430 EGAPVLKEINNYKIDIKPEGIVCVIKHMDKPGIIGKASTLLGDYGVNIAGMQVGRQEPGG 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            ++  L +D  I   V+ KL     I   K  + 
Sbjct: 490 ESVMVLNLDHVITEEVISKLKNIDNIIDAKIIKL 523


>gi|153952246|ref|YP_001398036.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939692|gb|ABS44433.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 527

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKIDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDS 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|294631551|ref|ZP_06710111.1| phosphoglycerate dehydrogenase [Streptomyces sp. e14]
 gi|292834884|gb|EFF93233.1| phosphoglycerate dehydrogenase [Streptomyces sp. e14]
          Length = 529

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +   D  G+V  VG I+GE G+NIA   + R+     A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLRYEDRPGVVGTVGRIIGEAGVNIAGMQVARAAVGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++  +VL ++S  +     +    
Sbjct: 499 VLTVDDTVPPAVLSEVSAEIGATSARSVNL 528


>gi|85859018|ref|YP_461220.1| D-3-phosphoglycerate dehydrogenase [Syntrophus aciditrophicus SB]
 gi|85722109|gb|ABC77052.1| D-3-phosphoglycerate dehydrogenase [Syntrophus aciditrophicus SB]
          Length = 527

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 45/96 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I +   DV     ++ + N D  G++  +G  +G   INIA  H  R Q
Sbjct: 431 LFGRRDPRIVRINQFTVDVIPEGHLLMLYNHDKPGVIGNIGTAIGSANINIARMHWSRLQ 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + + A+     D  +   +L+KL     +  V++ +
Sbjct: 491 AEQKAMVVFSTDTPVDAQLLKKLKETPNVISVQELD 526


>gi|226225601|ref|YP_002759707.1| D-3-phosphoglycerate dehydrogenase [Gemmatimonas aurantiaca T-27]
 gi|226088792|dbj|BAH37237.1| D-3-phosphoglycerate dehydrogenase [Gemmatimonas aurantiaca T-27]
          Length = 534

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 47/95 (49%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G PR  +I   + DV+  + ++ + N D+ G++  VG +LGE G+NIA +H  R    
Sbjct: 437 EGGTPRLTRIGSFHVDVNPRQTLLVLTNHDVPGVIGRVGTLLGERGVNIAEYHQARLAQG 496

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A++ + +DG++     + L     +R      F
Sbjct: 497 GDALAAVSVDGTVSEETRKALLELSDVRSASIVHF 531


>gi|91202994|emb|CAJ72633.1| similar to D-3-phosphoglycerate dehydrogenase (PGDH) [Candidatus
           Kuenenia stuttgartiensis]
          Length = 535

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 39/92 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   +PR + I     +  +   ++ +   D  G +  VG++LG   INIAH   GR +
Sbjct: 439 VFGKNEPRLVDINGYGVEAILNEQILVLFGRDKPGFIGQVGSLLGNKNINIAHMTFGRKE 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
              + IS L ID       L ++     I   
Sbjct: 499 VGGNTISILNIDAVPPQDCLNEIKQLNHIDAA 530


>gi|57167923|ref|ZP_00367063.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
 gi|57021045|gb|EAL57709.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
          Length = 527

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFQTDFKPKGKMIIFKNKDIPGVIAKISSVLASKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VLE+L       FV+  E
Sbjct: 492 F-GYALAVVLIDEKVQKEVLEELRQLEACIFVQYVE 526


>gi|308274573|emb|CBX31172.1| D-3-phosphoglycerate dehydrogenase [uncultured Desulfobacterium
           sp.]
          Length = 526

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 41/97 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I     ++     +  + N D  G +  +G +LG   INI    +G+ +
Sbjct: 430 IFGKKDPRIVRINNFRLEMHPSGHLALVHNLDKPGAIGSIGTVLGRNSINIGRMQVGQEE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E  I  L  D  I   VLE+L     ++ V   E 
Sbjct: 490 EGERNIILLKTDLPIPEPVLEELKALPLVKTVTLLEL 526


>gi|305432051|ref|ZP_07401218.1| phosphoglycerate dehydrogenase [Campylobacter coli JV20]
 gi|304445135|gb|EFM37781.1| phosphoglycerate dehydrogenase [Campylobacter coli JV20]
          Length = 527

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFQTDFKPKGKMIIFKNKDIPGVIAKISSVLASKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VLE+L       FV+  E
Sbjct: 492 F-GYALAVVLIDEKVQKEVLEELRQLEACIFVQYVE 526


>gi|313679957|ref|YP_004057696.1| d-3-phosphoglycerate dehydrogenase [Oceanithermus profundus DSM
           14977]
 gi|313152672|gb|ADR36523.1| D-3-phosphoglycerate dehydrogenase [Oceanithermus profundus DSM
           14977]
          Length = 520

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 40/73 (54%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+PR ++I +   +++    ++  +N D  G+V  VG +LGE G+NIA   LGR Q    
Sbjct: 428 GRPRLVRIDDYALEIEPTGAVLVCINRDQPGVVGRVGTLLGEAGVNIAGLQLGRDQPGGR 487

Query: 65  AISFLCIDGSILN 77
           A+  L +D    +
Sbjct: 488 ALFVLAVDQPPPD 500


>gi|225873973|ref|YP_002755432.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium capsulatum ATCC
           51196]
 gi|225792519|gb|ACO32609.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium capsulatum ATCC
           51196]
          Length = 525

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 2/99 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V      R + +  I+ +  +  +++ + N D+ G++  VG ILG++ INI +F LGRS 
Sbjct: 427 VLHGNSARLLNLDGIDIEAPLEGMLLSLRNLDVPGVIGRVGTILGDHQINIGNFALGRSD 486

Query: 61  ST--EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                 A++ + +DG++   VL+ L     I  V+    
Sbjct: 487 RDHHGTALAVIQVDGAVTEQVLQALRGVEAITEVRLVTL 525


>gi|328885238|emb|CCA58477.1| D-3-phosphoglycerate dehydrogenase [Streptomyces venezuelae ATCC
           10712]
          Length = 529

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + + + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R++    A+ 
Sbjct: 439 KIVAVGDYDVDLALADHMVVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRAEEGGEALV 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++   VL +++  +     +    
Sbjct: 499 VLTVDDTLPAPVLAEIAAEIGATSARSVNL 528


>gi|329936828|ref|ZP_08286507.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoaurantiacus
           M045]
 gi|329303753|gb|EGG47637.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoaurantiacus
           M045]
          Length = 529

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 46/90 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +  AD  G+V  +G +LGE GINIA   + R+ +   A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLRYADRPGVVGTLGRVLGEAGINIAGMQVSRAVAGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++   V+ +L+  +     +    
Sbjct: 499 VLTVDDTVPPHVVAELAEEIGATSARSINL 528


>gi|159897613|ref|YP_001543860.1| D-3-phosphoglycerate dehydrogenase [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890652|gb|ABX03732.1| D-3-phosphoglycerate dehydrogenase [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 524

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 41/88 (46%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+   ++I E   D+     M+   + D  G +  +G +LG   INI+  H+GRS     
Sbjct: 432 GEAHIVQINEFWLDLVPTSSMLFTFHQDRPGFIGRIGTLLGTADINISAMHVGRSSPRGT 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFV 92
           AI  L +D +I +  L  ++  V I   
Sbjct: 492 AIMVLTVDEAIPSETLTDINNQVDIERA 519


