BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.33_1
         (100 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|325063120|gb|ADY66810.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium sp. H13-3]
          Length = 531

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 51/100 (51%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LGE G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKNINMDADVGSHMIYITNTDVPGMIGFMGTTLGEAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR V+   FN+D
Sbjct: 492 EGGDAIALLYVDGPVSEDVLDKLRANPAIRQVRPLTFNID 531


>gi|227823299|ref|YP_002827271.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium fredii NGR234]
 gi|227342300|gb|ACP26518.1| phosphoglycerate dehydrogenase [Sinorhizobium fredii NGR234]
          Length = 531

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 66/100 (66%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ + N D+ G++ F+G  LG+  +NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYLTNTDVPGMIGFIGTTLGDANVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +  +VL+KL  N  +R  K   FNVD
Sbjct: 492 QGGDAIALLYVDGPVSEAVLDKLRANPAVRQAKPLVFNVD 531


>gi|15891242|ref|NP_356914.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str.
           C58]
 gi|15159607|gb|AAK89699.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str.
           C58]
          Length = 531

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 53/100 (53%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LGE G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKNINMDADVGSHMIYITNTDVPGMIGFMGTTLGEAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR VK   FNVD
Sbjct: 492 EAGDAIALLYVDGPVSEEVLDKLRANSAIRQVKPLTFNVD 531


>gi|328542552|ref|YP_004302661.1| Aspartyl/glutamyl tRNA amidotransferase subunit C [Polymorphum
           gilvum SL003B-26A1]
 gi|326412298|gb|ADZ69361.1| Aspartyl/glutamyl tRNA amidotransferase subunit C [Polymorphum
           gilvum SL003B-26A1]
          Length = 528

 Score =  123 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 62/97 (63%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+++ IN + ++G  M+ I N D  G +   G +LG+ G+NIA F+LGR++
Sbjct: 432 VFADGKPRIIQVKGINMEAELGPHMLYITNEDKPGFIGKFGTLLGQAGVNIATFNLGRTE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI+ + +DG +    LE+++    ++ VK  +F
Sbjct: 492 AGGDAIALIEVDGDVPARTLEQINALPLVKQVKLLKF 528


>gi|307318345|ref|ZP_07597780.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti AK83]
 gi|306896027|gb|EFN26778.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti AK83]
          Length = 531

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ I N D+ G++ F+G+ LG+ G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYITNTDVPGMIGFIGSTLGDAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGPVSEIVLDKLRANEAIRQAKPLVFNID 531


>gi|307300480|ref|ZP_07580260.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C]
 gi|306904646|gb|EFN35230.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C]
          Length = 531

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ I N D+ G++ F+G+ LG+ G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYITNTDVPGMIGFIGSTLGDAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGPVSEIVLDKLRANEAIRQAKPLVFNID 531


>gi|15966483|ref|NP_386836.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti 1021]
 gi|15075754|emb|CAC47309.1| Putative D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti
           1021]
          Length = 531

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ I N D+ G++ F+G+ LG+ G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYITNTDVPGMIGFIGSTLGDAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +   VL+KL  N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGPVSEIVLDKLRANEAIRQAKPLVFNID 531


>gi|150397816|ref|YP_001328283.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium medicae WSM419]
 gi|150029331|gb|ABR61448.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium medicae WSM419]
          Length = 531

 Score =  123 bits (310), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 68/100 (68%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ + N D+ G++ F+G+ LG+ G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGAHMVYLTNTDVPGMIGFIGSTLGDAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG +  +VL++L  N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGPVSETVLDRLRANEAIRQAKPLVFNID 531


>gi|307944592|ref|ZP_07659932.1| phosphoglycerate dehydrogenase [Roseibium sp. TrichSKD4]
 gi|307772341|gb|EFO31562.1| phosphoglycerate dehydrogenase [Roseibium sp. TrichSKD4]
          Length = 528

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 58/97 (59%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+PR I+++ IN +  +   M+ I N D  G +  +G  LG  G+NIA F+LGR+ 
Sbjct: 432 VFADGRPRIIQVKGINMEAGLSEHMLYITNEDKPGFIGQLGMELGSNGVNIASFNLGRTA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E AI  + +DG +  S++ +LS    ++ VK  +F
Sbjct: 492 PGEDAICLIEVDGEVPASIMARLSAVPHVKQVKALQF 528


>gi|148261633|ref|YP_001235760.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|326405123|ref|YP_004285205.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium multivorum AIU301]
 gi|146403314|gb|ABQ31841.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|325051985|dbj|BAJ82323.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium multivorum AIU301]
          Length = 528

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   KPR ++++ I  + D GR M+ + N D  G +     IL E GINIA FHLGR++
Sbjct: 432 LFGGAKPRLVEVKGIKVEADFGRHMLYVTNRDKPGFIAQCSAILAEKGINIATFHLGRTE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  + ID ++ +  L  +     +    Q  F
Sbjct: 492 KGGDAVCLISIDETLPDDALAAIRALPQVMQATQISF 528


>gi|116253700|ref|YP_769538.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258348|emb|CAK09450.1| putative D-3-phosphoglycerate dehydrogenase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 531

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + ++VL +L+ +  +R  K   FN+D
Sbjct: 492 QGGDAIALLYVDGKVDDAVLAELTAHQAVRQAKPLTFNID 531


>gi|241206175|ref|YP_002977271.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860065|gb|ACS57732.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 531

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 47/100 (47%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + ++VL +L+ +  +R  K   FN+D
Sbjct: 492 QGGDAIALLYVDGKVDDAVLAELTAHQAVRQAKPLTFNID 531


>gi|218663595|ref|ZP_03519525.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli IE4771]
          Length = 535

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 436 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGGAGVNIANFQLGRDK 495

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 496 QGGDAIALLYVDGEVEDGVLEQLTAHQAIRQAKLLTFNID 535


>gi|190893267|ref|YP_001979809.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT
           652]
 gi|190698546|gb|ACE92631.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT
           652]
          Length = 531

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 50/100 (50%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FNVD
Sbjct: 492 QGGDAIALLYVDGEVEDGVLERLTAHQAIRQAKLLTFNVD 531


>gi|254504693|ref|ZP_05116844.1| D-3-phosphoglycerate dehydrogenase [Labrenzia alexandrii DFL-11]
 gi|222440764|gb|EEE47443.1| D-3-phosphoglycerate dehydrogenase [Labrenzia alexandrii DFL-11]
          Length = 528

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+++ IN + ++G  M+ I N D  G +  +G  LG   +NIA F+LGR+ 
Sbjct: 432 VFADGKPRIIQVKGINMEAELGEHMLYITNEDKPGFIGHLGMELGNNEVNIATFNLGRTA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E AI  + +D  +   V+ +L     ++ VK   F
Sbjct: 492 PGEEAICLVEVDAPVSKEVMARLETVSHVKQVKPLRF 528


>gi|327193458|gb|EGE60354.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli
           CNPAF512]
          Length = 531

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGEVEDGVLEQLTAHQAIRQAKLLTFNID 531


>gi|46201295|ref|ZP_00208046.1| COG0111: Phosphoglycerate dehydrogenase and related dehydrogenases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 526

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   K R ++I+ I+ + ++G  M+ + N D  G +  +G +LG  G+NIA FHLGRS+
Sbjct: 429 LFGGDKARVVEIKGISIEAELGSHMLYVTNQDKPGFIGALGTLLGANGVNIATFHLGRSE 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI    +D  + N +LEK+     +   K   F
Sbjct: 489 AGGDAILLTQVDQPVSNELLEKVRALPQVVQAKFLTF 525


>gi|304394494|ref|ZP_07376415.1| phosphoglycerate dehydrogenase [Ahrensia sp. R2A130]
 gi|303293404|gb|EFL87783.1| phosphoglycerate dehydrogenase [Ahrensia sp. R2A130]
          Length = 533

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 59/97 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN + + G  M+   N+D  GI+  +G + GE G+NIAHF+LGR+ 
Sbjct: 435 VFSDGKPRFIQIKGINMEAEAGEHMLYTTNSDAPGIIGKLGTLFGEAGVNIAHFYLGRNH 494

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AIS + +D  +    LEKL     I   K  EF
Sbjct: 495 AGGDAISLIQLDHPVPADFLEKLKDTPEIDSAKPLEF 531


>gi|46203185|ref|ZP_00208842.1| COG0111: Phosphoglycerate dehydrogenase and related dehydrogenases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 534

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DGKPR I+I+ I+ D      M+ + N D  G +   G++LGE G+N+A F LGR  
Sbjct: 438 VFHDGKPRVIEIRGIDIDAAFAPHMLYVRNHDKPGFIGRFGSVLGEAGVNVATFALGREA 497

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +DG +   VL+ +     ++ V+   F
Sbjct: 498 EGGNAIAFVAVDGPVPAEVLKTIEAIPQVKRVRPVRF 534


>gi|144897885|emb|CAM74749.1| D-3-phosphoglycerate dehydrogenase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 525

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 54/97 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   KPR + I+ I  + ++G  M+ + N D  G +  +G++LG  G+NIA FHLGRS+
Sbjct: 429 LFGGDKPRVVAIKGIPIEAELGSHMLYVTNQDKPGFIGALGSLLGARGVNIATFHLGRSE 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI    +D  + +++L+++     +   K   F
Sbjct: 489 AGGDAILLTQVDQPLTDAILDEVKALPHVVQAKALNF 525


>gi|154252585|ref|YP_001413409.1| D-3-phosphoglycerate dehydrogenase [Parvibaculum lavamentivorans
           DS-1]
 gi|154156535|gb|ABS63752.1| D-3-phosphoglycerate dehydrogenase [Parvibaculum lavamentivorans
           DS-1]
          Length = 525

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 56/97 (57%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFS G PR I+I+ +N +  +GR M+ + N D  G +  +G+ LG+ GINIA+F+LGR +
Sbjct: 429 VFSGGLPRLIQIKSVNMEAALGRHMLYVTNLDKPGFIGALGSTLGKAGINIANFNLGREK 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI  + +D  +  + L ++     +  VK   F
Sbjct: 489 AGGDAICLIEVDADVPAATLAEIQALPHVVQVKALSF 525


>gi|218675485|ref|ZP_03525154.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli GR56]
          Length = 531

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGEVEDGVLERLTAHQAIRQAKLLTFNID 531


>gi|209550768|ref|YP_002282685.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536524|gb|ACI56459.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 531

 Score =  120 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + ++VL +L+ N  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGDVDDTVLAQLTANQAIRQAKLLTFNID 531


>gi|298292958|ref|YP_003694897.1| D-3-phosphoglycerate dehydrogenase [Starkeya novella DSM 506]
 gi|296929469|gb|ADH90278.1| D-3-phosphoglycerate dehydrogenase [Starkeya novella DSM 506]
          Length = 528

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+PR ++I+ I  D +    M+ + N D  G V    ++LG+ GINIA F LGR +
Sbjct: 432 VFADGRPRIVEIKGIKVDAEFAPSMLYVTNEDRPGFVGRFASLLGDAGINIATFALGRDR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   +L+K+    +++  K   F
Sbjct: 492 QGGDAIALVEVDGKVPAELLDKVQQIPSVKQAKPLVF 528


>gi|118588317|ref|ZP_01545726.1| D-3-phosphoglycerate dehydrogenase [Stappia aggregata IAM 12614]
 gi|118439023|gb|EAV45655.1| D-3-phosphoglycerate dehydrogenase [Stappia aggregata IAM 12614]
          Length = 528

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+++ IN + ++G  M+ I N D  G +  +G  LG  G+NIA FHLGR  
Sbjct: 432 VFADGKPRIIQVKGINMEAELGPQMLYITNEDKPGFIGHLGMELGNSGVNIATFHLGRLA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + AI  + +DG +   VL +L     ++ VK  +F
Sbjct: 492 PGDDAICLVEVDGDVSPDVLARLEAVSHVKQVKALKF 528


>gi|86359045|ref|YP_470937.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli CFN 42]
 gi|86283147|gb|ABC92210.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CFN 42]
          Length = 531

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 66/100 (66%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VL +L+ +  IR  K   FN+D
Sbjct: 492 QGGDAIALLYVDGEVEDGVLTQLTAHQAIRQAKLLTFNID 531


>gi|158422609|ref|YP_001523901.1| D-3-phosphoglycerate dehydrogenase [Azorhizobium caulinodans ORS
           571]
 gi|158329498|dbj|BAF86983.1| D-3-phosphoglycerate dehydrogenase [Azorhizobium caulinodans ORS
           571]
          Length = 528

 Score =  119 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+PR + I+ I  D      M+ + N D  G +    ++LG+ G+NIA F LGR  
Sbjct: 432 VFADGQPRIVDIKGIKVDAGFAPNMLYVTNEDKPGFIGRFASLLGDAGVNIATFALGRDH 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   VL K+S    +R VKQ  F
Sbjct: 492 PGGDAIALVEVDGPVPADVLGKVSALPHVRQVKQLRF 528


>gi|255264452|ref|ZP_05343794.1| phosphoglycerate dehydrogenase [Thalassiobium sp. R2A62]
 gi|255106787|gb|EET49461.1| phosphoglycerate dehydrogenase [Thalassiobium sp. R2A62]
          Length = 530

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG+ M+   N D+ GI+  +G  +GE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGQHMLYTTNEDVPGIIGTLGQTMGENGVNIANFTLGRAD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L ID  +   V+ KL        VK  +F+V
Sbjct: 492 RGGEAIALLYIDDPVAADVIAKLEATEMFTQVKPLDFDV 530


>gi|218509868|ref|ZP_03507746.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli Brasil 5]
          Length = 254

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 155 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 214

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 215 QGGDAIALLYVDGEVEDGVLEQLTAHQAIRQAKLLTFNID 254


>gi|46198894|ref|YP_004561.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB27]
 gi|46196518|gb|AAS80934.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB27]
          Length = 521

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V   G+PR + I +   +V     M+  VN D  G+V  VG +LGE G+NIA   LGR  
Sbjct: 425 VVIGGRPRLVGIDDYALEVVPEGYMLVCVNYDRPGVVGQVGTLLGEAGVNIAGMQLGRDV 484

