PSIBLAST alignment of GI: peg_33 and protein with PDB id: 1sc6

>gi|61679883|pdb|1SC6|A Chain A, Crystal Structure Of W139g D-3-Phosphoglycerate Dehydrogenase Complexed With Nad+ Length = 404
>gi|61679884|pdb|1SC6|B Chain B, Crystal Structure Of W139g D-3-Phosphoglycerate Dehydrogenase Complexed With Nad+ Length = 404
 Score = 77.0 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 31/86 (36%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 319 VNFPEVSLPLHG-GRRLXHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQXGYVVIDI 377

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+           +  
Sbjct: 378 EADEDVAEKALQAXKAIPGTIRARLL 403