>gi|290957185|ref|YP_003488367.1| D-3-phosphoglycerate dehydrogenase [Streptomyces scabiei 87.22]
 gi|260646711|emb|CBG69808.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces scabiei
           87.22]
          Length = 529

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +   D  G+V  VG + GE GINIA   + RS +   A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLSYVDRPGVVGTVGRVFGEAGINIAGMQVARSTAGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++  +VL ++   +     +    
Sbjct: 499 VLTVDDTVPPAVLAEVEAEIGATSARSVNL 528


>gi|34558837|gb|AAQ75181.1| D-3-phosphoglycerate dehydrogenase [Alvinella pompejana epibiont
           7G3]
          Length = 529

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 50/92 (54%), Gaps = 1/92 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +   R I+I     D++    MI   N D+ G++  VG I+  Y +NI+ F LGR  
Sbjct: 434 IFGENTQRIIEINGYKLDLEPKGKMILFRNTDVPGVIGDVGRIIASYNVNISDFRLGRDS 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           ++  A++ + +D ++  S+L++LS   T   V
Sbjct: 494 NS-QALAVVKVDDNVNKSLLQELSSLETCISV 524


>gi|320170533|gb|EFW47432.1| D-3-phosphoglycerate dehydrogenase [Capsaspora owczarzaki ATCC
           30864]
          Length = 552

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF     RF +I +  F+V     ++   N D  G++  +G  L +  INIA   LGR  
Sbjct: 456 VFGTNNLRFTRIDQFAFEVRPAGHLMFYRNEDKPGVIAAIGTHLAQASINIADLTLGRDD 515

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           S   A+  +  D  I   VL+++     I + +    
Sbjct: 516 SKREALCIVNTDQPIPADVLQRIQQTSFITYARTVTL 552


>gi|57242228|ref|ZP_00370167.1| D-3-phosphoglycerate dehydrogenase [Campylobacter upsaliensis
           RM3195]
 gi|57016908|gb|EAL53690.1| D-3-phosphoglycerate dehydrogenase [Campylobacter upsaliensis
           RM3195]
          Length = 527

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      M+   N DI G++  + + L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMLIFKNKDIPGVISKISSTLAAQNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + +D  I   VL++L+      FV+  E
Sbjct: 492 F-GYALAVVLVDEVISKEVLDELNKLEVCVFVQYVE 526


>gi|315638687|ref|ZP_07893861.1| phosphoglycerate dehydrogenase [Campylobacter upsaliensis JV21]
 gi|315481311|gb|EFU71941.1| phosphoglycerate dehydrogenase [Campylobacter upsaliensis JV21]
          Length = 527

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      M+   N DI G++  + + L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMLIFKNKDIPGVISKISSTLAAQNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + +D  I   VL++L+      FV+  E
Sbjct: 492 F-GYALAVVLVDEVISKEVLDELNKLEVCVFVQYVE 526


>gi|269838299|ref|YP_003320527.1| D-3-phosphoglycerate dehydrogenase [Sphaerobacter thermophilus DSM
           20745]
 gi|269787562|gb|ACZ39705.1| D-3-phosphoglycerate dehydrogenase [Sphaerobacter thermophilus DSM
           20745]
          Length = 737

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 38/84 (45%)

Query: 9   FIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISF 68
            ++I   + +  +   ++   + D  G+V  VG ILG Y +NIA   +GR +    AI  
Sbjct: 629 IMEIDRFSLERPLAGDLLITRHWDRPGVVGRVGTILGRYNVNIAGMQVGRHERGGQAIMV 688

Query: 69  LCIDGSILNSVLEKLSVNVTIRFV 92
           L +D  I  + L ++     I   
Sbjct: 689 LNVDDIIPEAALAEIVTIPGIESA 712


>gi|283954452|ref|ZP_06371972.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794069|gb|EFC32818.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 521

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 426 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 485

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 486 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 520


>gi|17229382|ref|NP_485930.1| D-3-phosphoglycerate dehydrogenase [Nostoc sp. PCC 7120]
 gi|17130980|dbj|BAB73589.1| phosphoglycerate dehydrogenase [Nostoc sp. PCC 7120]
          Length = 526

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGDKEIHLTDVDGFPINVPPSKYMVFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  + + +L +++    IR  
Sbjct: 490 VRGDAVMALSIDDPLPDGILAEITKVPGIRDA 521


>gi|228474509|ref|ZP_04059242.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus hominis SK119]
 gi|228271538|gb|EEK12900.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus hominis SK119]
          Length = 869

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 40/92 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V      R ++I + + D           + D+ G+V   G +LG++ INIA   LGRS 
Sbjct: 771 VIDGFGARIVRINDYSVDFKPNTYQFISYHKDLPGMVGLTGQLLGKHDINIASMSLGRSS 830

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  I   V+++L        +
Sbjct: 831 EGGQAMMILSIDQPITQQVIKELYEIGDFDNI 862


>gi|222824187|ref|YP_002575761.1| D-3-phosphoglycerate dehydrogenase [Campylobacter lari RM2100]
 gi|222539409|gb|ACM64510.1| D-3-phosphoglycerate dehydrogenase [Campylobacter lari RM2100]
          Length = 526

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + + R +++   + D      MI + N DI G++  V  IL +  +NIA F LGR+ 
Sbjct: 431 IFGENEQRIVELNGFDVDFKPKGKMIILNNNDIPGVIANVSGILAKNNVNIADFRLGRNG 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A++ + +D  I  ++LE+L       F 
Sbjct: 491 F-GKALAVILLDAKISKALLEELRAIDACIFA 521


>gi|282899725|ref|ZP_06307688.1| D-3-phosphoglycerate dehydrogenase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195340|gb|EFA70274.1| D-3-phosphoglycerate dehydrogenase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 526

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  + +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGEKEIHLTDVDGFPINVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  + + +LE++     IR  
Sbjct: 490 VRGDAVMALSIDDPLPDGILEEIKQVSGIRDA 521


>gi|205356376|ref|ZP_03223141.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|205345761|gb|EDZ32399.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8421]
          Length = 489

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 394 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 453

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 454 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 488


>gi|315929501|gb|EFV08695.1| ACT domain protein [Campylobacter jejuni subsp. jejuni 305]
          Length = 330

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 235 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 294

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 295 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 329


>gi|302558214|ref|ZP_07310556.1| phosphoglycerate dehydrogenase [Streptomyces griseoflavus Tu4000]
 gi|302475832|gb|EFL38925.1| phosphoglycerate dehydrogenase [Streptomyces griseoflavus Tu4000]
          Length = 529

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG +LGE GINIA   + R+     A++
Sbjct: 439 KIVAIGEYDVDLALADHMVVLRYEDRPGVVGTVGRVLGEAGINIAGMQVARATVGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++   V+ +L+  +     +    
Sbjct: 499 VLTVDDTVSAGVIGELAEEIGATSARSVNL 528


>gi|282895559|ref|ZP_06303693.1| D-3-phosphoglycerate dehydrogenase [Raphidiopsis brookii D9]
 gi|281199399|gb|EFA74263.1| D-3-phosphoglycerate dehydrogenase [Raphidiopsis brookii D9]
          Length = 526

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  + +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGEKEIHLTDVDGFPINVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  + + +LE++     IR  
Sbjct: 490 VRGDAVMALSIDDPLPDGILEEIKQVSGIRDA 521


>gi|269127749|ref|YP_003301119.1| D-3-phosphoglycerate dehydrogenase [Thermomonospora curvata DSM
           43183]
 gi|268312707|gb|ACY99081.1| D-3-phosphoglycerate dehydrogenase [Thermomonospora curvata DSM
           43183]
          Length = 531