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D      VLE L     +  V   E 
Sbjct: 485 PGGRALFVLTVDQKPSPEVLEALRALPVLERVDLVEL 521


>gi|254473015|ref|ZP_05086413.1| phosphoglycerate dehydrogenase [Pseudovibrio sp. JE062]
 gi|211957736|gb|EEA92938.1| phosphoglycerate dehydrogenase [Pseudovibrio sp. JE062]
          Length = 532

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D KPR I+I+ IN + ++G  M+ + N D  G +  +G+ILG+  INIA F+LGR  
Sbjct: 432 VFGDQKPRIIQIKGINMEAELGENMLYVTNQDKPGFIGQLGSILGDAKINIATFNLGRKV 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E AI  + IDG I  + + +++    +   K   F
Sbjct: 492 EGEEAICLVEIDGEIAEATVNEIAAIEQVNQAKLLHF 528


>gi|55980921|ref|YP_144218.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB8]
 gi|55772334|dbj|BAD70775.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB8]
          Length = 521

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V   G+PR + I +   +V     M+  VN D  G+V  VG +LGE G+NIA   LGR  
Sbjct: 425 VVIGGRPRLVGIDDYALEVVPEGYMLVCVNYDRPGVVGQVGTLLGEAGVNIAGMQLGRDV 484

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D      VLE L     +  V   E 
Sbjct: 485 PGGRALFVLTVDQKPSPEVLEALRALPVLERVDLVEL 521


>gi|110635490|ref|YP_675698.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium sp. BNC1]
 gi|110286474|gb|ABG64533.1| D-3-phosphoglycerate dehydrogenase [Chelativorans sp. BNC1]
          Length = 532

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D  GI+  +G I G++G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINLDAEVGEHMLYTTNNDTPGIIGQLGTICGKHGVNIANFQLGRNR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D      VLE+L    +I   K   F+V
Sbjct: 492 PGGDAIALLYLDAPFPQPVLEELKSTGSIISAKPLRFDV 530


>gi|299134302|ref|ZP_07027495.1| D-3-phosphoglycerate dehydrogenase [Afipia sp. 1NLS2]
 gi|298591049|gb|EFI51251.1| D-3-phosphoglycerate dehydrogenase [Afipia sp. 1NLS2]
          Length = 529

 Score =  118 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DG PR + I+ I  D + G+ MI I N D  G +    ++LG+  +NIA FHLGR+Q
Sbjct: 433 VYADGAPRLVNIKGIRVDAEFGKSMIYITNEDKPGFIGQFASLLGDAKVNIATFHLGRNQ 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   +L K++    ++  K   F
Sbjct: 493 QGGDAIALVEVDGPVPAEILAKVAKLPHVKQAKALTF 529


>gi|83312292|ref|YP_422556.1| D-3-phosphoglycerate dehydrogenase [Magnetospirillum magneticum
           AMB-1]
 gi|82947133|dbj|BAE51997.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Magnetospirillum magneticum AMB-1]
          Length = 526

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   K R ++I+ I+ + ++G+ M+ + N D  G +  +G++LG  G+NIA FHLGRS+
Sbjct: 429 LFGGNKARVVEIKGISIEAELGQNMLYVTNQDKPGFIGALGSLLGANGVNIATFHLGRSE 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI    +D  + N +LEK+     +   K   F
Sbjct: 489 AGGDAILLTQVDQPVSNDLLEKVRALPQVVQAKFLTF 525


>gi|300709559|ref|YP_003735373.1| D-3-phosphoglycerate dehydrogenase [Halalkalicoccus jeotgali B3]
 gi|299123242|gb|ADJ13581.1| D-3-phosphoglycerate dehydrogenase [Halalkalicoccus jeotgali B3]
          Length = 537

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 44/98 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+D  PR ++I +   D      M+   N D  G + F+G +LGE GINIA     R  
Sbjct: 431 LFADDDPRIVRIDDYRVDAIPHGHMLVARNYDEPGTIGFIGTVLGENGINIAGMFNAREA 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               AI+   +D  +   +L +L  +  I   +    +
Sbjct: 491 IGGEAITVYDLDEEVGEELLAQLEDDERIIEARYITLD 528


>gi|163758780|ref|ZP_02165867.1| D-3-phosphoglycerate dehydrogenase [Hoeflea phototrophica DFL-43]
 gi|162284070|gb|EDQ34354.1| D-3-phosphoglycerate dehydrogenase [Hoeflea phototrophica DFL-43]
          Length = 531

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 68/100 (68%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G+ MI I N D+ G++ F+G+ LG+ G+NIA+FHLGR  
Sbjct: 432 VFSDGKPRFIQIKGINMDADVGQHMIYIANTDVPGMIGFMGSTLGDAGVNIANFHLGRET 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            +  AI+ L +D  +   VL KL+ +  I+  K   FNVD
Sbjct: 492 ESGDAIALLYVDELVSQDVLAKLTAHHAIKQAKPLVFNVD 531


>gi|170744437|ref|YP_001773092.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium sp. 4-46]
 gi|168198711|gb|ACA20658.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium sp. 4-46]
          Length = 531

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DG PR ++I+ I  +      M+ + NAD  G +   G +LGE G+N+A FHLGR +
Sbjct: 435 VFQDGVPRIVEIRSIPLEAAFAPHMLYVRNADQPGFIGRFGTLLGEAGVNVATFHLGRDR 494

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI F  +D  +  ++L ++     ++  +   F
Sbjct: 495 PGGDAICFAAVDQPVSPALLRQIEAIPQVKRARAVRF 531


>gi|17939923|emb|CAD19520.1| d-3 phosphoglycerate dehydrogenase, L-serine dehydratase [Rhizobium
           etli]
          Length = 125

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 48/100 (48%), Positives = 66/100 (66%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 26  VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 85

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VL +L+ +  IR  K   FN+D
Sbjct: 86  QGGDAIALLYVDGEVEDGVLTQLTAHQAIRQAKLLTFNID 125


>gi|218295353|ref|ZP_03496166.1| D-3-phosphoglycerate dehydrogenase [Thermus aquaticus Y51MC23]
 gi|218243985|gb|EED10511.1| D-3-phosphoglycerate dehydrogenase [Thermus aquaticus Y51MC23]
          Length = 521

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 33/92 (35%), Positives = 43/92 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V   GKPR + I +   +V     M+  VN D  G+V  VG +LGE G+NIA   LGR  
Sbjct: 425 VVIGGKPRLVGIDDYALEVVPEGYMLVCVNYDRPGVVGQVGTLLGEAGVNIAGMQLGRDV 484

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D      VLE L     +  V
Sbjct: 485 PGGRALFVLTVDQKPAPEVLEALRALPVLERV 516


>gi|126738641|ref|ZP_01754346.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. SK209-2-6]
 gi|126720440|gb|EBA17146.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. SK209-2-6]
          Length = 531

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +GE+G+NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNNDVPGIIGSLGQTMGEHGVNIANFTLGRSE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+       +K  +F+V
Sbjct: 492 AGGEAIALLYVDEPVPAEARAKLAETDLFNQIKPLQFDV 530


>gi|218516339|ref|ZP_03513179.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli 8C-3]
          Length = 231

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 132 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGAAGVNIANFQLGRDK 191

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG + + VLE+L+ +  IR  K   FN+D
Sbjct: 192 QGGDAIALLYVDGEVEDGVLEQLTAHQAIRQAKLLTFNID 231


>gi|222086960|ref|YP_002545494.1| D-3-phosphoglycerate dehydrogenase protein [Agrobacterium
           radiobacter K84]
 gi|221724408|gb|ACM27564.1| D-3-phosphoglycerate dehydrogenase protein [Agrobacterium
           radiobacter K84]
          Length = 531

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/100 (49%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  M+ + N D+ G++ F+G+ LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGNHMVYLANTDVPGMIGFIGSTLGSAGVNIANFQLGRDK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG I + VL KL+ +  IR  K   FNVD
Sbjct: 492 QGGDAIALLYVDGPINDEVLGKLTAHQAIRQAKPLVFNVD 531


>gi|87200693|ref|YP_497950.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87136374|gb|ABD27116.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 540

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +G+PR ++I  I  + D+   M+ IVN+D  G +  +G +LG+  INI  FHLGR +
Sbjct: 443 LFGNGQPRLVEIFGIGIEADLDGDMLYIVNSDAPGFIGRIGTLLGQNTINIGTFHLGRRE 502

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +   VL++      +R VK  +F
Sbjct: 503 AGGEAVLLLSLDNPVSEDVLKEAREIQGVRVVKALKF 539


>gi|326389093|ref|ZP_08210675.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206693|gb|EGD57528.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 528

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +G+PR ++I +I  + D+   M+ IVN D  G +  +G +LG+  INI  FHLGR Q
Sbjct: 431 LFGNGQPRLVEIFDIAVEADLDGDMLYIVNTDAPGFIGSIGTLLGQSNINIGTFHLGRRQ 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  + + VL K      +R VK  +F
Sbjct: 491 AGGEAVLLLSVDSPVSDEVLAKAKTLNGVRLVKALKF 527


>gi|209965081|ref|YP_002297996.1| D-3-phosphoglycerate dehydrogenase [Rhodospirillum centenum SW]
 gi|209958547|gb|ACI99183.1| D-3-phosphoglycerate dehydrogenase [Rhodospirillum centenum SW]
          Length = 525

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 57/97 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   KPR ++I+++  + ++   M+ I N D  G +  +G  LG+ G+NIA FHLGR+ 
Sbjct: 429 LFGGDKPRLVEIEDVPIEAEVTPNMLFIRNEDKPGFIGKLGTALGDAGVNIATFHLGRTA 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + E AI+ +C+D  + + ++E++    ++   K   F
Sbjct: 489 AGETAIALVCVDQPLGDDLVERIRALPSVVRAKALTF 525


>gi|258593832|emb|CBE70173.1| D-3-phosphoglycerate dehydrogenase [NC10 bacterium 'Dutch
           sediment']
          Length = 526

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 51/96 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +FS  +PR ++I E   +      ++   N D+ G++  +G +LG++ +NIA   LGR Q
Sbjct: 430 LFSRREPRVVRINEFRLEAIPEGYLLIFSNLDVPGVIGTIGTLLGKHRVNIAGMQLGREQ 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               A+S + +D  +   V++++     I FVK  +
Sbjct: 490 PGGRAVSVVNVDNPVPAHVIDEIRRLPNIVFVKLVK 525


>gi|85373221|ref|YP_457283.1| D-3-phosphoglycerate dehydrogenase [Erythrobacter litoralis
           HTCC2594]
 gi|84786304|gb|ABC62486.1| phosphoglycerate dehydrogenase [Erythrobacter litoralis HTCC2594]
          Length = 527

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I  +  +  +   M+ IVN D  G +  +G +LGE+GINI  F+LGR  
Sbjct: 431 LFGSDAPRLVEIFGVRIEAQLEGHMLYIVNEDAPGFIGRIGTLLGEHGINIGTFNLGRRS 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  I   V++       ++ V    F
Sbjct: 491 AGGEAVLLLSVDQPIPQDVVKAACALDGVKTVMPLSF 527


>gi|119383566|ref|YP_914622.1| D-3-phosphoglycerate dehydrogenase [Paracoccus denitrificans
           PD1222]
 gi|119373333|gb|ABL68926.1| D-3-phosphoglycerate dehydrogenase [Paracoccus denitrificans
           PD1222]
          Length = 529

 Score =  117 bits (294), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ G++  +G  LG+ G+NIA+F LGR++
Sbjct: 431 VFSDGKPRFIQIRGINVDAEIGEHMLYTRNRDVPGVIGALGMTLGDLGVNIANFTLGRTK 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           + + AI+ L +D  +    LE L        V+  +F V
Sbjct: 491 TGDDAIAILYLDEPLKPEALEALRATGKFLQVRPLQFEV 529


>gi|260891940|ref|YP_003238037.1| D-3-phosphoglycerate dehydrogenase [Ammonifex degensii KC4]
 gi|260864081|gb|ACX51187.1| D-3-phosphoglycerate dehydrogenase [Ammonifex degensii KC4]
          Length = 527

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 41/92 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             +PR ++I     D      ++ I + D   I+  +G ++G + INIA   +GR +   
Sbjct: 434 GKEPRVVEIDGYRVDAVPEGYVLFIPHLDRPRIIGRIGTLIGAHDINIAAMQVGRKEIGG 493

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            AI  L +D  +    L +++    +  VK  
Sbjct: 494 KAIMLLSVDSPVPEETLREIAKVENVLDVKML 525


>gi|169830231|ref|YP_001716213.1| D-3-phosphoglycerate dehydrogenase [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637075|gb|ACA58581.1| D-3-phosphoglycerate dehydrogenase [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 526

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 40/97 (41%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR + I     D      M+ I + D   I+  VG ++G++ +NIA   +GR  
Sbjct: 430 LFRGNDPRVVFIDGYRVDAVTEGHMLIIPHIDRPRIIGAVGTLIGQHDVNIAAMQVGRKV 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  +    LE +     I  V+    
Sbjct: 490 IGGRAVMVLMIDSPVPPETLEAIRRVDGILDVRMVSL 526


>gi|239832773|ref|ZP_04681102.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum intermedium LMG
           3301]
 gi|239825040|gb|EEQ96608.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum intermedium LMG
           3301]
          Length = 538

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 61/98 (62%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 438 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHNVNIANFSLGRDHP 497

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L+    I+     EFNV
Sbjct: 498 GGDAIAMLYVDEQIPQAALDELTAQEAIKAATPLEFNV 535


>gi|114763689|ref|ZP_01443083.1| D-3-phosphoglycerate dehydrogenase [Pelagibaca bermudensis
           HTCC2601]
 gi|114543690|gb|EAU46703.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. HTCC2601]
          Length = 531

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 63/99 (63%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G +LGE+ +N+A+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGEHMLYTTNEDVPGIIGKLGTMLGEHKVNLANFTLGRSA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+   +D ++  SV++ L      R VK  EF+V
Sbjct: 492 QGGEAIAIAYLDEAMDASVVDALKATGLFRQVKPLEFDV 530