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 42/91 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   + ++     M      D  GIV  VG +LG+  INIA   +GRS     A+ 
Sbjct: 438 RIVEINGYDMELVPAEHMAFFSYTDRPGIVGVVGRLLGDAQINIASMQVGRSSKGGKALI 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D +I   +LE +   +     ++ + +
Sbjct: 498 ALTVDSAIGPDLLETIRTEIGADMGRRVDLD 528


>gi|168700983|ref|ZP_02733260.1| phosphoglycerate dehydrogenase [Gemmata obscuriglobus UQM 2246]
          Length = 539

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F D   R +++     +  +  +++   + D+ G++ FVG I G++ +NIA   +GR+ 
Sbjct: 432 LFGDQYVRLVQLGPFRMEGYLDGVLLVFRHHDVPGLIGFVGTIFGKHKVNIAQMTVGRTS 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  L +D    +  + ++  +  I  V   + 
Sbjct: 492 PGGEAIGILNLDNWPSDEAVAEVKAHPQISSVTVVKL 528


>gi|294815271|ref|ZP_06773914.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
 gi|294327870|gb|EFG09513.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 538

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
               + + I + + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R +   
Sbjct: 443 KNVQKIVAIGDHDVDLALADHMLVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRHEEGG 502

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++   V+ ++S  +     +    
Sbjct: 503 EALVVLTVDDTVPVPVIAEISAEIGAASARSVNL 536


>gi|330684332|gb|EGG96064.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU121]
          Length = 531

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 43/92 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V S   PR ++I   + D    +  I   + D  GIV   GN+LG  GINI    LGR+ 
Sbjct: 433 VLSGFGPRIVRINNFSLDFKPSQYQIVTCHNDQPGIVGKTGNLLGNKGINIGSMTLGRTN 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID    ++++ +L+  +    +
Sbjct: 493 EGGQALMILSIDQPASHALVAELNNAIPFNKI 524


>gi|309791398|ref|ZP_07685905.1| D-3-phosphoglycerate dehydrogenase [Oscillochloris trichoides DG6]
 gi|308226531|gb|EFO80252.1| D-3-phosphoglycerate dehydrogenase [Oscillochloris trichoides DG6]
          Length = 525

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+P  ++      D      ++   + D  G++  VG +LGE  +NI+  ++GR    + 
Sbjct: 433 GEPHIVQADGYFVDFVPQGSLLITYHRDRPGMIGRVGTLLGENDVNISGMYVGRLSPRDR 492

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFV 92
           A+  L +D      VL  +     I   
Sbjct: 493 AMMVLTLDEPASEEVLNLVRALDDIDQA 520


>gi|255322493|ref|ZP_05363638.1| phosphoglycerate dehydrogenase [Campylobacter showae RM3277]
 gi|255300401|gb|EET79673.1| phosphoglycerate dehydrogenase [Campylobacter showae RM3277]
          Length = 525

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 1/93 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + I     D      MI   N D+ G++  + +IL E  INIA F LGR  
Sbjct: 430 VFGENQQRIVTINGFKTDFKPKGKMIIFKNNDVPGVIAKISSILAEEKINIADFRLGRDD 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
               A++ + +D  I    L KL+      + K
Sbjct: 490 H-GMALAVVLVDEKITKETLAKLNDLDVCVWAK 521


>gi|319790479|ref|YP_004152112.1| D-3-phosphoglycerate dehydrogenase [Thermovibrio ammonificans HB-1]
 gi|317114981|gb|ADU97471.1| D-3-phosphoglycerate dehydrogenase [Thermovibrio ammonificans HB-1]
          Length = 533

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 50/97 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +  P+ ++I    FD+     ++ I N D+ G++  +G+ILG++ +NIA F LGR +
Sbjct: 437 VMDEKFPKIVEINGFLFDLTPEGKLLLIKNYDVPGVIGKLGSILGKHRVNIAGFQLGRKE 496

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A   + ID  +    +E++     I  VKQ   
Sbjct: 497 KGKEAKGVILIDDDVPQQAIEEIKEIPEILEVKQVNL 533


>gi|254392671|ref|ZP_05007846.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
 gi|197706333|gb|EDY52145.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 532

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
               + + I + + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R +   
Sbjct: 437 KNVQKIVAIGDHDVDLALADHMLVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRHEEGG 496

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++   V+ ++S  +     +    
Sbjct: 497 EALVVLTVDDTVPVPVIAEISAEIGAASARSVNL 530


>gi|307747791|gb|ADN91061.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni M1]
          Length = 527

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|21223871|ref|NP_629650.1| D-3-phosphoglycerate dehydrogenase [Streptomyces coelicolor A3(2)]
 gi|256785031|ref|ZP_05523462.1| D-3-phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
 gi|289768924|ref|ZP_06528302.1| phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
 gi|4467266|emb|CAB37591.1| probable D-3-phosphoglycerate dehydrogenase [Streptomyces
           coelicolor A3(2)]
 gi|289699123|gb|EFD66552.1| phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
          Length = 529

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG I+GE G+NIA   + R+     A++
Sbjct: 439 KIVAIGEYDVDLALADHMVVLRYEDRPGVVGTVGRIIGEAGLNIAGMQVARATVGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++ + VL +++  +     +    
Sbjct: 499 VLTVDDTVPSGVLAEVAAEIGATSARSVNL 528


>gi|326443626|ref|ZP_08218360.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 525

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
               + + I + + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R +   
Sbjct: 430 KNVQKIVAIGDHDVDLALADHMLVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRHEEGG 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++   V+ ++S  +     +    
Sbjct: 490 EALVVLTVDDTVPVPVIAEISAEIGAASARSVNL 523


>gi|157415148|ref|YP_001482404.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|157386112|gb|ABV52427.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81116]
          Length = 527

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|57237720|ref|YP_178968.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni RM1221]
 gi|86150274|ref|ZP_01068501.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88597554|ref|ZP_01100788.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|218562511|ref|YP_002344290.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|57166524|gb|AAW35303.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni RM1221]
 gi|85839390|gb|EAQ56652.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88190146|gb|EAQ94121.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360217|emb|CAL35012.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|284926125|gb|ADC28477.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|315058331|gb|ADT72660.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni S3]
 gi|315927558|gb|EFV06891.1| phosphoglycerate dehydrogenase [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 527

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|119508833|ref|ZP_01627985.1| D-3-phosphoglycerate dehydrogenase [Nodularia spumigena CCY9414]
 gi|119466362|gb|EAW47247.1| D-3-phosphoglycerate dehydrogenase [Nodularia spumigena CCY9414]
          Length = 526

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 43/92 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGDKEIHLTDVDGFPINVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  + + +L ++     IR  
Sbjct: 490 VRGDAVMALSIDDPLPDGILAEIVKVAGIRDA 521


>gi|186685295|ref|YP_001868491.1| D-3-phosphoglycerate dehydrogenase [Nostoc punctiforme PCC 73102]
 gi|186467747|gb|ACC83548.1| D-3-phosphoglycerate dehydrogenase [Nostoc punctiforme PCC 73102]
          Length = 526

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 43/92 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  + +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGEREIHLTDVDGFPINVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  +   +L+++     IR  
Sbjct: 490 VRGDAVMALSIDDPLPEGILDEIIKVPGIRDA 521


>gi|315932626|gb|EFV11557.1| phosphoglycerate dehydrogenase [Campylobacter jejuni subsp. jejuni
           327]
          Length = 527