>gi|220926557|ref|YP_002501859.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium nodulans ORS
           2060]
 gi|219951164|gb|ACL61556.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium nodulans ORS
           2060]
          Length = 531

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DG PR ++I+ I  +      M+ + NAD  G +   G +LGE G+N+A FHLGR +
Sbjct: 435 VFHDGVPRTVEIRSIPLEAAFAPHMLYVRNADQPGFIGRFGTLLGEAGVNVATFHLGRDR 494

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI F+ +D  +  ++L ++     ++  +   F
Sbjct: 495 PGGDAICFVAVDQPVSPALLRQIEAIPQVKRARAVRF 531


>gi|217977556|ref|YP_002361703.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
 gi|217502932|gb|ACK50341.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
          Length = 528

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I I  I  D  +G  M+ + N D  G +    +ILG  GINIA F LGR +
Sbjct: 432 VFNDGKPRIIMINGIKVDAAVGPSMVYVTNEDRPGFIGRFASILGNAGINIATFALGRDR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               +I+ + +D ++   VL+ +     ++  K   F
Sbjct: 492 EGGSSIALVEVDENVPEKVLDAVRRLPGVKEAKALRF 528


>gi|83588894|ref|YP_428903.1| D-3-phosphoglycerate dehydrogenase [Moorella thermoacetica ATCC
           39073]
 gi|83571808|gb|ABC18360.1| D-3-phosphoglycerate dehydrogenase [Moorella thermoacetica ATCC
           39073]
          Length = 525

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 42/93 (45%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+PR + +   + D      ++ I + D   I+  V   +G++G+NIA   +GR +    
Sbjct: 433 GEPRLVNLDGYSVDTIPAGHLLVIPHLDRPRIIGPVALAIGDHGVNIAAMQVGRRERGGQ 492

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           A+  + +D  +  + L+ +     +  V+    
Sbjct: 493 AVMLISVDSEVPRAALDAIRQVDGVLDVRYISL 525


>gi|295696411|ref|YP_003589649.1| D-3-phosphoglycerate dehydrogenase [Bacillus tusciae DSM 2912]
 gi|295412013|gb|ADG06505.1| D-3-phosphoglycerate dehydrogenase [Bacillus tusciae DSM 2912]
          Length = 527

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR ++I   + DV     ++   + D  GI+  VG++LG  G+NIA   +GR +
Sbjct: 431 LFNGLGPRIVQIDGYSVDVAPQGTLLITRHIDQPGIIGQVGSLLGAAGVNIAAMQVGRKE 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  +    L  +     I  V+    
Sbjct: 491 LGGQAVMVLAVDKPVDAETLANIGQVPGILAVRDVSL 527


>gi|260429359|ref|ZP_05783336.1| phosphoserine aminotransferase [Citreicella sp. SE45]
 gi|260419982|gb|EEX13235.1| phosphoserine aminotransferase [Citreicella sp. SE45]
          Length = 918

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 64/99 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G +LG++ +N+A+F LGRS 
Sbjct: 819 VFSDGKPRFIQIKGINIDAEVGEHMLYTTNEDVPGIIGKLGTLLGDHKVNLANFTLGRSA 878

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+   +D ++ +SV++ L      R VK  EF++
Sbjct: 879 QGAEAIAISYLDEALDDSVVKALKDTGLFRQVKPLEFDL 917


>gi|209886269|ref|YP_002290126.1| phosphoglycerate dehydrogenase [Oligotropha carboxidovorans OM5]
 gi|209874465|gb|ACI94261.1| phosphoglycerate dehydrogenase [Oligotropha carboxidovorans OM5]
          Length = 529

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DG PR + I+ I  D + G+ MI I N D  G +    ++LG+  +NIA FHLGR+Q
Sbjct: 433 VYADGAPRLVNIKGIRVDAEFGKSMIYITNEDKPGFIGKFASLLGDAKVNIATFHLGRNQ 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   +L K++    ++  K   F
Sbjct: 493 QGGDAIALVEVDGPVPQEILTKVAALPQVKQAKALAF 529


>gi|149912706|ref|ZP_01901240.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. AzwK-3b]
 gi|149813112|gb|EDM72938.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. AzwK-3b]
          Length = 531

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 64/99 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IGR M+   N D  GI+  +G  +GE G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGRHMLYTTNNDEPGIIGTLGQTMGENGVNIANFTLGRSN 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  I  +V++KL      + V+  +F+V
Sbjct: 492 AGGEAIALLYVDAPIETAVIKKLEATGKFQQVRALQFDV 530


>gi|83952581|ref|ZP_00961312.1| D-3-phosphoglycerate dehydrogenase [Roseovarius nubinhibens ISM]
 gi|83836254|gb|EAP75552.1| D-3-phosphoglycerate dehydrogenase [Roseovarius nubinhibens ISM]
          Length = 531

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 63/99 (63%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D  GI+  +G  +G+ G+NIA+F LGRSQ
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDEPGIIGMLGQTMGQNGVNIANFTLGRSQ 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   V+++L      + V+  +F+V
Sbjct: 492 AGGEAIALLYVDAEVPAPVIKQLEDTGMFKQVRPLQFDV 530


>gi|75677149|ref|YP_319570.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
 gi|74422019|gb|ABA06218.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
          Length = 529

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DG PR + I+ I  D + G+ MI + N D  G +    ++LG+ G+NIA F+LGR  
Sbjct: 433 VYADGHPRLVDIKGIRVDAEFGKSMIYVTNEDRPGFIGKFASLLGDAGVNIATFNLGRHS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DGS+  +VL K+     +R  K   F
Sbjct: 493 QGGDAIALVEVDGSVPENVLAKVQALPQVRQAKALTF 529


>gi|147676347|ref|YP_001210562.1| D-3-phosphoglycerate dehydrogenase [Pelotomaculum thermopropionicum
           SI]
 gi|146272444|dbj|BAF58193.1| phosphoglycerate dehydrogenase and related dehydrogenases
           [Pelotomaculum thermopropionicum SI]
          Length = 526

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 41/97 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R + I   + D      M+ I + D   I+  VGN++G + INI+   +GR  
Sbjct: 430 IFGKVDQRIVSIDGYHVDAVPEGHMLYIPHIDKPRIIGPVGNLIGTHNINISGMQVGRKV 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  +    + +++    +  VK    
Sbjct: 490 IGGKAVMLLNIDSPVPEETMAEIAKIDGVLGVKSVSI 526


>gi|320450108|ref|YP_004202204.1| phosphoglycerate dehydrogenase [Thermus scotoductus SA-01]
 gi|320150277|gb|ADW21655.1| phosphoglycerate dehydrogenase [Thermus scotoductus SA-01]
          Length = 521

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 42/88 (47%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GKPR + I +   +V     M+  +N D  G+V  VG +LGE G+NIA   LGR      
Sbjct: 429 GKPRLVGIDDYALEVVPEGYMLVCINYDRPGVVGQVGTLLGEAGVNIAGMQLGRDVPGGR 488

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFV 92
           A+  L +D      VLE L     +  V
Sbjct: 489 ALFVLTVDEKPSPEVLEALRALPVLERV 516


>gi|167629222|ref|YP_001679721.1| d-3-phosphoglycerate dehydrogenase [Heliobacterium modesticaldum
           Ice1]
 gi|167591962|gb|ABZ83710.1| d-3-phosphoglycerate dehydrogenase [Heliobacterium modesticaldum
           Ice1]
          Length = 526

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 48/93 (51%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            KPRF+ I   + D+     M+ + + D   I+  +G I+GE+ +NIA  HLGR     +
Sbjct: 433 NKPRFVSIDGYDMDMAPEGHMLVVPHTDKPRIIGQLGTIIGEHNVNIAGMHLGRKDFGGN 492

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           A++ L IDG +  +VL  L+    +  VK    
Sbjct: 493 AVAILTIDGPVPAAVLTDLAKIDGVADVKYVNL 525


>gi|56698179|ref|YP_168551.1| D-3-phosphoglycerate dehydrogenase [Ruegeria pomeroyi DSS-3]
 gi|56679916|gb|AAV96582.1| D-3-phosphoglycerate dehydrogenase [Ruegeria pomeroyi DSS-3]
          Length = 531

 Score =  115 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +G  +GE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGINVDAEIGAHMLYTTNEDVPGIIGTLGQTMGENGVNIANFTLGRAA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+       +K  EF+V
Sbjct: 492 AGGEAIALLYVDEPVPAEARAKLAETGLFNQIKPLEFDV 530


>gi|92116697|ref|YP_576426.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter hamburgensis X14]
 gi|91799591|gb|ABE61966.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter hamburgensis X14]
          Length = 529

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 57/97 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+ G+NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAGVNIATFNLGRHG 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++  +VL K+     ++ VK   F
Sbjct: 493 QGGDAIALVEVDGNVPENVLAKVQALPQVKQVKALTF 529


>gi|52080816|ref|YP_079607.1| D-3-phosphoglycerate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|52786187|ref|YP_092016.1| D-3-phosphoglycerate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|319645226|ref|ZP_07999459.1| SerA protein [Bacillus sp. BT1B_CT2]
 gi|52004027|gb|AAU23969.1| phosphoglycerate dehydrogenase SerA [Bacillus licheniformis ATCC
           14580]
 gi|52348689|gb|AAU41323.1| SerA [Bacillus licheniformis ATCC 14580]
 gi|317393035|gb|EFV73829.1| SerA protein [Bacillus sp. BT1B_CT2]
          Length = 525

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 3/96 (3%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F     R + +   + D      ++ I + D  G +  VG ILG++ INIA   +GR + 
Sbjct: 432 FGG---RIVALNGFDIDFYPAGHLVYIHHQDKPGAIGHVGRILGDHDINIATMQVGRKEK 488

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              AI  L  D  + + +L +L     I  VK  + 
Sbjct: 489 GGEAIMMLSFDRHLEDDILAELKNIPDIVSVKAIDL 524


>gi|254700347|ref|ZP_05162175.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261750842|ref|ZP_05994551.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261740595|gb|EEY28521.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
          Length = 533

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 42/98 (42%), Positives = 61/98 (62%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR Q 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDQP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|260432240|ref|ZP_05786211.1| phosphoglycerate dehydrogenase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416068|gb|EEX09327.1| phosphoglycerate dehydrogenase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 531

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +GE+G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGKTMGEHGVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+       +K  EF+V
Sbjct: 492 AGGEAIALLYVDEPVPAEARAKLAETGLFTQIKPLEFDV 530


>gi|225628254|ref|ZP_03786288.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti str. Cudo]
 gi|225616100|gb|EEH13148.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti str. Cudo]
          Length = 538

 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 438 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 497

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 498 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 535


>gi|149202983|ref|ZP_01879954.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. TM1035]
 gi|149143529|gb|EDM31565.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. TM1035]
          Length = 531

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 64/99 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IGR M+   N D+ GI+  +G  +G++G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGRHMLYTTNEDVPGIIGTLGMTMGDHGVNIANFTLGRSD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  + ++ L      + +++  F+V
Sbjct: 492 AGGEAIALLYVDAPVPEAAIKALHATGKFQQIRELRFDV 530


>gi|254466037|ref|ZP_05079448.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium Y4I]
 gi|206686945|gb|EDZ47427.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium Y4I]
          Length = 531

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN + D+G  M+   N D+ GI+  +G  LG+ G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINLEADVGAHMLYTTNEDVPGIIGTLGQTLGDNGVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   +  KL+       +K  EF+V
Sbjct: 492 AGGEAIALLYVDEPVPAEIRAKLAETGLFNQIKPLEFDV 530


>gi|256160401|ref|ZP_05458090.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
 gi|265998770|ref|ZP_06111327.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
 gi|262553459|gb|EEZ09228.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
          Length = 533

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|86139432|ref|ZP_01058001.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. MED193]
 gi|85823935|gb|EAQ44141.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. MED193]
          Length = 531

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 63/99 (63%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +GE+G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNNDVPGIIGTLGQTMGEHGVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D ++      KL+       +K  +F+V
Sbjct: 492 AGGEAIALLYVDAAVPAEARAKLAETDLFNQIKPLQFDV 530


>gi|260167901|ref|ZP_05754712.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
 gi|261757340|ref|ZP_06001049.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
 gi|261737324|gb|EEY25320.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
          Length = 533

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|254453066|ref|ZP_05066503.1| phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
 gi|198267472|gb|EDY91742.1| phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
          Length = 516

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  MI   N D+ GI+  +G  +G++ +NIA+F LGRS 
Sbjct: 417 VFSDGKPRFIQIKGINIDAEIGAHMIYTTNEDVPGIIGTLGQTMGKHNVNIANFTLGRSA 476

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D ++  + L ++        VK   F+V
Sbjct: 477 ANGEAIALLYVDETVPAAALAEIEATGMFTQVKPLTFDV 515


>gi|89070040|ref|ZP_01157371.1| D-3-phosphoglycerate dehydrogenase [Oceanicola granulosus HTCC2516]
 gi|89044377|gb|EAR50515.1| D-3-phosphoglycerate dehydrogenase [Oceanicola granulosus HTCC2516]
          Length = 530

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG+ M+   N D+ GI+  +G  +G  G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGQHMLYTTNEDVPGIIGTLGTTMGSNGVNIANFTLGRSA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +    L+ L      R VK  +F V
Sbjct: 492 AKGEAIALLYVDEEVPAKALDALKQTGMFRQVKTLQFEV 530


>gi|163845265|ref|YP_001622920.1| D-3-phosphoglycerate dehydrogenase [Brucella suis ATCC 23445]
 gi|163675988|gb|ABY40098.1| D-3-phosphoglycerate dehydrogenase [Brucella suis ATCC 23445]
          Length = 533

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|294850937|ref|ZP_06791613.1| phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|294821580|gb|EFG38576.1| phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-0026]
          Length = 533

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|254708700|ref|ZP_05170511.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261316192|ref|ZP_05955389.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261295415|gb|EEX98911.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
          Length = 533