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|283956236|ref|ZP_06373716.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283791956|gb|EFC30745.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 527

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|297622551|ref|YP_003703985.1| D-3-phosphoglycerate dehydrogenase [Truepera radiovictrix DSM
           17093]
 gi|297163731|gb|ADI13442.1| D-3-phosphoglycerate dehydrogenase [Truepera radiovictrix DSM
           17093]
          Length = 524

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 38/84 (45%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +PR + + E   ++     M+   N D  G V  VG +LG+ G+NI+   L R      A
Sbjct: 432 EPRIVSVDEYPIELRPEGTMLICTNYDRPGAVGKVGTVLGDAGVNISGMQLSRVGENGLA 491

Query: 66  ISFLCIDGSILNSVLEKLSVNVTI 89
           +  L +D     SVLE L     +
Sbjct: 492 LFALGLDQEPPESVLEVLRSLPNV 515


>gi|70726201|ref|YP_253115.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus haemolyticus
           JCSC1435]
 gi|68446925|dbj|BAE04509.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus haemolyticus
           JCSC1435]
          Length = 532

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 39/92 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +    R ++I + + D       +   + D  G+V   G +LG + INIA   LGR+ 
Sbjct: 433 VIAGFGARIVRINDYSVDFKPNAYQLVSYHGDKPGMVGLTGQLLGRHNINIASMSLGRNI 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  +   ++ +L        +
Sbjct: 493 QGGQAMMVLSIDQPVTEDIINELYDVGGFDKI 524


>gi|116750521|ref|YP_847208.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116699585|gb|ABK18773.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 525

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V    + R I+I +   + ++  + + I N D  G +  +G  LG + +NIA+ HL R  
Sbjct: 430 VLQGHEIRLIRINDYRLEAELEGINLLIQNYDKPGTIGLIGTTLGSHQVNIANMHLSR-T 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + AI+ + +D       +E L  + +I  V+Q + 
Sbjct: 489 PRDKAIAIIRLDNEAPPEAIETLRRHPSIISVQQVKL 525


>gi|86152140|ref|ZP_01070352.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315124387|ref|YP_004066391.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85840925|gb|EAQ58175.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315018109|gb|ADT66202.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 527

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|297202558|ref|ZP_06919955.1| phosphoglycerate dehydrogenase [Streptomyces sviceus ATCC 29083]
 gi|197709915|gb|EDY53949.1| phosphoglycerate dehydrogenase [Streptomyces sviceus ATCC 29083]
          Length = 529

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +   D  G+V  VG I GE GINIA   + R+ +   A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLKYEDRPGVVGTVGRIFGEAGINIAGMQVSRAIAGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++   VL +++  +     +    
Sbjct: 499 VLTVDDTVPAGVLTEVAEEIGATSARAVNL 528


>gi|118474999|ref|YP_892404.1| D-3-phosphoglycerate dehydrogenase [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118414225|gb|ABK82645.1| D-3-phosphoglycerate dehydrogenase [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 525

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + +     D      MI   N D+ G++  + +IL E  INIA F LGR  
Sbjct: 430 VFGETEQRIVNVNGFKTDFKPKGRMIVFKNTDVPGVISSISSILAEEKINIADFRLGRDD 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNV 87
           +   A++ + +D  I   +L KL+   
Sbjct: 490 N-GFALAVILVDDDIKKDILAKLNALE 515


>gi|302537104|ref|ZP_07289446.1| phosphoglycerate dehydrogenase [Streptomyces sp. C]
 gi|302445999|gb|EFL17815.1| phosphoglycerate dehydrogenase [Streptomyces sp. C]
          Length = 529

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   MI +   D  G+V  VG +LGE G+NIA   + R++    A+ 
Sbjct: 439 KIVGVGEYDVDLALADHMIVLRYTDRPGVVGKVGQLLGEAGLNIAGMQVARAEEGGEALV 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  +   VL  +S  +     +    
Sbjct: 499 VLTVDAEVPVDVLAAISEEIGAASARTVNL 528


>gi|239637958|ref|ZP_04678919.1| phosphoglycerate dehydrogenase [Staphylococcus warneri L37603]
 gi|239596521|gb|EEQ79057.1| phosphoglycerate dehydrogenase [Staphylococcus warneri L37603]
          Length = 531

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 43/92 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V S   PR ++I   + D    +  I   + D  GIV   GN+LG+ GINI    LGR+ 
Sbjct: 433 VLSGFGPRIVRINNFSLDFKPNQYQIVTCHNDQPGIVGKTGNLLGDNGINIGSMTLGRTI 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID     +++ +L+  +    +
Sbjct: 493 EGGQALMILSIDQPASQTLVTELNNAIPFNKI 524


>gi|95928509|ref|ZP_01311256.1| D-3-phosphoglycerate dehydrogenase [Desulfuromonas acetoxidans DSM
           684]
 gi|95135299|gb|EAT16951.1| D-3-phosphoglycerate dehydrogenase [Desulfuromonas acetoxidans DSM
           684]
          Length = 528

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 50/97 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F++ + R I + +   +      ++ + N D  G++  +G +L E  IN+A  +L R +
Sbjct: 431 IFNNRECRIIGVDDYAIETIPSGHLLVVRNLDRPGVIALLGRLLAEAEINVAMMNLSRQK 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           ST  A+S + +D  I   V+E+L  + +I    Q + 
Sbjct: 491 STGDAMSLVTVDHKIPEQVMEELRRHDSILSAVQIDL 527


>gi|282861276|ref|ZP_06270341.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. ACTE]
 gi|282563934|gb|EFB69471.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. ACTE]
          Length = 530

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R  +   A+ 
Sbjct: 439 KIVAIGEHDVDLALADHMVVLRYEDRPGVVGAVGKILGEAGLNIAGMQVSRQDAGGEALV 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D +I  SVL +++  +     +    
Sbjct: 499 VLTVDDTIPQSVLSEIAEEIGATSARSVNL 528


>gi|223039567|ref|ZP_03609854.1| phosphoglycerate dehydrogenase [Campylobacter rectus RM3267]
 gi|222879138|gb|EEF14232.1| phosphoglycerate dehydrogenase [Campylobacter rectus RM3267]
          Length = 525

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 1/93 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + I     D      MI   N D+ G++  +  IL    INIA F LGR  
Sbjct: 430 VFGENQQRIVTINGFKTDFKPKGKMIIFKNNDVPGVIAQISTILAAEKINIADFRLGRDD 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
               A++ + +D  I    L KL+      + K
Sbjct: 490 H-GMALAVVLVDEKITKETLAKLNELDVCVWAK 521


>gi|148926576|ref|ZP_01810258.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|145845270|gb|EDK22364.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8486]
          Length = 529

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 434 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLATKNINIADFRLGRDG 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 494 F-GYALAVVLIDEKVQKEVLDELKQLEVCVFVQYVE 528


>gi|302554336|ref|ZP_07306678.1| phosphoglycerate dehydrogenase [Streptomyces viridochromogenes DSM
           40736]
 gi|302471954|gb|EFL35047.1| phosphoglycerate dehydrogenase [Streptomyces viridochromogenes DSM
           40736]
          Length = 529

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +   D  G+V  VG ILGE GINIA   + R+ +   A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLRYEDRPGVVGTVGRILGEAGINIAGMQVSRAVAGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++   VL +++  +     +    
Sbjct: 499 VLTVDDTVTPGVLAEVAAEIGATSSRSVNL 528