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|23502543|ref|NP_698670.1| D-3-phosphoglycerate dehydrogenase [Brucella suis 1330]
 gi|148559678|ref|YP_001259539.1| D-3-phosphoglycerate dehydrogenase [Brucella ovis ATCC 25840]
 gi|161619616|ref|YP_001593503.1| D-3-phosphoglycerate dehydrogenase [Brucella canis ATCC 23365]
 gi|254703466|ref|ZP_05165294.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|254708447|ref|ZP_05170275.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|254714547|ref|ZP_05176358.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|254717444|ref|ZP_05179255.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|254719689|ref|ZP_05181500.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|256030226|ref|ZP_05443840.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|256061723|ref|ZP_05451860.1| D-3-phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|256370095|ref|YP_003107606.1| D-3-phosphoglycerate dehydrogenase [Brucella microti CCM 4915]
 gi|260568773|ref|ZP_05839241.1| SerA family protein [Brucella suis bv. 4 str. 40]
 gi|261219276|ref|ZP_05933557.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|261315946|ref|ZP_05955143.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261322337|ref|ZP_05961534.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|261325728|ref|ZP_05964925.1| phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|261754095|ref|ZP_05997804.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|265984704|ref|ZP_06097439.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|265987255|ref|ZP_06099812.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|306837853|ref|ZP_07470715.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. NF 2653]
 gi|306841404|ref|ZP_07474106.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO2]
 gi|306844678|ref|ZP_07477263.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO1]
 gi|23348542|gb|AAN30585.1| D-3-phosphoglycerate dehydrogenase [Brucella suis 1330]
 gi|148370935|gb|ABQ60914.1| phosphoglycerate dehydrogenase [Brucella ovis ATCC 25840]
 gi|161336427|gb|ABX62732.1| D-3-phosphoglycerate dehydrogenase [Brucella canis ATCC 23365]
 gi|256000258|gb|ACU48657.1| D-3-phosphoglycerate dehydrogenase [Brucella microti CCM 4915]
 gi|260154157|gb|EEW89239.1| SerA family protein [Brucella suis bv. 4 str. 40]
 gi|260924365|gb|EEX90933.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|261295027|gb|EEX98523.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|261301708|gb|EEY05205.1| phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|261304972|gb|EEY08469.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261743848|gb|EEY31774.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|264659452|gb|EEZ29713.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|264663296|gb|EEZ33557.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|306274850|gb|EFM56620.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO1]
 gi|306288510|gb|EFM59862.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO2]
 gi|306407092|gb|EFM63309.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. NF 2653]
          Length = 533

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|116071264|ref|ZP_01468533.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. BL107]
 gi|116066669|gb|EAU72426.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. BL107]
          Length = 528

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G+++GE+ +NIA   +GR  
Sbjct: 432 VFADGELRITSIDEFPVNVSPSRHMLFTRHRDMPGIIGHLGSMMGEHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I   +L+K++    I+       
Sbjct: 492 VRGDAVMVLSIDDPIPAELLQKITAIDGIQEAHPVTL 528


>gi|17986632|ref|NP_539266.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
 gi|17982247|gb|AAL51530.1| d-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
          Length = 538

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 438 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 497

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 498 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 535


>gi|254559246|ref|YP_003066341.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens DM4]
 gi|254266524|emb|CAX22288.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens DM4]
          Length = 535

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ IN D     LM+ + N D  G V   G +LGE G+N+A F +GR  
Sbjct: 439 VFNDGKPRVIEIRGINIDAPFAPLMLYVRNHDRPGFVGSFGTVLGEAGVNLATFAMGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIEAIPQVKRVRPVRF 535


>gi|240137235|ref|YP_002961704.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens AM1]
 gi|240007201|gb|ACS38427.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens AM1]
          Length = 535

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ IN D     LM+ + N D  G V   G +LGE G+N+A F +GR  
Sbjct: 439 VFNDGKPRVIEIRGINIDAPFAPLMLYVRNHDRPGFVGSFGTVLGEAGVNLATFAMGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIEAIPQVKRVRPVRF 535


>gi|90425581|ref|YP_533951.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
 gi|90107595|gb|ABD89632.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
          Length = 529

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 54/97 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG PR + I+ I  D + G+ MI + N D  G +    ++LG+  INIA F+LGR +
Sbjct: 433 VFADGHPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKINIATFNLGRHE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   V+ K+     ++  K   F
Sbjct: 493 LGGDAIALVEVDGAVPAEVIAKVQALPQVKQAKALVF 529


>gi|171909940|ref|ZP_02925410.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobium spinosum DSM
           4136]
          Length = 534

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 46/91 (50%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F  G PR +KI     +      ++ + N D  G++   G ILG++ +NIA+  L R++ 
Sbjct: 437 FFGGDPRIVKINGRRVEAKPEGTLLLLENDDRPGMIGAYGTILGQHQVNIANMSLSRNEE 496

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
              A++ L +D +  + V++ L     ++ V
Sbjct: 497 GGTAMTLLTLDTAPADVVIKDLETIPGVKRV 527


>gi|85705886|ref|ZP_01036982.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. 217]
 gi|85669474|gb|EAQ24339.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. 217]
          Length = 531

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 64/99 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IGR M+   N D+ GI+  +G  +GE G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGRHMLYTTNEDVPGIIGTLGMTMGENGVNIANFTLGRSD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  + ++ L      + +++ +F+V
Sbjct: 492 AGGEAIALLYVDAPVPEAAIKALHATGKFQQIRELKFDV 530


>gi|56420782|ref|YP_148100.1| D-3-phosphoglycerate dehydrogenase [Geobacillus kaustophilus
           HTA426]
 gi|56380624|dbj|BAD76532.1| phosphoglycerate dehydrogenase [Geobacillus kaustophilus HTA426]
          Length = 510

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 45/89 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +    +  D      ++ I + D  G++  VGN+LG + +NIA   +GR ++   A+ 
Sbjct: 421 RIVHFDGVAIDFAPEGHLLYIQHQDRPGMIGKVGNVLGAHDVNIATMQVGRQEAGGKAMM 480

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  + + VL+ L+    I  VK+ E
Sbjct: 481 ILSLDKPVDDEVLQALAQIDDIETVKRLE 509


>gi|114704945|ref|ZP_01437853.1| phosphoglycerate dehydrogenase [Fulvimarina pelagi HTCC2506]
 gi|114539730|gb|EAU42850.1| phosphoglycerate dehydrogenase [Fulvimarina pelagi HTCC2506]
          Length = 532

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 39/98 (39%), Positives = 60/98 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D  GI+  +G + G+ G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGEHMVYTTNNDAPGIIGLLGTVFGKAGVNIANFQLGRNR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               AI+ L +D ++   VL+++  +  I       F+
Sbjct: 492 PGGDAIALLYVDSAVPEGVLDQVRDHKEIHRAVALRFD 529


>gi|163850102|ref|YP_001638145.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium extorquens
           PA1]
 gi|163661707|gb|ABY29074.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium extorquens
           PA1]
          Length = 535

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ IN D     LM+ + N D  G V   G +LGE G+N+A F +GR  
Sbjct: 439 VFNDGKPRVIEIRGINIDAPFAPLMLYVRNHDRPGFVGSFGTVLGEAGVNLATFAMGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIEAIPQVKRVRPVRF 535


>gi|153008560|ref|YP_001369775.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560448|gb|ABS13946.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum anthropi ATCC
           49188]
          Length = 533

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGK RFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ INIA+F LGR   
Sbjct: 433 FSDGKARFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHNINIANFSLGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L+    I+     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELTAQEAIKAATPLEFNV 530


>gi|312110403|ref|YP_003988719.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y4.1MC1]
 gi|311215504|gb|ADP74108.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y4.1MC1]
          Length = 524

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 47/89 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +       D      ++ I + D  G++  VGNILGE+ INIA   +GR Q+   AI 
Sbjct: 435 RIVHFDGFTIDFAPEGHLLYIQHQDRPGMIGKVGNILGEHQINIATMQVGRQQAGGKAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  I +++L+KL+    I  VK+ E
Sbjct: 495 MLSLDKPIDDALLQKLTEIEDIETVKRVE 523


>gi|218528706|ref|YP_002419522.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium
           chloromethanicum CM4]
 gi|218521009|gb|ACK81594.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium
           chloromethanicum CM4]
          Length = 535

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ IN D     LM+ + N D  G V   G +LGE G+N+A F +GR  
Sbjct: 439 VFNDGKPRVIEIRGINIDAPFAPLMLYVRNHDRPGFVGSFGTVLGEAGVNLATFAMGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIEAIPQVKRVRPVRF 535


>gi|225853142|ref|YP_002733375.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis ATCC 23457]
 gi|256045296|ref|ZP_05448190.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256263367|ref|ZP_05465899.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260565812|ref|ZP_05836295.1| aspartyl/glutamyl tRNA amidotransferase subunit C [Brucella
           melitensis bv. 1 str. 16M]
 gi|265991722|ref|ZP_06104279.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|225641507|gb|ACO01421.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis ATCC 23457]
 gi|260151185|gb|EEW86280.1| aspartyl/glutamyl tRNA amidotransferase subunit C [Brucella
           melitensis bv. 1 str. 16M]
 gi|263002678|gb|EEZ15081.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093365|gb|EEZ17434.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|326409698|gb|ADZ66763.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis M28]
 gi|326539406|gb|ADZ87621.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis M5-90]
          Length = 533

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|149186566|ref|ZP_01864878.1| phosphoglycerate dehydrogenase [Erythrobacter sp. SD-21]
 gi|148829793|gb|EDL48232.1| phosphoglycerate dehydrogenase [Erythrobacter sp. SD-21]
          Length = 537

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I  +  + ++   M+ IVN D  G +  +G++LGE GINI  F+LGR  
Sbjct: 441 LFGADAPRLVEIFGVRIEAELDGHMLYIVNEDAPGFIGRIGSLLGENGINIGTFNLGRRA 500

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  I N V++K      ++ V    F
Sbjct: 501 AGGEAVLLLSVDQPIPNEVVKKACALEGVKTVMPLAF 537


>gi|258511215|ref|YP_003184649.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477941|gb|ACV58260.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 529

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 50/97 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +  PR +++     D  I  ++I   + D  G++  +G +LG+  INIA   +GR +
Sbjct: 433 VLGEYGPRIVELDGYPIDTPIQGILIYTRHEDRPGMIGRIGTLLGDRDINIAGMQVGRRE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +   V+++++ +  IR V+  E 
Sbjct: 493 TGGEAVMLLSVDKRVPQDVIDEIAKHPGIRLVRAIEL 529


>gi|15614165|ref|NP_242468.1| D-3-phosphoglycerate dehydrogenase [Bacillus halodurans C-125]
 gi|10174219|dbj|BAB05321.1| D-3-phosphoglycerate dehydrogenase [Bacillus halodurans C-125]
          Length = 540

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 43/91 (47%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR +KI   N D      +I I + D  G++  +G +L E+ +NIA   +GR +    AI
Sbjct: 450 PRIVKINGFNVDFVPEGHLIYIQHNDRPGVIGKMGQLLAEHNVNIATMQVGRQEEGGDAI 509

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + +D    + V+E L     I F  + E 
Sbjct: 510 MMVAVDKVATDEVIEALKAVDEIHFADRIEL 540


>gi|222149645|ref|YP_002550602.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis S4]
 gi|221736627|gb|ACM37590.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis S4]
          Length = 531

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 46/100 (46%), Positives = 67/100 (67%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 432 VFSDGKPRFIQIKGINLDADVGPHMIYISNTDVPGMIGFMGTTLGNAGVNIANFQLGREK 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            +  AI+ L +DG +  +VL++L+ N  I+  +   F V+
Sbjct: 492 ESGDAIALLYVDGPVEQTVLDQLTANAAIKQARLLTFAVE 531


>gi|256114254|ref|ZP_05454999.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265995559|ref|ZP_06108116.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|262766843|gb|EEZ12461.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
          Length = 533

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRAATPLEFNV 530


>gi|261417914|ref|YP_003251596.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC61]
 gi|297529583|ref|YP_003670858.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. C56-T3]
 gi|319767274|ref|YP_004132775.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC52]
 gi|261374371|gb|ACX77114.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC61]
 gi|297252835|gb|ADI26281.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. C56-T3]
 gi|317112140|gb|ADU94632.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC52]
          Length = 524

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 45/89 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +    +  D      ++ I + D  G++  VGN+LG + +NIA   +GR ++   A+ 
Sbjct: 435 RIVHFDGVAIDFAPEGHLLYIQHQDRPGMIGKVGNVLGAHDVNIATMQVGRQEAGGKAMM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  + + VL+ L+    I  VK+ E
Sbjct: 495 ILSLDKPVDDEVLQALAQIDDIETVKRLE 523


>gi|148253350|ref|YP_001237935.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. BTAi1]
 gi|146405523|gb|ABQ34029.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. BTAi1]
          Length = 529

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+  INIA FHLGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKINIATFHLGRVA 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI+ + IDG++   +L K+     ++  K   F
Sbjct: 493 AGSDAIALVEIDGAVPAELLAKIQALPQVKQAKALTF 529


>gi|78184104|ref|YP_376539.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9902]
 gi|78168398|gb|ABB25495.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9902]
          Length = 528

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G+++GE+ +NIA   +GR  
Sbjct: 432 VFADGELRITSIDEYPVNVSPSRHMLFTRHRDMPGIIGHLGSMMGEHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I   +L+K++    I+       
Sbjct: 492 VRGDAVMVLSIDDPIPADLLQKITAIDGIQEAHPVTL 528


>gi|196248716|ref|ZP_03147416.1| amino acid-binding ACT domain protein [Geobacillus sp. G11MC16]
 gi|196211592|gb|EDY06351.1| amino acid-binding ACT domain protein [Geobacillus sp. G11MC16]
          Length = 310

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 46/89 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +    +  D      ++ I + D  G++  VGNILG + +NIA   +GR ++   A+ 
Sbjct: 221 RIVHFDGVAIDFAPEGHLLYIQHQDRPGMIGKVGNILGAHDVNIATMQVGRQEAGGKAMM 280

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  + ++VL+ L+    I  VK+ E
Sbjct: 281 ILSLDKPVDDAVLKTLAQIDDIETVKRLE 309


>gi|146342773|ref|YP_001207821.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. ORS278]
 gi|146195579|emb|CAL79606.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. ORS278]
          Length = 529

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 54/97 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+  INIA FHLGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKINIATFHLGRVA 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   +L K+     ++  K   F
Sbjct: 493 PGSDAIALVEVDGAVPAELLAKIQALPQVKQAKALAF 529


>gi|328950683|ref|YP_004368018.1| D-3-phosphoglycerate dehydrogenase [Marinithermus hydrothermalis
           DSM 14884]
 gi|328451007|gb|AEB11908.1| D-3-phosphoglycerate dehydrogenase [Marinithermus hydrothermalis
           DSM 14884]
          Length = 521

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             +PR + I +   +V     ++  VN D  G+V  VG +LGE G+NIA   LGR     
Sbjct: 428 GSQPRLVGIDDYPLEVVPEGHLLVCVNHDRPGVVGRVGTLLGEAGVNIAGMQLGRDAPGG 487

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D      VLE L+    +  V   E 
Sbjct: 488 RALFVLTVDERPSPEVLEALARLEVLERVDVVEL 521


>gi|295398990|ref|ZP_06808972.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294978456|gb|EFG54052.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 524

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 47/89 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +       D      ++ I + D  G++  VGNILGE+ INIA   +GR Q+   AI 
Sbjct: 435 RIVHFDGFTIDFAPEGHLLYIQHQDRPGMIGKVGNILGEHQINIATMQVGRQQAGGKAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  I +++L+KL+    I  VK+ E
Sbjct: 495 MLSLDKPIDDTLLQKLTEIEDIETVKRVE 523


>gi|217977921|ref|YP_002362068.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
 gi|217503297|gb|ACK50706.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
          Length = 531

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF  GKPR I +  I  D  +  +MI + N D  G V    +ILG  G+NIA F LGR +
Sbjct: 432 VFHAGKPRIISVNGIEVDAVVAPVMIYVSNDDKPGFVGRFTSILGAAGLNIATFALGRDR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++ + +DG++ + VL  +     +R VK   F
Sbjct: 492 EGGSAVALIAVDGAVPDEVLADIRAAPGVREVKALHF 528


>gi|90418985|ref|ZP_01226896.1| D-3-phosphoglycerate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337065|gb|EAS50770.1| D-3-phosphoglycerate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 535

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 59/99 (59%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G+ M+   N D  GI+  +G   G  G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINLDAEVGQHMVYTTNNDAPGIIGLLGTTFGAAGVNIANFQLGRNR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  +   +L+ +  +  I   K   F+V
Sbjct: 492 PGGDAIALLYLDSPMPEDLLKTVLSHKEIISAKPLRFDV 530


>gi|159045858|ref|YP_001534652.1| D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shibae DFL 12]
 gi|157913618|gb|ABV95051.1| D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shibae DFL 12]
          Length = 531

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D  G++  +G ILGE  +NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGEHMLYTTNKDTPGMIGTLGGILGENQVNIANFTLGRNE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   V +KL      + V+  +FNV
Sbjct: 492 TNGDAIAMLYLDAPLPRDVQDKLIATGLFQQVRPLQFNV 530


>gi|218289859|ref|ZP_03494049.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239999|gb|EED07185.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 529

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +  PR +++     D  I  ++I   + D  G++  +G +LG+  INIA   +GR +
Sbjct: 433 VLGEYGPRIVELDGYPIDTPIQGILIYTRHEDRPGMIGRIGTLLGDRDINIAGMQVGRRE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D S+   V+++++ +  IR V+  E 
Sbjct: 493 TGGEAVMLLSVDKSVPQDVIDEIAKHPGIRLVRSIEL 529


>gi|316935825|ref|YP_004110807.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           DX-1]
 gi|315603539|gb|ADU46074.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           DX-1]
          Length = 529

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G  MI + N D  G +    ++LG+  +NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGASMIYVTNEDKPGFIGKFASLLGDAKVNIATFNLGRHS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + IDG     VLEK+     ++ VK   F
Sbjct: 493 QGGDAIALVEIDGPAPAEVLEKVQALPPVKQVKALTF 529


>gi|85715274|ref|ZP_01046257.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter sp. Nb-311A]
 gi|85697920|gb|EAQ35794.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter sp. Nb-311A]
          Length = 549

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DG PR + I+ I  D + G+ MI + N D  G +    ++LG+ G+NIA F+LGR  
Sbjct: 453 VYADGHPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGRFASLLGDAGLNIATFNLGRHS 512

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DGS+  +VL K+     ++  K   F
Sbjct: 513 QGGDAIALVEVDGSVPENVLAKVQALPQVKQAKALTF 549


>gi|237816063|ref|ZP_04595059.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus str. 2308 A]
 gi|237788726|gb|EEP62938.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus str. 2308 A]
          Length = 538

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 438 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 497

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 498 GGDAIAMLYVDEQIPQAALDELMAQEAIRVATPLEFNV 535


>gi|163796990|ref|ZP_02190946.1| Phosphoglycerate dehydrogenase and related dehydrogenase [alpha
           proteobacterium BAL199]
 gi|159177737|gb|EDP62288.1| Phosphoglycerate dehydrogenase and related dehydrogenase [alpha
           proteobacterium BAL199]
          Length = 525

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 51/95 (53%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
              KPR +++Q I  + D GR M+ + N D  G +  +G+ LG +G+NIA FHLGR    
Sbjct: 431 GGTKPRLVEVQGIAIEADFGRHMLYVRNYDKPGFIGALGSALGNHGVNIATFHLGRRDVG 490

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             AI+ + +D +I  ++L ++     +  V    F
Sbjct: 491 GEAIALVEVDQAIDAALLTEVQSLPHVVRVNALSF 525


>gi|33865069|ref|NP_896628.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 8102]
 gi|33638753|emb|CAE07048.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 8102]
          Length = 528

 Score =  113 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V     M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRITSIDEFPVNVTPSSHMLFTRHRDMPGIIGQLGSMLGEHNVNIAAMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++L+ ++    I+       
Sbjct: 492 VRGDAVMVLSIDDPIPAALLQTITAIEGIQEAHPVSL 528


>gi|163745024|ref|ZP_02152384.1| D-3-phosphoglycerate dehydrogenase [Oceanibulbus indolifex HEL-45]
 gi|161381842|gb|EDQ06251.1| D-3-phosphoglycerate dehydrogenase [Oceanibulbus indolifex HEL-45]
          Length = 531

 Score =  113 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ I  D +IG  M+   N D+ GI+  +G  +GE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGITIDAEIGEHMLYTTNEDVPGIIGTLGQTMGENGVNIANFTLGRNT 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  +V+ KL      R +K  +F+V
Sbjct: 492 AKGEAIALLYVDDQVPEAVIGKLRDTGMFRQIKPLQFDV 530


>gi|296284464|ref|ZP_06862462.1| D-3-phosphoglycerate dehydrogenase [Citromicrobium bathyomarinum
           JL354]
          Length = 528

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 51/97 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I  I  + ++   MI +VN D  G +  +G++LG  GINI  F+LGR Q
Sbjct: 432 LFGREAPRLVEIFGIGIEAELDGHMIYVVNDDAPGFIGRIGSLLGNRGINIGTFNLGRKQ 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  + ++++ +      +R V    F
Sbjct: 492 AGGEAVLLLSLDQPVDDALIAEAEALEGVRTVTALSF 528


>gi|254436982|ref|ZP_05050476.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 307]
 gi|198252428|gb|EDY76742.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 307]
          Length = 531

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  MI   N D+ GI+  +G  +G++ +NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMIYTTNEDVPGIIGTLGQTMGKHNVNIANFTLGRSA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  + L++L        VK   F+V
Sbjct: 492 ANGEAIALLYVDEVVPAATLKELEATGMFTQVKPLTFDV 530


>gi|126733884|ref|ZP_01749631.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS2]
 gi|126716750|gb|EBA13614.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS2]
          Length = 530

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 58/99 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D  G++  +G  LG   +NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGEHMVYTTNEDRPGVIGTLGTTLGANNVNIANFTLGRSE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  I    +E L      + VK   FNV
Sbjct: 492 AKGEAIALLYVDEPIPAQAIEALETTGLFQQVKPLTFNV 530


>gi|62290557|ref|YP_222350.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 1 str.
           9-941]
 gi|82700473|ref|YP_415047.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis biovar
           Abortus 2308]
 gi|189024778|ref|YP_001935546.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus S19]
 gi|254689854|ref|ZP_05153108.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|254694347|ref|ZP_05156175.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698003|ref|ZP_05159831.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730889|ref|ZP_05189467.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|256258108|ref|ZP_05463644.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|260547197|ref|ZP_05822935.1| SerA family protein [Brucella abortus NCTC 8038]
 gi|260755386|ref|ZP_05867734.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260758607|ref|ZP_05870955.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260762439|ref|ZP_05874776.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884402|ref|ZP_05896016.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|261214655|ref|ZP_05928936.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297248957|ref|ZP_06932665.1| phosphoglycerate dehydrogenase [Brucella abortus bv. 5 str. B3196]
 gi|62196689|gb|AAX74989.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 1
           str. 9-941]
 gi|82616574|emb|CAJ11653.1| ATP/GTP-binding site motif A (P-loop):Amino acid-binding
           ACT:D-isomer specific 2-hydroxyacid dehydrogenase,
           catalytic domain: [Brucella melitensis biovar Abortus
           2308]
 gi|189020350|gb|ACD73072.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus S19]
 gi|260095562|gb|EEW79440.1| SerA family protein [Brucella abortus NCTC 8038]
 gi|260668925|gb|EEX55865.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260672865|gb|EEX59686.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675494|gb|EEX62315.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260873930|gb|EEX80999.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|260916262|gb|EEX83123.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297174090|gb|EFH33447.1| phosphoglycerate dehydrogenase [Brucella abortus bv. 5 str. B3196]
          Length = 533

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 60/98 (61%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G  M+ + N D+ G++  +G I G++ +NIA+F LGR   
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGPHMLYVTNKDVPGMIGLLGTICGKHDVNIANFALGRDHP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D  I  + L++L     IR     EFNV
Sbjct: 493 GGDAIAMLYVDEQIPQAALDELMAQEAIRVATPLEFNV 530


>gi|39937368|ref|NP_949644.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           CGA009]
 gi|192293149|ref|YP_001993754.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           TIE-1]
 gi|39651226|emb|CAE29749.1| putative phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           CGA009]
 gi|192286898|gb|ACF03279.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           TIE-1]
          Length = 529

 Score =  113 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 36/97 (37%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G  MI + N D  G +    ++LG+  +NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGSSMIYVTNEDKPGFIGKFASLLGDAKVNIATFNLGRHT 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + IDG     VLEK+     ++ VK   F
Sbjct: 493 EGGDAIALVTIDGPAPTEVLEKVQALPQVKQVKALTF 529


>gi|319781038|ref|YP_004140514.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166926|gb|ADV10464.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 533

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 66/99 (66%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G+ M+   NAD  GI+  +G + GE G+NIA+F LGR++ 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGQHMLYTTNADAPGIIGLLGTVCGENGVNIANFQLGRNRP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
              AI+ L +D     +VLEK+  + +I   K+ +F+V+
Sbjct: 493 GGDAIALLYLDAPFPEAVLEKVKAHKSIDSAKRLQFDVN 531


>gi|61612115|gb|AAX47292.1| 3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri]
          Length = 533

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 66/99 (66%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G+ M+   NAD  GI+  +G + GE G+NIA+F LGR++ 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGQHMLYTTNADAPGIIGLLGTVCGENGVNIANFQLGRNRP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
              AI+ L +D     +VLEK+  + +I   K+ +F+V+
Sbjct: 493 GGDAIALLYLDAPFPEAVLEKVKAHKSIDSAKRLQFDVN 531


>gi|239827548|ref|YP_002950172.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. WCH70]
 gi|239807841|gb|ACS24906.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. WCH70]
          Length = 525

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 47/89 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +       D      ++ I + D  G++  VGN+LGE+ +NIA   +GR Q+   AI 
Sbjct: 435 RIVHFDGFTIDFAPDGHLLYIQHQDRPGMIGKVGNVLGEHQVNIATMQVGREQAGGKAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  I +++L+KL+    I  VK+ E
Sbjct: 495 MLSLDKPIDDALLQKLAEIEDIETVKRLE 523


>gi|288556042|ref|YP_003427977.1| D-3-phosphoglycerate dehydrogenase [Bacillus pseudofirmus OF4]
 gi|288547202|gb|ADC51085.1| D-3-phosphoglycerate dehydrogenase [Bacillus pseudofirmus OF4]
          Length = 540

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 43/90 (47%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
            R + I   N D      ++ I + D  G++  +G +L E+ +NIA   +GR Q    AI
Sbjct: 450 ARIVSINGFNVDFVPQGHLLYIQHNDKPGVIGRIGQLLAEHDVNIATMQVGRKQEGGEAI 509

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             + +D ++   VL+ +     I+F  + E
Sbjct: 510 MMITVDKTVEEDVLKAVRKIEDIQFADKIE 539


>gi|285808609|gb|ADC36128.1| putative D-3-phosphoglycerate dehydrogenase [uncultured bacterium
           253]
          Length = 533

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 4/101 (3%)

Query: 1   VFSDGKP----RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHL 56
           +F  G+     R  +I   + +      M+ + N D+ G++  VG ILGE+ +NI+ FHL
Sbjct: 432 IFGFGEQAREGRITEIDGFHIEAIPRGHMLVMRNRDVPGVIGRVGTILGEHDVNISRFHL 491

Query: 57  GRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           GR +    A++ + +D ++    L  L     I  V++ E 
Sbjct: 492 GRRERGGEAMAVIEVDSTVAPKALAALRSQEEILLVREIEL 532


>gi|91978368|ref|YP_571027.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
 gi|91684824|gb|ABE41126.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
          Length = 529

 Score =  113 bits (284), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+  +NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKVNIATFNLGRHS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG +   V+ ++     ++  K   F
Sbjct: 493 QGGDAIALVEVDGPVPAEVIAQVQALPPVKQAKALVF 529


>gi|138895825|ref|YP_001126278.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermodenitrificans
           NG80-2]
 gi|134267338|gb|ABO67533.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermodenitrificans
           NG80-2]
          Length = 465