>gi|256396892|ref|YP_003118456.1| D-3-phosphoglycerate dehydrogenase [Catenulispora acidiphila DSM
           44928]
 gi|256363118|gb|ACU76615.1| D-3-phosphoglycerate dehydrogenase [Catenulispora acidiphila DSM
           44928]
          Length = 535

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 39/91 (42%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + +++     DV I   ++ +   D  G+V  +G +LG  GINI    + R+     A+ 
Sbjct: 444 KIVEVDGFQLDVTIAEHLLFLRYTDRPGVVGQLGGVLGAAGINIGGMQVARAAKGGEALV 503

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D  +   +LE++   +    V      
Sbjct: 504 ALTVDSVVPAGLLEEIKAAIGATAVHSISLE 534


>gi|121612205|ref|YP_001000566.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167005499|ref|ZP_02271257.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|87249339|gb|EAQ72299.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
          Length = 527

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      M+   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMVIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|86153461|ref|ZP_01071665.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|85843187|gb|EAQ60398.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni HB93-13]
          Length = 527

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      M+   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMVIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              +A++ + ID  +   VL++L       FV+  E
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVE 526


>gi|296272027|ref|YP_003654658.1| D-3-phosphoglycerate dehydrogenase [Arcobacter nitrofigilis DSM
           7299]
 gi|296096202|gb|ADG92152.1| D-3-phosphoglycerate dehydrogenase [Arcobacter nitrofigilis DSM
           7299]
          Length = 527

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   R +++    FD+     MI + N+DI G++  VG  LG+  INIA F L R +
Sbjct: 433 VFDEDVQRIVEVNGFVFDIAPKGNMIFLRNSDIPGVIGTVGKTLGDNNINIADFRLSRGK 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               A++ + +D  + + VL++L        V   E
Sbjct: 493 D--SALAVILVDTFVSHDVLKQLENLEAAISVSYVE 526


>gi|167044704|gb|ABZ09375.1| putative D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
           domain protein [uncultured marine microorganism
           HF4000_APKG7H23]
          Length = 491

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 42/91 (46%), Gaps = 1/91 (1%)

Query: 4   DGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           + +   +++ + + D+   GR M+   + D  G++  +G I GE+ INI+   +GR    
Sbjct: 397 NDQVHLVRVNDFSLDLQPTGRFMMFTEHTDRPGMIGRMGTIAGEHDINISFMEVGRRAPR 456

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
             A   + +D  I +  L +      +  V+
Sbjct: 457 GEATMIVGLDDPISDEALAEFRAIPHVSRVR 487


>gi|320008407|gb|ADW03257.1| D-3-phosphoglycerate dehydrogenase [Streptomyces flavogriseus ATCC
           33331]
          Length = 530

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R  +   A+ 
Sbjct: 439 KIVAIGEHDVDLALADHMVVLRYEDRPGVVGAVGKILGEAGLNIAGMQVSRQDAGGEALV 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D +I  SVL +++  +     +    
Sbjct: 499 VLTVDDTIPQSVLTEIAEEIGAASARSVNL 528


>gi|225849892|ref|YP_002730126.1| D-3-phosphoglycerate dehydrogenase [Persephonella marina EX-H1]
 gi|225646129|gb|ACO04315.1| phosphoglycerate dehydrogenase [Persephonella marina EX-H1]
          Length = 529

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 47/94 (50%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F    P+ + I     D+D   +++   N D+ G++  +G IL  + INIA F LGR + 
Sbjct: 434 FYGKFPKIMLIDRYWIDIDPEGVILVFENKDVPGVIAKLGEILARHNINIAGFRLGRLEK 493

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            + A+  L +D  I  ++LE++     I   K+ 
Sbjct: 494 GKIALGALQLDERINEAILEEIQNIPEIIKAKEI 527


>gi|297191887|ref|ZP_06909285.1| D-3-phosphoglycerate dehydrogenase [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197721137|gb|EDY65045.1| D-3-phosphoglycerate dehydrogenase [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 530

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M  +   D  G+V  VG ILGE G+NIA   + R++    A+ 
Sbjct: 439 KIVAIGEHDVDLALADHMAVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRAEEGGEALV 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++  +VL ++S  +     +    
Sbjct: 499 VLTVDDTVPPAVLAEISDEIGAASARSVNL 528


>gi|169825985|ref|YP_001696143.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus sphaericus
           C3-41]
 gi|168990473|gb|ACA38013.1| Phosphoglycerate dehydrogenase [Lysinibacillus sphaericus C3-41]
          Length = 535

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 27/90 (30%), Positives = 40/90 (44%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +K+++   DV     ++ I N D  G +  V   L E  INIA   +GR+Q    A+ 
Sbjct: 446 RIVKVEDYVVDVIPQGHLLYIKNTDKPGAIGRVATKLAEKDINIATMQVGRAQVGGTAVM 505

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L ID  + N  L  ++    I  VK    
Sbjct: 506 MLTIDNVVTNEDLAFVAQLENIDEVKAINL 535


>gi|317050372|ref|YP_004111488.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
 gi|316945456|gb|ADU64932.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
          Length = 520

 Score =  103 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLG-RS 59
           + +D  PR +++ E   +      M+   N D  G++  +G +LGE  IN+A+  LG R 
Sbjct: 424 LLADKFPRIVEVNEYKIEAVPQGTMLFFRNYDRPGVIGSLGRLLGEKNINVANMRLGFRG 483

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                AI+ + ID ++  + L++++    I    Q EF
Sbjct: 484 DD--EAIAMVNIDTAVDAATLQEITRLDNIIDCFQLEF 519


>gi|254444984|ref|ZP_05058460.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobiae bacterium
           DG1235]
 gi|198259292|gb|EDY83600.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobiae bacterium
           DG1235]
          Length = 545

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 46/94 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
              PR + I     +V+    M+ I N+D LGIV  +G I+G+ G+NIA   L R++   
Sbjct: 452 GNFPRIVSINGREVEVEPHGSMLVIANSDELGIVGKIGEIIGKDGVNIAAMSLSRNEVGG 511

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A++   +D  + ++ + ++     I+  K    
Sbjct: 512 VALNIASLDSDLSDAAMAEIKAIEAIKQAKVVHL 545


>gi|314936177|ref|ZP_07843524.1| phosphoglycerate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
 gi|313654796|gb|EFS18541.1| phosphoglycerate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 531

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 40/92 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V      R ++I + + D           + D+ G+V   G +LG++ INIA   LGRS 
Sbjct: 433 VIDGFGARIVRINDYSVDFKPNTYQFISYHKDLPGMVGLTGQLLGKHDINIASMSLGRSS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  I   V+++L        +
Sbjct: 493 EGGQAMMILSIDQPITQQVIKELYEIGDFDNI 524


>gi|254383224|ref|ZP_04998577.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. Mg1]
 gi|194342122|gb|EDX23088.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. Mg1]
          Length = 529

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   MI +  AD  G+V  VG  LGE G+NIA   + R++    A+ 
Sbjct: 439 KIVGIGEYDLDLALAEQMIVLRYADRPGVVGTVGRFLGEAGLNIAGMQVARAEEGGEALG 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  +   VL  ++  +     +    
Sbjct: 499 VLTVDAEVPAGVLADIAAEIGAVSARSVSL 528


>gi|78777073|ref|YP_393388.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas denitrificans DSM
           1251]
 gi|78497613|gb|ABB44153.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas denitrificans DSM
           1251]
          Length = 529