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 46/89 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +    +  D      ++ I + D  G++  VGNILG + +NIA   +GR ++   A+ 
Sbjct: 376 RIVHFDGVAIDFAPEGHLLYIQHQDRPGMIGKVGNILGAHDVNIATMQVGRQEAGGKAMM 435

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D  + ++VL+ L+    I  VK+ E
Sbjct: 436 ILSLDKPVDDAVLKTLAQIDDIETVKRLE 464


>gi|126724751|ref|ZP_01740594.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705915|gb|EBA05005.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
          Length = 530

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +G  +G  G+NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDVPGIIGTLGQTMGGNGVNIANFTLGRSE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D +I   +L +L      + V    F+V
Sbjct: 492 VGGEAIALLYVDSAIPAPILAELKTTGMFQSVNPLRFDV 530


>gi|115526154|ref|YP_783065.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
 gi|115520101|gb|ABJ08085.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
          Length = 530

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG PR + I+ I  D + G+ MI + N D  G +    ++LG+  INIA F+LGR  
Sbjct: 434 VFADGHPRLVDIKGIRVDAEFGKSMIYVTNEDKPGFIGKFASLLGDAKINIATFNLGRHS 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   +L K+     ++  K   F
Sbjct: 494 QGGDAIALVEVDGAVPTELLAKVQSLPQVKQAKALVF 530


>gi|322368216|ref|ZP_08042785.1| D-3-phosphoglycerate dehydrogenase [Haladaptatus paucihalophilus
           DX253]
 gi|320552232|gb|EFW93877.1| D-3-phosphoglycerate dehydrogenase [Haladaptatus paucihalophilus
           DX253]
          Length = 527

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 43/98 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+D  PR ++I     D      M+   N D  G++ F+G +LGE+  NIA     R  
Sbjct: 428 LFADDDPRIVRIDGYRVDAIPHGHMLVARNQDKPGVIGFIGTVLGEHDTNIAGMFNARET 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A+S   +D  +  +  E L  +  I  V+    N
Sbjct: 488 DGGEALSVYNLDSEVSTAAKEALEADERIIEVRNIALN 525


>gi|31790358|gb|AAP58615.1| putative D-3-phosphoglycerate dehydrogenase [uncultured
           Acidobacteria bacterium]
          Length = 561

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 49/101 (48%), Gaps = 4/101 (3%)

Query: 1   VFSDGKP----RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHL 56
           +F  G+     R  +I   + +      M+ + N D+ G++  VG ILGE G+NI+HFHL
Sbjct: 460 IFGFGEQAREGRITEIDGFHIEALPHGHMLVMRNRDVPGVIGRVGTILGERGVNISHFHL 519

Query: 57  GRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           GR +    A++ + +D +     L+ L     I  V   E 
Sbjct: 520 GRRERGGEAMAVIEVDAAADAETLDALRSLQDILSVCVIEL 560


>gi|85707813|ref|ZP_01038879.1| phosphoglycerate dehydrogenase [Erythrobacter sp. NAP1]
 gi|85689347|gb|EAQ29350.1| phosphoglycerate dehydrogenase [Erythrobacter sp. NAP1]
          Length = 534

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I  I  + D+   M+ +VN D  G +  +G +LG  GINI  F+LGR  
Sbjct: 438 LFGKDAPRLVEIFGIGIEADLDGNMLYVVNDDKPGFIGRIGTLLGSQGINIGTFNLGRRD 497

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D      V+ +      ++ VK   F
Sbjct: 498 AGGEAVLLLSLDDEPSADVMAEAEKVEGVKMVKALSF 534


>gi|83855133|ref|ZP_00948663.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. NAS-14.1]
 gi|83842976|gb|EAP82143.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. NAS-14.1]
          Length = 531

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN + ++G  M+   N D+ GI+  +G  LG   +NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIEAEVGAHMLYTTNNDVPGIIGTLGQTLGANDVNIANFTLGRST 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L IDG +    L+ L      + VK+ EF V
Sbjct: 492 AKGEAIALLYIDGPLPEKALKDLRDTGLFKQVKELEFEV 530


>gi|83941656|ref|ZP_00954118.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. EE-36]
 gi|83847476|gb|EAP85351.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. EE-36]
          Length = 531

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN + ++G  M+   N D+ GI+  +G  LG   +NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIEAEVGAHMLYTTNNDVPGIIGTLGQTLGANDVNIANFTLGRST 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L IDG +    L+ L      + VK+ EF V
Sbjct: 492 AKGEAIALLYIDGPLPEKALKDLRDTGLFKQVKELEFEV 530


>gi|86748440|ref|YP_484936.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
 gi|86571468|gb|ABD06025.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
          Length = 529

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V++DGKPR + I+ I  D + G+ MI + N D  G +    ++LG+  +NIA F+LGR  
Sbjct: 433 VYADGKPRLVDIKGIRVDAEFGQSMIYVTNEDKPGFIGKFASLLGDAKVNIATFNLGRHS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + IDG     V+ K+     ++  K   F
Sbjct: 493 QGGDAIALVEIDGPAPADVIAKVQALPQVKQAKALAF 529


>gi|254509701|ref|ZP_05121768.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium KLH11]
 gi|221533412|gb|EEE36400.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium KLH11]
          Length = 531

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +G  +GE+ +NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDVPGIIGVLGQTMGEHNVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +       L+       +K  EF+V
Sbjct: 492 AGGEAIALLYVDAPVPAEARAVLAETGLFTQIKPLEFDV 530


>gi|254477808|ref|ZP_05091194.1| phosphoglycerate dehydrogenase [Ruegeria sp. R11]
 gi|214032051|gb|EEB72886.1| phosphoglycerate dehydrogenase [Ruegeria sp. R11]
          Length = 531

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 58/99 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +G+  +NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGALGKTMGDNDVNIANFTLGRSD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+       +K   F+V
Sbjct: 492 AGGEAIALLYVDEPVPAEARAKLAETGLFTQIKPLAFDV 530


>gi|188579907|ref|YP_001923352.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium populi BJ001]
 gi|179343405|gb|ACB78817.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium populi BJ001]
          Length = 535

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPR I+I+ I  D     LM+ + N D  G V   G++LG+ G+N+A F LGR  
Sbjct: 439 VFNDGKPRVIEIRGIGIDAPFAPLMLYVRNHDKPGFVGSFGSVLGDAGVNLATFALGREA 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +AI+F+ +D  +   VL+ +     ++ V+   F
Sbjct: 499 EGGNAIAFVAVDAEVSPEVLKAIETIPQVKRVRLVRF 535


>gi|148557578|ref|YP_001265160.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas wittichii RW1]
 gi|148502768|gb|ABQ71022.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas wittichii RW1]
          Length = 525

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 54/97 (55%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F++ +PR ++I  +  + D+G  M+ IVN D  G +  +G+ LGE  +NI  FHLGR  
Sbjct: 429 LFANAEPRLVEIYGVKVEADLGGTMLYIVNVDAPGFIGRLGSTLGEANVNIGTFHLGRRS 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  + +++  K++    ++  K   F
Sbjct: 489 AGGEAVLLLSVDTPVDDALKAKIAQLPGVKTAKALSF 525


>gi|259417745|ref|ZP_05741664.1| phosphoglycerate dehydrogenase [Silicibacter sp. TrichCH4B]
 gi|259346651|gb|EEW58465.1| phosphoglycerate dehydrogenase [Silicibacter sp. TrichCH4B]
          Length = 531

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 58/99 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  LG+  +NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNKDVPGIIGTLGQTLGDMDVNIANFTLGRNE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  +      KL+       +K   F+V
Sbjct: 492 VGGEAIALLYVDAEVPADARAKLAETGYFTQIKPLAFDV 530


>gi|99082861|ref|YP_615015.1| D-3-phosphoglycerate dehydrogenase [Ruegeria sp. TM1040]
 gi|99039141|gb|ABF65753.1| D-3-phosphoglycerate dehydrogenase [Ruegeria sp. TM1040]
          Length = 531

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 58/99 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  LG+  +NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNQDVPGIIGTLGQTLGDMDVNIANFTLGRNE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  +      KL+       +K   F+V
Sbjct: 492 VGGEAIALLYVDAEVPADARAKLAETGYFTQIKPLAFDV 530


>gi|116073644|ref|ZP_01470906.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9916]
 gi|116068949|gb|EAU74701.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9916]
          Length = 528

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTTIDEFPVNVPPSRHMLFTRHRDMPGIIGQLGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++L  ++    I+       
Sbjct: 492 VRGDAVMVLSIDDPIPPTLLANINAIDGIQEAHPVTL 528


>gi|78213665|ref|YP_382444.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9605]
 gi|78198124|gb|ABB35889.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9605]
          Length = 528

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I     +V     M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRITSIDAFPVNVTPSSHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I   +L+ ++    I+       
Sbjct: 492 VRGDAVMVLSIDDPIPADLLQTITAIDGIQEAHPVTL 528


>gi|206890990|ref|YP_002248773.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742928|gb|ACI21985.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 529

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 53/99 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S   PR ++I +I+ ++     MI + N D  G++  +G +LG+  INI H H GR +
Sbjct: 430 LLSRKDPRIVQINDISMEIIPEGNMIFLRNHDRPGVIGNIGTLLGQNNINIGHMHFGRKE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   A S + +D ++ + ++EK+     +  V+    +V
Sbjct: 490 AGGIAFSVISVDATLTDDIIEKIKQLPNVLEVRPVYISV 528


>gi|260434318|ref|ZP_05788288.1| phosphoglycerate dehydrogenase [Synechococcus sp. WH 8109]
 gi|260412192|gb|EEX05488.1| phosphoglycerate dehydrogenase [Synechococcus sp. WH 8109]
          Length = 528

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I     +V     M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRITSIDAFPVNVTPSSHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I   +L+ ++    I+       
Sbjct: 492 VRGDAVMVLSIDDPIPADLLQTITAIDGIQEAHPVTL 528


>gi|110677605|ref|YP_680612.1| D-3-phosphoglycerate dehydrogenase [Roseobacter denitrificans OCh
           114]
 gi|109453721|gb|ABG29926.1| D-3-phosphoglycerate dehydrogenase [Roseobacter denitrificans OCh
           114]
          Length = 531

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ I  D ++G  M+   N D+ GI+  +G  +GE G+NIA+F LGR++
Sbjct: 432 VFSDGKPRFIQIKGIQIDAEVGAHMLYTTNEDVPGIIGTLGQTMGENGVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   V++KL        VK   F+V
Sbjct: 492 AKGEAIALLYVDDQVPAPVIKKLEKTGMFTQVKPLIFDV 530


>gi|148265877|ref|YP_001232583.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
 gi|146399377|gb|ABQ28010.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
          Length = 539

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 46/94 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++   D      M+ +   D  G++  +G ILG   INIA  +LGR +   
Sbjct: 435 EGAPRIVRLRDYAMDFSPEGHMLLLNYIDRPGMIGRIGTILGTRDINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++   V+E+L       F++    
Sbjct: 495 EAMVILSLDSAVPPDVVEELRNATNATFIRPLNM 528


>gi|225174433|ref|ZP_03728432.1| D-3-phosphoglycerate dehydrogenase [Dethiobacter alkaliphilus AHT
           1]
 gi|225170218|gb|EEG79013.1| D-3-phosphoglycerate dehydrogenase [Dethiobacter alkaliphilus AHT
           1]
          Length = 525

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 46/98 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+    R +KI + N +V   R M+     D+ G++   G  LGE  INIA   +GR  
Sbjct: 428 LFNKDDIRIVKIDKYNIEVVPSRYMLVTKYMDMPGVIGRFGITLGESNINIAGMQVGRQS 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A+  L +D  +   V++KL     I  ++  + +
Sbjct: 488 IGGEAVMALQVDCPVPEDVIKKLEKLDAIVSIRFVKLD 525


>gi|332188569|ref|ZP_08390288.1| phosphoglycerate dehydrogenase [Sphingomonas sp. S17]
 gi|332011413|gb|EGI53499.1| phosphoglycerate dehydrogenase [Sphingomonas sp. S17]
          Length = 516

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F D  PR +++  I  + D+   M+ +VN D  G +  +G  LGE G+NI  FHLGR  
Sbjct: 420 LFGDQAPRLVELFGIKVEADLAGPMLYVVNEDAPGFIGRLGTTLGEAGVNIGTFHLGRRS 479

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D ++   +L K+     ++      F
Sbjct: 480 AGGEAVLLLSVDEAVDAELLAKVKSLPGVKTAMGLVF 516


>gi|254462167|ref|ZP_05075583.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium HTCC2083]
 gi|206678756|gb|EDZ43243.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 531

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/99 (45%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +GN +G+ G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDVPGIIGLLGNTMGKSGVNIANFTLGRAD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  I   VL+ L        VK  EF+V
Sbjct: 492 VGGEAIALLYVDNPIPADVLKTLDGTGMFSQVKPLEFDV 530


>gi|260467077|ref|ZP_05813257.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium opportunistum
           WSM2075]
 gi|259029186|gb|EEW30482.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium opportunistum
           WSM2075]
          Length = 533

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/98 (42%), Positives = 64/98 (65%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G+ M+   NAD  GI+  +G + GE G+NIA+F LGR++ 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGQHMLYTTNADAPGIIGLLGTVCGENGVNIANFQLGRNRP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D      VLE++  + +I   K+ +F+V
Sbjct: 493 GGDAIALLYLDAPFPEKVLEQVRAHKSIDSAKRLQFDV 530


>gi|15791207|ref|NP_281031.1| D-3-phosphoglycerate dehydrogenase [Halobacterium sp. NRC-1]
 gi|169236963|ref|YP_001690163.1| D-3-phosphoglycerate dehydrogenase [Halobacterium salinarum R1]
 gi|10581831|gb|AAG20511.1| phosphoglycerate dehydrogenase [Halobacterium sp. NRC-1]
 gi|167728029|emb|CAP14817.1| phosphoglycerate dehydrogenase [Halobacterium salinarum R1]
          Length = 527