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 1/93 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F D   R + I   + +V +   MI + N D+ G++  +G+ L ++ +NIA F L R+ 
Sbjct: 434 IFDDNVFRIVSIDGFDIEVALKGDMIILKNQDVPGVIGNIGSTLAKHNVNIADFSLARND 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
               A++ + +D  I +  LE+L        V+
Sbjct: 494 KK-QALAVILVDNVISDDTLEELLRIDACSSVQ 525


>gi|227499137|ref|ZP_03929272.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus sp. D21]
 gi|226904584|gb|EEH90502.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus sp. D21]
          Length = 529

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 41/97 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  D +P   +++   FD      MI   N D  G++  +G +LG   +NIA   + R +
Sbjct: 433 VTPDNQPHITEVEGYQFDTIPAPYMIFARNDDKPGMIGQIGTLLGAGHVNIATMQVSRKK 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D ++  + LE +     I   +    
Sbjct: 493 KEGTAMMVLTVDSAVDGATLEIVRNLDGISDAQLVRL 529


>gi|284032768|ref|YP_003382699.1| D-3-phosphoglycerate dehydrogenase [Kribbella flavida DSM 17836]
 gi|283812061|gb|ADB33900.1| D-3-phosphoglycerate dehydrogenase [Kribbella flavida DSM 17836]
          Length = 536

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 44/91 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   + +V++   +  +   D  GIV  VG ILGE  INIA   + R +    A+ 
Sbjct: 445 RLVEIDGFDLEVELAEHLAFLSYEDRPGIVGQVGRILGESDINIAGMQVSRDRKGGKALV 504

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D SI  ++L+ ++  V     +  +  
Sbjct: 505 ALSVDSSITPALLDDIATAVQADTARTVDLE 535


>gi|182435790|ref|YP_001823509.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326776414|ref|ZP_08235679.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
 gi|178464306|dbj|BAG18826.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|326656747|gb|EGE41593.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 530

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 44/94 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
               + + I E + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R+    
Sbjct: 435 KNLQKIVAIGEHDVDLALADHMVVLRYQDRPGVVGAVGKILGEAGLNIAGMQVSRAAEGG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++  SVL ++S  +     +    
Sbjct: 495 EALVVLTVDETVPQSVLTEISEEIGASSARSVNL 528


>gi|87312269|ref|ZP_01094368.1| phosphoglycerate dehydrogenase [Blastopirellula marina DSM 3645]
 gi|87285007|gb|EAQ76942.1| phosphoglycerate dehydrogenase [Blastopirellula marina DSM 3645]
          Length = 539

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +  PR I +     +  +   +    + D+ GI+  VG I G + +NIA   +GRS 
Sbjct: 433 LFGNDMPRLILVDGQRLEAYLDGTLFLFAHNDVPGIIGRVGTIFGNHNVNIAQMAVGRSS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +DG+   S ++++  +  I   +  E 
Sbjct: 493 TGG-AVGVLNLDGAPPQSAVDEVLKSADITTARIIEL 528


>gi|29829272|ref|NP_823906.1| D-3-phosphoglycerate dehydrogenase [Streptomyces avermitilis
           MA-4680]
 gi|29606379|dbj|BAC70441.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces
           avermitilis MA-4680]
          Length = 529

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +   D  G+V  +G ILG  GINIA   + R+ +   A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLKYTDRPGVVGTLGRILGGAGINIAGMQVSRAVAGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++  +VL +L+  +     +    
Sbjct: 499 VLTVDDTVSQNVLTELAEEIGATSARSVNL 528


>gi|237749847|ref|ZP_04580327.1| d-3-phosphoglycerate dehydrogenase [Helicobacter bilis ATCC 43879]
 gi|229374597|gb|EEO24988.1| d-3-phosphoglycerate dehydrogenase [Helicobacter bilis ATCC 43879]
          Length = 535

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 46/97 (47%), Gaps = 2/97 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           ++     RF  I     D++    MI + N D+ G++  +G+ + ++ +NIA F LGR  
Sbjct: 437 IYDGHIVRFNNINGFGMDLEPNGNMILVRNTDVPGVIGSIGHTIAKHKVNIADFRLGRKT 496

Query: 61  STEH--AISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            +    A++ + +D ++   +L+ L        V+  
Sbjct: 497 DSSERNALALILVDSAVSTQLLDDLKAIPECLSVRNV 533


>gi|126649438|ref|ZP_01721679.1| phosphoglycerate dehydrogenase [Bacillus sp. B14905]
 gi|126593763|gb|EAZ87686.1| phosphoglycerate dehydrogenase [Bacillus sp. B14905]
          Length = 535

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 40/90 (44%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +K+++   DV     ++ I N D  G +  V   L E  INIA   +GR+Q    A+ 
Sbjct: 446 RIVKVEDYVVDVIPQGHLLYIKNTDKPGAIGRVATKLAEKEINIATMQVGRAQVGGTAVM 505

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L ID  + +  L  ++    I  VK    
Sbjct: 506 MLTIDNVVTDEDLAFVAQLENIDEVKAINL 535


>gi|239944498|ref|ZP_04696435.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|239990958|ref|ZP_04711622.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           11379]
 gi|291447964|ref|ZP_06587354.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|291350911|gb|EFE77815.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
          Length = 530

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 43/90 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R+     A+ 
Sbjct: 439 KIVAIGEHDVDLALADHMVVLRYQDRPGVVGAVGKILGEAGLNIAGMQVSRAAEGGEALV 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++   VL +++  +     +    
Sbjct: 499 VLTVDETVPQPVLTEIAEEIGASSARSVNL 528


>gi|254478955|ref|ZP_05092315.1| ACT domain protein [Carboxydibrachium pacificum DSM 12653]
 gi|214035101|gb|EEB75815.1| ACT domain protein [Carboxydibrachium pacificum DSM 12653]
          Length = 256

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 45/91 (49%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           + R ++      + +    M+ + N D+ G++  +GN+LG++GINI+   +  +++   A
Sbjct: 163 ELRIVEYMGHKVNFEPTEYMLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDGTA 222

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           +  +  D  I    +E L+   +I   K  +
Sbjct: 223 LMLVSTDKEIPEEAVESLNKLNSIIKAKAVK 253


>gi|312144313|ref|YP_003995759.1| D-3-phosphoglycerate dehydrogenase [Halanaerobium sp.
           'sapolanicus']
 gi|311904964|gb|ADQ15405.1| D-3-phosphoglycerate dehydrogenase [Halanaerobium sp.
           'sapolanicus']
          Length = 534

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 39/79 (49%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I+I  +  D+D+    I +   D  G++  +G  LGE  INIA+  +GR  +   A+ 
Sbjct: 440 RVIEINGLRIDLDLSGEFIIVTYQDKPGVIGKIGTSLGEENINIANMQVGRQTAGGEAVM 499

Query: 68  FLCIDGSILNSVLEKLSVN 86
            + ID       ++K+  +
Sbjct: 500 LMQIDSKPSPETMKKIKNH 518


>gi|299537582|ref|ZP_07050875.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus fusiformis ZC1]
 gi|298726951|gb|EFI67533.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus fusiformis ZC1]
          Length = 537

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 39/90 (43%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +K+++   DV     ++ I N D  G +  V   L E  INIA   +GR+Q    A+ 
Sbjct: 448 RIVKVEDYVVDVIPQGHLLYIKNTDKPGAIGRVATKLAEKEINIATMQVGRAQVGGTAVM 507

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  +    L  ++    I  VK    
Sbjct: 508 MLTVDNVVTEEDLVFVAQLENIDEVKAINL 537


>gi|284992450|ref|YP_003411004.1| D-3-phosphoglycerate dehydrogenase [Geodermatophilus obscurus DSM
           43160]
 gi|284065695|gb|ADB76633.1| D-3-phosphoglycerate dehydrogenase [Geodermatophilus obscurus DSM
           43160]
          Length = 533

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 45/95 (47%), Gaps = 1/95 (1%)

Query: 1   VFSDGK-PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           +F   + P+ +++   + D+D    ++  V  D  G+V  VG  LGE GINIA   + R+
Sbjct: 433 LFGKNQVPKLVEVNGFDMDLDAAGYLLFFVYTDRPGVVGTVGAALGEAGINIAGAQVSRT 492

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
                A+  + +D  +   +L  ++  +  R  + 
Sbjct: 493 TRGGEALMAVTVDSPVPAELLGDIAGRIGAREARS 527


>gi|220931993|ref|YP_002508901.1| D-3-phosphoglycerate dehydrogenase [Halothermothrix orenii H 168]
 gi|219993303|gb|ACL69906.1| D-3-phosphoglycerate dehydrogenase [Halothermothrix orenii H 168]
          Length = 527

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 44/90 (48%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
            R I+I +   D+++    + I   D  G++  VG+ILG+  +NIA   +GR      AI
Sbjct: 437 LRIIEINDFRIDLNLEGKFLVISYQDKPGVIGKVGSILGQDNVNIASMQVGRKSYGGQAI 496

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             +  D     + +EK++ N+ +  +   E
Sbjct: 497 MIIQTDNKPSKATMEKINKNIELTDLTYLE 526


>gi|157165087|ref|YP_001466441.1| D-3-phosphoglycerate dehydrogenase [Campylobacter concisus 13826]
 gi|112801635|gb|EAT98979.1| phosphoglycerate dehydrogenase [Campylobacter concisus 13826]
          Length = 525

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 1/88 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + +     D      MI   N D+ G++  +  IL +  INIA F LGR +
Sbjct: 430 VFGENQQRIVTVNGFKTDFKPKGKMIIFKNHDVPGVIAQISKILADEKINIADFRLGRDE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVT 88
               A++ + +D  I    LE+L+    
Sbjct: 490 H-GMALAVILVDEHIKTETLERLNALEA 516


>gi|315636539|ref|ZP_07891775.1| phosphoglycerate dehydrogenase [Arcobacter butzleri JV22]
 gi|315479188|gb|EFU69885.1| phosphoglycerate dehydrogenase [Arcobacter butzleri JV22]
          Length = 528

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   R I++     DVD    MI + N DI G++  VG +LG+  INIA F L R +
Sbjct: 433 VFADDVQRVIELDGFAIDVDPKGKMIVMKNKDIPGVIGTVGKLLGDNKINIADFRLSRGK 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A++   ID  + + +++ L        V
Sbjct: 493 D-GIALAIALIDEKVTSEIIKNLDNLEATIAV 523


>gi|157738251|ref|YP_001490935.1| D-3-phosphoglycerate dehydrogenase [Arcobacter butzleri RM4018]
 gi|157700105|gb|ABV68265.1| D-3-phosphoglycerate dehydrogenase [Arcobacter butzleri RM4018]
          Length = 528

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   R I++     DVD    MI + N DI G++  VG +LG+  INIA F L R +
Sbjct: 433 VFADDVQRVIELDGFAIDVDPKGKMIVMKNKDIPGVIGTVGKLLGDNKINIADFRLSRGK 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A++   ID  + + +++ L        V
Sbjct: 493 D-GIALAIALIDEKVTSEIIKNLDNLEATIAV 523


>gi|325107117|ref|YP_004268185.1| D-3-phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
 gi|324967385|gb|ADY58163.1| D-3-phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
          Length = 546

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 46/99 (46%), Gaps = 2/99 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR-- 58
           +F     R + + +   D  +   M+   + D+ G++  VG  LG++ INI H  LGR  
Sbjct: 436 LFGREYLRLVLLDDYQLDGYLDGTMMVYRHKDVPGLIGAVGTTLGKHKINIGHMALGRET 495

Query: 59  SQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            Q    +I+   +D    + ++E++  +  +  V+  + 
Sbjct: 496 EQPGGDSIAVFNLDTRPSDEIIEEIRQHPDVTDVEIVQL 534


>gi|298706859|emb|CBJ25823.1| Phosphoglycerate dehydrogenase / Phosphoserine aminotransferase
           [Ectocarpus siliculosus]
          Length = 965

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/85 (32%), Positives = 43/85 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R + +  +  D +    M+   N D  G++  V  ILG+ GINIA F LGR ++   A+S
Sbjct: 480 RVVDVDGLEIDFNPSGHMLMFNNPDSPGMLRAVAAILGDQGINIASFALGRVRTGGVAMS 539

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFV 92
            L +D      +LE++     IR V
Sbjct: 540 CLNLDTPCTEGMLEEIRKIPDIRNV 564


>gi|254458447|ref|ZP_05071872.1| phosphoglycerate dehydrogenase [Campylobacterales bacterium GD 1]
 gi|207084755|gb|EDZ62042.1| phosphoglycerate dehydrogenase [Campylobacterales bacterium GD 1]
          Length = 528

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 46/92 (50%), Gaps = 1/92 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F DG  R + I   + +V +   MI   N+D+ G++  +G+ L    +NI+ F L R++
Sbjct: 433 IFDDGVKRIVAIDGFDIEVALKGDMILFKNSDVPGVIGSIGSTLARNNVNISDFSLARNK 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A++ + +D ++  + L  L+       V
Sbjct: 493 D-AEALAVILVDNAVNEATLNALASLEACLSV 523


>gi|325963764|ref|YP_004241670.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469851|gb|ADX73536.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 529

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 42/91 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I     ++ I   ++ +   D  G++  +G+ILG   INIA   + RS      ++
Sbjct: 438 KLVGINGFEVEIPISEHLVVVGYTDRPGVIGTIGHILGMNNINIAGMQVARSDEGGQVLA 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L ID ++   VL+ +   +    V++ +  
Sbjct: 498 LLTIDSAVPQQVLDAIKAGIGADMVREVDLE 528


>gi|311898491|dbj|BAJ30899.1| putative D-3-phosphoglycerate dehydrogenase [Kitasatospora setae
           KM-6054]
          Length = 528

 Score =  101 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 2/90 (2%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + +   + DV +   M      D  G+V  +G ILG+ GINIA   + R    + A++
Sbjct: 440 KIVGVDGFDVDVALTDHMAFFHYEDRPGVVGTLGRILGDAGINIAGMQVARD--GDSALA 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            + +D  +   VL +++  +  RF +    
Sbjct: 498 SITVDSEVSQEVLAEIAAAIGARFARSVNL 527


>gi|297559156|ref|YP_003678130.1| D-3-phosphoglycerate dehydrogenase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296843604|gb|ADH65624.1| D-3-phosphoglycerate dehydrogenase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 529

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 43/91 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I     ++ +   M+ +   D  G+V  VG +LG+ G+NIA   + R Q    A+ 
Sbjct: 438 KLVEINNYTMEIGLAEHMVFLSYEDRPGVVGTVGALLGDAGVNIAGMQVIRDQEGGKALI 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D ++ +  L  +S  +     +Q +  
Sbjct: 498 ALTVDSAVPDETLASISAEIDADISRQVDLE 528


>gi|302546895|ref|ZP_07299237.1| phosphoglycerate dehydrogenase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302464513|gb|EFL27606.1| phosphoglycerate dehydrogenase [Streptomyces himastatinicus ATCC
           53653]
          Length = 529