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 43/98 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR ++I     +      M+   N D  G++ F+G +LG   +NIA     R  
Sbjct: 428 LFAGDDPRLVEIDGFRVEAAPNGHMLVARNHDTPGVIGFIGGVLGTAEVNIAGMFNAREA 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D  +    L++L+ +  I  V   E N
Sbjct: 488 RGGEALTVYNLDADVPARALDELAGDDRIVDVTSIELN 525


>gi|222481126|ref|YP_002567363.1| D-3-phosphoglycerate dehydrogenase [Halorubrum lacusprofundi ATCC
           49239]
 gi|222454028|gb|ACM58293.1| D-3-phosphoglycerate dehydrogenase [Halorubrum lacusprofundi ATCC
           49239]
          Length = 534

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 43/98 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+    R ++I     D      M+   N D  G++  +G +LG+Y +NIA  +  R  
Sbjct: 429 LFAGEDARIVRIDGFRVDAVPYGHMLVARNTDEPGVIGLIGTVLGDYDVNIAGMYNARET 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D  + +  +E L  +  I  V +   +
Sbjct: 489 QGGEALTVYNLDQDVPDEAIEALLADDRIVEVTEITLD 526


>gi|103486109|ref|YP_615670.1| D-3-phosphoglycerate dehydrogenase [Sphingopyxis alaskensis RB2256]
 gi|98976186|gb|ABF52337.1| D-3-phosphoglycerate dehydrogenase [Sphingopyxis alaskensis RB2256]
          Length = 528

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + +PR +++  I  + D+   M+ IVN D  G +  +G+ LG+ G+NI  FHLGR  
Sbjct: 432 LFGNNEPRLVEMFGIKVEADLDGDMLYIVNEDAPGFIGRIGSTLGDAGLNIGTFHLGRRA 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +   +L ++     ++ VK  +F
Sbjct: 492 AGGEAVLLLSLDSPMPEPLLWQVCQLPGVKMVKGLKF 528


>gi|212638896|ref|YP_002315416.1| D-3-phosphoglycerate dehydrogenase [Anoxybacillus flavithermus WK1]
 gi|212560376|gb|ACJ33431.1| Phosphoglycerate dehydrogenase [Anoxybacillus flavithermus WK1]
          Length = 549

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 46/90 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +       D      ++ I + D  G++  VGNILG++ +NIA   +GR ++   AI 
Sbjct: 435 RIVHFNGFAIDFAPEGHLLYIQHHDKPGMIGKVGNILGDHQVNIATMQVGRQEAGGKAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  + ++++E L     I  VK+ E+
Sbjct: 495 MLSLDKPLDDALVETLEQISDIDVVKRLEY 524


>gi|302038732|ref|YP_003799054.1| d-3-phosphoglycerate dehydrogenase [Candidatus Nitrospira defluvii]
 gi|300606796|emb|CBK43129.1| D-3-phosphoglycerate dehydrogenase [Candidatus Nitrospira defluvii]
          Length = 530

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 48/94 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           ++    PR I+I +   +V     ++ I N D  G++  VG+ILG++ INIA     R +
Sbjct: 430 LYHRKDPRIIEIDQFKVEVVPDNHLLLIQNEDRPGVIGTVGHILGDHNINIARMQCSREE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
               A+    +D  +  SVL++++ +  I  VK 
Sbjct: 490 RGGKALQIFGLDAPLPKSVLDQITNSKHILSVKV 523


>gi|258517404|ref|YP_003193626.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257781109|gb|ACV65003.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 526

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 40/97 (41%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +        + I     DV     M+ + + D   I+  VG ++GE+ INIA   +GR +
Sbjct: 430 LLQGNVAHLVNIDGYRVDVVPSGHMLVVPHYDRPKIIGKVGTLIGEHDINIAAMQVGRKE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  + +  L  ++    I  VK    
Sbjct: 490 IGGKAVMVLTIDDVVPDDTLRAIAQVDGILDVKFVSL 526


>gi|126732689|ref|ZP_01748485.1| D-3-phosphoglycerate dehydrogenase [Sagittula stellata E-37]
 gi|126706819|gb|EBA05889.1| D-3-phosphoglycerate dehydrogenase [Sagittula stellata E-37]
          Length = 532

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 59/99 (59%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  LG  G+NIA+F LGRS 
Sbjct: 433 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGMTLGGMGVNIANFTLGRSA 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +      KL+     R +K   F+V
Sbjct: 493 AKGEAIALLYVDEPVPAEARAKLAETGMFRQIKPLSFDV 531


>gi|78044181|ref|YP_361480.1| D-3-phosphoglycerate dehydrogenase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996296|gb|ABB15195.1| D-3-phosphoglycerate dehydrogenase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 525

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + +PR ++I +   DV      + + + D   ++  VG ILGE GINIA   LGR  
Sbjct: 429 LFRNNEPRIVQIDQYRVDVVPEGYKLFVPHKDQPLMIGKVGIILGEKGINIAGMQLGRIT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D       ++ ++    I  VK    
Sbjct: 489 PGGDAVMVLSLDHPADGDSIKAIAAIPGIYEVKAVSL 525


>gi|313125075|ref|YP_004035339.1| d-3-phosphoglycerate dehydrogenase [Halogeometricum borinquense DSM
           11551]
 gi|312291440|gb|ADQ65900.1| D-3-phosphoglycerate dehydrogenase [Halogeometricum borinquense DSM
           11551]
          Length = 534

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 1/99 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR ++I     D      M+   N D  G++ F+G +LGE  +NIA     R  
Sbjct: 432 LFAGEDPRIVRIDGYRVDAIPHGQMLVARNYDKPGVIGFIGTVLGENDVNIAGMFNARRS 491

Query: 61  -STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
                A++   +D  I   V EKL  +  I  VK    N
Sbjct: 492 ADGGEALTVYNLDDPIPEEVSEKLLADERITDVKYLTLN 530


>gi|13473319|ref|NP_104886.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium loti MAFF303099]
 gi|14024068|dbj|BAB50672.1| phosphoglycerate dehydrogenase [Mesorhizobium loti MAFF303099]
          Length = 533

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 42/98 (42%), Positives = 64/98 (65%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++G+ M+   NAD  GI+  +G + GE G+NIA+F LGR++ 
Sbjct: 433 FSDGKPRFIQIKGINLDAEVGQHMLYTTNADAPGIIGLLGTVCGENGVNIANFQLGRNRP 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+ L +D      VLE++  + +I   K+ +F+V
Sbjct: 493 GGDAIALLYLDAPFPEKVLEQVRAHKSIDSAKRLQFDV 530


>gi|121535994|ref|ZP_01667786.1| D-3-phosphoglycerate dehydrogenase [Thermosinus carboxydivorans
           Nor1]
 gi|121305430|gb|EAX46380.1| D-3-phosphoglycerate dehydrogenase [Thermosinus carboxydivorans
           Nor1]
          Length = 528

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 45/98 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   + R + I     DVD    ++   + D  G+V  VG ILGE+ INIA   +GR++
Sbjct: 429 LFGKTEGRIVMIDGYRVDVDPQGWLLIGPHIDKPGMVGKVGTILGEHNINIAGMQVGRTE 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
                I  + ++  I   V+ K+     I   K   FN
Sbjct: 489 QAGTNIMVMAVESDIPTPVMLKIKAVDGILGAKLVNFN 526


>gi|317969029|ref|ZP_07970419.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CB0205]
          Length = 528

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E    V   + M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTTIDEFPVSVTPSKHMLFTRHRDMPGIIGHIGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  +   +L  +     I+       
Sbjct: 492 VRGDAVMVLSLDDPLPADLLAGIHAIEGIQQAHPVTL 528


>gi|297566778|ref|YP_003685750.1| D-3-phosphoglycerate dehydrogenase [Meiothermus silvanus DSM 9946]
 gi|296851227|gb|ADH64242.1| D-3-phosphoglycerate dehydrogenase [Meiothermus silvanus DSM 9946]
          Length = 521

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 40/89 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
            GKPR + + +   +V     M+   N D  G+V  VG +LG  G+NIA   LGR     
Sbjct: 428 GGKPRLVGVDDYRLEVVPEGFMLICTNRDQPGVVGKVGTLLGGSGVNIAGMQLGRDAPGG 487

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+  L ID      VL+ L     +  V
Sbjct: 488 KALFVLAIDERPSEEVLDALRGLDVLERV 516


>gi|163733251|ref|ZP_02140695.1| D-3-phosphoglycerate dehydrogenase [Roseobacter litoralis Och 149]
 gi|161393786|gb|EDQ18111.1| D-3-phosphoglycerate dehydrogenase [Roseobacter litoralis Och 149]
          Length = 531

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ I  D ++G  M+   N D+ GI+  +G  +GE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGIQIDAEVGAHMLYTTNEDVPGIIGALGQTMGENGVNIANFTLGRAV 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +   V++KL        VK   F+V
Sbjct: 492 AQGEAIALLYVDDQVPAPVIKKLEATGMFTQVKPLMFDV 530


>gi|110667020|ref|YP_656831.1| D-3-phosphoglycerate dehydrogenase [Haloquadratum walsbyi DSM
           16790]
 gi|109624767|emb|CAJ51173.1| phosphoglycerate dehydrogenase [Haloquadratum walsbyi DSM 16790]
          Length = 534

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 1/98 (1%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ- 60
           F+ G+PR +KI     D      M+   NAD  G++ F+G++LGE+ INIA     R   
Sbjct: 431 FTGGEPRIVKIDGYRVDAVPHGKMLVARNADKPGVIGFIGSVLGEHNINIAGMFNARRDI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D S+   V+E+L  +  +  V+    N
Sbjct: 491 EGGEALTIYNLDDSVPTDVVERLLADERMIDVRYLTLN 528


>gi|89052752|ref|YP_508203.1| D-3-phosphoglycerate dehydrogenase [Jannaschia sp. CCS1]
 gi|88862301|gb|ABD53178.1| D-3-phosphoglycerate dehydrogenase [Jannaschia sp. CCS1]
          Length = 531

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 57/97 (58%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N DI GI+  +G  +GE G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGEHMLYTTNHDIPGIIGTLGQTMGENGVNIANFTLGRSG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ L +D      VL KL        VK  +F
Sbjct: 492 RDGEAIALLYLDEQPPADVLGKLMETGLFESVKPLQF 528


>gi|312115664|ref|YP_004013260.1| D-3-phosphoglycerate dehydrogenase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220793|gb|ADP72161.1| D-3-phosphoglycerate dehydrogenase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 526

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPR I+I  +  D +    M+  VNAD  G +  +G +LG+ G+NIA F+LGR  
Sbjct: 430 VFSDGKPRVIQINHVPMDAEFAPNMLFTVNADKPGHIGALGTLLGDEGVNIATFNLGREA 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++ + +D  + ++ ++K      +    +  F
Sbjct: 490 QGGKAMALVTVDEPVSDATIQKALALPHVVRAARLSF 526


>gi|154245150|ref|YP_001416108.1| D-3-phosphoglycerate dehydrogenase [Xanthobacter autotrophicus Py2]
 gi|154159235|gb|ABS66451.1| D-3-phosphoglycerate dehydrogenase [Xanthobacter autotrophicus Py2]
          Length = 528

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+PR + I+ IN D +    MI + N D  G +     +LG+ G+NIA F LGR  
Sbjct: 432 VFADGRPRIVNIKGINVDAEFAPSMIYVTNEDKPGFIGRFAGLLGDAGLNIATFALGRDH 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   VL K+     ++  K   F
Sbjct: 492 LGGDAIALVAVDGTVPADVLGKVQALPQVKAAKALAF 528


>gi|257052425|ref|YP_003130258.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
 gi|256691188|gb|ACV11525.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
          Length = 520

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 45/98 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F D +PR ++I     D      M+   N D  G++  +G++ GEY +NIA     R  
Sbjct: 423 LFGDNEPRLVEIDGFRVDATPYGHMLISRNRDEPGVIGALGSVFGEYDVNIAGMANARES 482

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A+S   +D  +   +LE+L  +  +  V   + +
Sbjct: 483 IDGEAMSVYNLDDPVTPELLEELESDTRVTGVTAIDLD 520


>gi|262276980|ref|ZP_06054773.1| phosphoglycerate dehydrogenase [alpha proteobacterium HIMB114]
 gi|262224083|gb|EEY74542.1| phosphoglycerate dehydrogenase [alpha proteobacterium HIMB114]
          Length = 526

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 46/95 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
            GKPR + ++ I  + ++ +  + I N D  G +  +  IL +  INIA F+LGR  S  
Sbjct: 431 GGKPRIVNVKGIKIEAELAKHNLYISNEDKPGFISNLSKILSDNNINIATFNLGRKDSGG 490

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            AI+ +  D  I   VL+ +     +   K   FN
Sbjct: 491 EAIALISTDNPIEEKVLDGIKKLPLVIQAKTLTFN 525


>gi|268324733|emb|CBH38321.1| D-3-phosphoglycerate dehydrogenase [uncultured archaeon]
          Length = 542

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 40/97 (41%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR +KI     D      M+     D   ++  V  ILG++ INI    +GR +
Sbjct: 446 LFGKDDPRIVKIDGFWMDASPSGHMLICSFIDKPRVIGPVCTILGDHSINITGMRVGREK 505

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  +   ++E +     +  +K  + 
Sbjct: 506 KEGEAVMVLNVDNPVAGDIIEDIMKVENLIDIKLVKL 542


>gi|254430175|ref|ZP_05043878.1| phosphoglycerate dehydrogenase [Cyanobium sp. PCC 7001]
 gi|197624628|gb|EDY37187.1| phosphoglycerate dehydrogenase [Cyanobium sp. PCC 7001]
          Length = 528

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTSIDEFPVNVTPSRHMLFTRHRDMPGIIGQIGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  I  S+L  ++    I+       
Sbjct: 492 VRGDAVMVLSLDDPIPTSLLACVNDIDGIQEAHPVTL 528


>gi|85680324|gb|ABC72353.1| phosphoglycerate dehydrogenase [Haloquadratum walsbyi]
          Length = 536