 Score =  101 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 43/93 (46%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
              + + + +   D+ +   +I +   D  G+V  VG++LGE G+NIA   + RS     
Sbjct: 436 NIQKIVSVGQHTIDLAVSDHLIFLRYKDRPGVVGTVGHVLGEAGLNIAGMQVSRSVPGGE 495

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            ++ L +D ++   VL +++      F +    
Sbjct: 496 TLAVLNVDSNVPADVLNEIAQETDATFARSVSL 528


>gi|304317984|ref|YP_003853129.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779486|gb|ADL70045.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 533

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 47/93 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++      + +    M+ + N DI G++  +GN+LG++GINIA  H+  +++  
Sbjct: 438 GDEIRIVEYLGHRVNFEPTEYMLFVRNKDIPGVIGHIGNVLGDFGINIASMHVSPNKNDG 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  +  D  I N  +E L+   +I   K  +
Sbjct: 498 TALMIVNTDREIPNEAVESLNKLNSILRAKAVK 530


>gi|271969249|ref|YP_003343445.1| D-3-phosphoglycerate dehydrogenase [Streptosporangium roseum DSM
           43021]
 gi|270512424|gb|ACZ90702.1| D-3-phosphoglycerate dehydrogenase [Streptosporangium roseum DSM
           43021]
          Length = 529

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 40/90 (44%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + +++     +++    +      D  GIV  VG ILG++GINIA   + R      A+ 
Sbjct: 438 KIVEVNGYQMEIEPTDHLSFFTYTDRPGIVGVVGRILGDHGINIASMQVARDVKGGKALI 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  I   V++++   +     +  + 
Sbjct: 498 ALTVDTGIPADVIDQIGAEIGADSGRSVDL 527


>gi|220913021|ref|YP_002488330.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter chlorophenolicus
           A6]
 gi|219859899|gb|ACL40241.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter chlorophenolicus
           A6]
          Length = 529

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 42/91 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I     ++ I   ++ +  AD  G++  +G+ILG   INIA   + R       ++
Sbjct: 438 KLVGINGFEVEIPISEHLVVVAYADRPGVIGTIGHILGMNNINIAGMQVARHDEGGQVLA 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L ID S+   VL+ +   +    V++ +  
Sbjct: 498 LLTIDSSVPQQVLDAIKAGIGAEMVREVDLE 528


>gi|154174389|ref|YP_001407860.1| D-3-phosphoglycerate dehydrogenase [Campylobacter curvus 525.92]
 gi|112803368|gb|EAU00712.1| phosphoglycerate dehydrogenase [Campylobacter curvus 525.92]
          Length = 525

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + I     D      MI   N D+ G++  +  IL +  INIA F LGR  
Sbjct: 430 VFGETEQRIVGINGFKTDFKPKGKMIIFKNHDVPGVIAQISKILADEKINIADFRLGRGD 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A++ + +D +I    L KL+  
Sbjct: 490 N-GMALAVILVDENISKETLTKLNAL 514


>gi|239982472|ref|ZP_04704996.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
 gi|291454320|ref|ZP_06593710.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
 gi|291357269|gb|EFE84171.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
          Length = 533

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG +LGE G+NI    + R+     A++
Sbjct: 442 KIVAIGEHDVDLSLADHMVVLRYEDRPGVVGTVGRVLGESGVNIGGMQVSRATVGGEALA 501

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++  +VL +L+  +     +  + 
Sbjct: 502 VLTVDDTVSQAVLTELAEEIGASVARSVDL 531


>gi|116671082|ref|YP_832015.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter sp. FB24]
 gi|116611191|gb|ABK03915.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter sp. FB24]
          Length = 529

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 42/91 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + +     ++ I   ++ +  AD  G++  +G+ILG   INIA   + R       ++
Sbjct: 438 KLVGVNGYEVEIPISEHLVVVAYADRPGVIGTIGHILGMNNINIAGMQVARQAEGGQVLA 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L ID S+   VL+ +   +    V++ +  
Sbjct: 498 LLTIDSSVPQQVLDAIKAGIGAEMVREVDLE 528


>gi|20808958|ref|NP_624129.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           tengcongensis MB4]
 gi|20517622|gb|AAM25733.1| Phosphoglycerate dehydrogenase and related dehydrogenases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 533

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 45/91 (49%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           + R ++      + +    M+ + N D+ G++  +GN+LG++GINI+   +  +++   A
Sbjct: 440 ELRIVEYMGHKVNFEPTEYMLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDGTA 499

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           +  +  D  I    +E L+   +I   K  +
Sbjct: 500 LMLVSTDKEIPEEAVESLNKLNSIIKAKAVK 530


>gi|297568578|ref|YP_003689922.1| D-3-phosphoglycerate dehydrogenase [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924493|gb|ADH85303.1| D-3-phosphoglycerate dehydrogenase [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 528

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 43/97 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   +PR ++      +      M+ + N D+ G++  + + +G+ G+NIA   +GR Q
Sbjct: 431 VFGKKEPRLVRFNTFRLEALPEGPMLFVHNNDVPGVIGKLASTIGDAGVNIARMTVGREQ 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            +   I  L  D  +   +L+K+     I      + 
Sbjct: 491 DSGRNIILLNTDSLLDRELLKKVKALDNIHDAMVLDL 527


>gi|28210417|ref|NP_781361.1| D-3-phosphoglycerate dehydrogenase [Clostridium tetani E88]
 gi|28202854|gb|AAO35298.1| D-3-phosphoglycerate dehydrogenase [Clostridium tetani E88]
          Length = 533

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +  + + ++I E   DV     M+ + N D+ G++  VG  LG  G+N+A   +GR  
Sbjct: 437 ISNRNEGKLVEIMEYEVDVKPTECMVFLQNYDVPGVIGHVGTFLGTNGVNVATMQVGRKL 496

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A+  L +D  +    L  L  +  I + K  + 
Sbjct: 497 KGDKALMLLNVDDKVTQDTLLGLQKHDDILWAKFVQL 533


>gi|296270774|ref|YP_003653406.1| D-3-phosphoglycerate dehydrogenase [Thermobispora bispora DSM
           43833]
 gi|296093561|gb|ADG89513.1| D-3-phosphoglycerate dehydrogenase [Thermobispora bispora DSM
           43833]
          Length = 529

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 40/76 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + +++     +++    +      D  GIV  VG ILGE+GINIA   + R+     A+ 
Sbjct: 438 KIVEVNGFAMEIEPTDHLAFFTYIDRPGIVGVVGRILGEHGINIASMQVSRNVKGGKALI 497

Query: 68  FLCIDGSILNSVLEKL 83
            L +D +I + ++E++
Sbjct: 498 ALTVDSAIPSELVEEI 513


>gi|148272280|ref|YP_001221841.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|147830210|emb|CAN01143.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
          Length = 529

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 43/89 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   + +V   R +I +   D  GIV   G   G+  +NIA   + R ++   A+S
Sbjct: 438 KLVEIDGYDVEVPFSRHLIVMKYEDRPGIVAVYGKEFGDAEVNIAGMQIARQEAGGRALS 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  + + VLE +   +    +++ +
Sbjct: 498 VLSVDSPVPDGVLENVRQAIQATSLREID 526


>gi|117927917|ref|YP_872468.1| D-3-phosphoglycerate dehydrogenase [Acidothermus cellulolyticus
           11B]
 gi|117648380|gb|ABK52482.1| D-3-phosphoglycerate dehydrogenas