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 1/98 (1%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ- 60
           F+ G+PR +KI     D      M+   NAD  G++ F+G++LGE+ INIA     R   
Sbjct: 433 FTGGEPRIVKIDGYRVDAVPHGKMLVARNADKPGVIGFIGSVLGEHNINIAGMFNARRDI 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D S+   V+E+L  +  +  V+    N
Sbjct: 493 EGGEALTIYNLDDSVPTDVVERLLADERMIDVRYLTLN 530


>gi|88807419|ref|ZP_01122931.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7805]
 gi|88788633|gb|EAR19788.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7805]
          Length = 528

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTNIDEFPVNVPPSRHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++L  +     I+       
Sbjct: 492 VRGDAVMVLSIDDPIPPALLATIHGINGIQEAHPVTL 528


>gi|15606928|ref|NP_214309.1| D-3-phosphoglycerate dehydrogenase [Aquifex aeolicus VF5]
 gi|2984165|gb|AAC07698.1| D-3-phosphoglycerate dehydrogenase [Aquifex aeolicus VF5]
          Length = 533

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 46/95 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V     PR  +I     D++   +++   N D+ G++  +G+ILGE  INIA F LGR +
Sbjct: 437 VLEGQIPRITEIDRYKVDIEPEGILLVFENKDVPGVIGKIGSILGEANINIAGFRLGREK 496

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
               AI  L +D      VL ++     I FVK  
Sbjct: 497 KGGIAIGILNLDEPASEEVLSRIKEIPEILFVKHI 531


>gi|77464929|ref|YP_354433.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides 2.4.1]
 gi|221640849|ref|YP_002527111.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides KD131]
 gi|77389347|gb|ABA80532.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides 2.4.1]
 gi|221161630|gb|ACM02610.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides KD131]
          Length = 534

 Score =  110 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 63/98 (64%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++GR M+   N D+ GI+  +G  +G+ G+NIA+F LGR+  
Sbjct: 436 FSDGKPRFIQIKGINIDAEVGRHMLYTTNEDVPGIIGLLGMTMGKNGVNIANFTLGRTSV 495

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            + AI+ L +D +I   V+E L      + VK  EF+V
Sbjct: 496 GQEAIAILYLDQAIDPKVVETLESTGLFQQVKPLEFDV 533


>gi|126460798|ref|YP_001041912.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102462|gb|ABN75140.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 531

 Score =  110 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 63/98 (64%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++GR M+   N D+ GI+  +G  +G+ G+NIA+F LGR+  
Sbjct: 433 FSDGKPRFIQIKGINIDAEVGRHMLYTTNEDVPGIIGLLGMTMGKNGVNIANFTLGRTSV 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            + AI+ L +D +I   V+E L      + VK  EF+V
Sbjct: 493 GQEAIAILYLDQAIDPKVVETLESTGLFQQVKPLEFDV 530


>gi|148240317|ref|YP_001225704.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7803]
 gi|147848856|emb|CAK24407.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7803]
          Length = 528

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRVTNIDEFPVNVPPSRHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++L  +     I+       
Sbjct: 492 VRGDAVMVLSIDDPIPPALLATIHGINGIQEAHPVTL 528


>gi|307294836|ref|ZP_07574678.1| D-3-phosphoglycerate dehydrogenase [Sphingobium chlorophenolicum
           L-1]
 gi|306879310|gb|EFN10528.1| D-3-phosphoglycerate dehydrogenase [Sphingobium chlorophenolicum
           L-1]
          Length = 526

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + +PR +++  I  + D+   M+ IVN D  G +  +G+ LGE  +NI  FHLGR  
Sbjct: 429 LFGNAQPRLVELFGIKVEADLAGDMLYIVNQDAPGFIGRLGSTLGEANVNIGTFHLGRRN 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +DG++  +VL  +     ++ VK   F
Sbjct: 489 QGGEAVLLLSLDGAVSEAVLSDICKLAGVKTVKLLRF 525


>gi|288819163|ref|YP_003433511.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
 gi|288788563|dbj|BAI70310.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
 gi|308752746|gb|ADO46229.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
          Length = 530

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/95 (34%), Positives = 50/95 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V     PR  +I     DV+   +M+   N D+ G++  VG+ILG+ G+NIA F LGR +
Sbjct: 434 VLEGHVPRIFRIDNYRVDVEPEGIMLIFENKDVPGVIGKVGSILGDAGVNIAGFRLGREK 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
               A+  L +D  +   +L +LS    + FVKQ 
Sbjct: 494 RGGIALGILNLDDPVPEEILHELSKLPEVLFVKQV 528


>gi|73662348|ref|YP_301129.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72494863|dbj|BAE18184.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 538

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 33/100 (33%), Positives = 49/100 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +   PR ++I +   D    R  + I + D  GIV   G ILGEYGINIA  HLGR  
Sbjct: 432 VLNGYGPRIVRINDYPVDFKPERHQLVINHNDRPGIVGRTGQILGEYGINIASMHLGRIN 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
              +A+  L ID  + + V++ L        ++  E  ++
Sbjct: 492 QGGNALMILSIDHPVTDDVIDGLYEIEGFNLIRSVELEIE 531


>gi|323701688|ref|ZP_08113360.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum nigrificans
           DSM 574]
 gi|323533461|gb|EGB23328.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum nigrificans
           DSM 574]
          Length = 527

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 43/97 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR + I     +      M+ I + D  GIV  VG ++G+  INIA   +GR +
Sbjct: 431 LFQGNDPRVVNIDGYRINAATTGHMLVIPHIDKPGIVGKVGTLVGDKDINIAGMQVGRIE 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  + +D  +    L++++    I  VK    
Sbjct: 491 LGGKAIMVMMVDNIVPQCALDEMAKIDGILEVKMVSL 527


>gi|55379323|ref|YP_137173.1| D-3-phosphoglycerate dehydrogenase [Haloarcula marismortui ATCC
           43049]
 gi|55232048|gb|AAV47467.1| D-3-phosphoglycerate dehydrogenase [Haloarcula marismortui ATCC
           43049]
          Length = 528

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 43/96 (44%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F   +PR ++I +   +      M+ + N D  G + F+G +LGE  INIA    GR   
Sbjct: 430 FGGEEPRIVRIDDHRIEAVPHGHMLVVRNRDEPGTIGFIGTVLGEADINIAGMFNGRETI 489

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              A+S   +D      ++E+L+ +  I      E 
Sbjct: 490 GGEALSVYNLDEQPPQDIIERLNDDSRIIETTYVEL 525


>gi|146276068|ref|YP_001166227.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554309|gb|ABP68922.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 531

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 63/98 (64%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++GR M+   N D+ GI+  +G  +G+ G+NIA+F LGR+  
Sbjct: 433 FSDGKPRFIQIKGINIDAEVGRHMLYTTNEDVPGIIGLLGMTMGKNGVNIANFTLGRTSV 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            + AI+ L +D +I   V+E L      + VK  EF+V
Sbjct: 493 GQEAIAILYLDQAIDPKVVETLESTGMFQQVKPLEFDV 530


>gi|84502815|ref|ZP_01000928.1| D-3-phosphoglycerate dehydrogenase [Oceanicola batsensis HTCC2597]
 gi|84388798|gb|EAQ01668.1| D-3-phosphoglycerate dehydrogenase [Oceanicola batsensis HTCC2597]
          Length = 531

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G  +G+ G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGQTMGQNGVNIANFTLGRAS 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D +     L  L      R +K  +F++
Sbjct: 492 AAGEAIALLYLDEAPRKDALSALEQTGLFRQIKPLQFDI 530


>gi|27382512|ref|NP_774041.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium japonicum USDA
           110]
 gi|27355684|dbj|BAC52666.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium japonicum USDA
           110]
          Length = 529

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V+ DGKPR + ++ I  D + G+ MI + N D  G +    ++LG   +NIA FHLGR +
Sbjct: 433 VYHDGKPRLVDVKGIRVDAEFGKSMIYVTNEDKPGFIGAFASLLGAAKLNIATFHLGRVK 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++   VL K+     ++  K   F
Sbjct: 493 LGGDAIALVEVDGAVPADVLAKVQALPQVKQAKALTF 529


>gi|310814538|ref|YP_003962502.1| D-3-phosphoglycerate dehydrogenase [Ketogulonicigenium vulgare Y25]
 gi|308753273|gb|ADO41202.1| D-3-phosphoglycerate dehydrogenase [Ketogulonicigenium vulgare Y25]
          Length = 531

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 46/100 (46%), Positives = 64/100 (64%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+EIN D +IG  MI   N D+ G++  +G ILGE G+NIA+F LGR+ 
Sbjct: 432 VFSDGKPRFIQIKEINVDAEIGADMIYTTNKDVPGVIGTLGGILGENGVNIANFTLGRAD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
               AI+ L +DG    +VL+K+  +     V    F+V+
Sbjct: 492 QGGEAIAVLYVDGRPDEAVLDKVRASGKFGQVTAMHFDVN 531


>gi|182678253|ref|YP_001832399.1| D-3-phosphoglycerate dehydrogenase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634136|gb|ACB94910.1| D-3-phosphoglycerate dehydrogenase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 529

 Score =  110 bits (275), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DGKPR I I +I  D  +  +MI + N D  G +    ++LG   +NIA F LGR +
Sbjct: 433 VFHDGKPRIIAINDIKIDAAVAPVMIYVSNEDKPGFIGRFASLLGNASVNIATFALGRDR 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+ + +DG++  SV  ++     ++ VK   F
Sbjct: 493 EGGSAIALVEVDGAVPESVQNEVKALPGVKKVKALAF 529


>gi|108803680|ref|YP_643617.1| D-3-phosphoglycerate dehydrogenase [Rubrobacter xylanophilus DSM
           9941]
 gi|108764923|gb|ABG03805.1| D-3-phosphoglycerate dehydrogenase [Rubrobacter xylanophilus DSM
           9941]
          Length = 527

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 43/92 (46%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +PR ++      D+   R M+ I N D+ G++  VG ILGE+GINI +  +GR +    A
Sbjct: 435 QPRLVEALGYTLDIVPERHMLFIRNEDVPGMIGKVGTILGEHGINIGNMAVGRGEPGSRA 494

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              + +D  +   V+E L         +    
Sbjct: 495 AMAVTVDEPVPPEVVESLLNIPGFNDARAVTL 526


>gi|33863698|ref|NP_895258.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9313]
 gi|33635281|emb|CAE21606.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9313]
          Length = 532

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++G  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 436 VFANGDLRITTIDEFPVNVSPSRHMLLTRHRDMPGIIGQLGSVLGEHNVNIASMQVGRRI 495

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  S+L  +     I+       
Sbjct: 496 VRGDAVMVLSIDDPIPPSLLVTIHAINGIKEAHPVTL 532


>gi|87123644|ref|ZP_01079494.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9917]
 gi|86168213|gb|EAQ69470.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9917]
          Length = 528

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRVTSIDEFPVNVPPSRHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  S+L  +     I+       
Sbjct: 492 VRGDAVMVLSIDDPIPPSLLATIHAINGIQEAHPVTL 528


>gi|134297895|ref|YP_001111391.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum reducens MI-1]
 gi|134050595|gb|ABO48566.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum reducens MI-1]
          Length = 526

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR + I     +      M+ + + D  GIV  VG ++G+  INIA   +GR +
Sbjct: 430 LFQGNDPRIVNIDGFRINAATQGHMLVVPHIDKPGIVGKVGTVVGDMAINIAGMQVGRIE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  + +D ++  + LE+L+    I  VK    
Sbjct: 490 LGGKAIMVMMVDNTLPTNALEQLATIDGILEVKMVSL 526


>gi|84687790|ref|ZP_01015661.1| D-3-phosphoglycerate dehydrogenase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84664226|gb|EAQ10719.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2654]
          Length = 532

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 60/99 (60%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ I  D +IG  M+   N D+ GI+  +G  LGE G+NIA+F LGR+Q
Sbjct: 434 VFSDGKPRFIQIKGITIDAEIGEHMLYTTNKDVPGIIGTLGRTLGEMGVNIANFTLGRNQ 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               AI+ L +D  +  +V + LS     + V   +F +
Sbjct: 494 QGGDAIALLYVDAEVPANVRKALSDTGMFQNVSALQFAI 532


>gi|124022234|ref|YP_001016541.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9303]
 gi|123962520|gb|ABM77276.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9303]
          Length = 528

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++G  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFANGDLRITTIDEFPVNVSPSRHMLLTRHRDMPGIIGQLGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  S+L  +     I+       
Sbjct: 492 VRGDAVMVLSIDDPIPPSLLVTIHAINGIKEAHPVTL 528


>gi|318042229|ref|ZP_07974185.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CB0101]
          Length = 528

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG+ R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGELRITTIDEFPVNVAPSRHMLFTRHRDMPGIIGNLGSVLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  +  S+L  +     I+       
Sbjct: 492 VRGDAVMVLSLDDPLPASLLATIHGIEGIQEAHPVTL 528


>gi|291294575|ref|YP_003505973.1| D-3-phosphoglycerate dehydrogenase [Meiothermus ruber DSM 1279]
 gi|290469534|gb|ADD26953.1| D-3-phosphoglycerate dehydrogenase [Meiothermus ruber DSM 1279]
          Length = 521

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/89 (33%), Positives = 40/89 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
            GKPR + I +   +      M+  +N D  G+V  VG +LGE  INIA   LGR     
Sbjct: 428 GGKPRIVGIDDHTVEAVPRGFMLVCINRDRPGVVGKVGTLLGENNINIAGMQLGRDNPGG 487

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+  L ID     +VL  L     +  V
Sbjct: 488 KALFVLAIDERPGEAVLSALRGLDVLERV 516


>gi|257052567|ref|YP_003130400.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
 gi|256691330|gb|ACV11667.1| D-3-phosphoglycerate dehydrogenase [Halorhabdus utahensis DSM
           12940]
          Length = 528

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 45/97 (46%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F+DG+PR + I     +      M+ + NAD  G++ F+G +LGEY +NIA     R   
Sbjct: 426 FADGEPRIVSIDRYWVEAIPHGHMLIVRNADEPGVIGFIGTVLGEYDVNIAGMFNAREAI 485

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
              A+S   +D      VL  L+ +  I      E N
Sbjct: 486 GGEALSVYNLDDEPGEDVLAALNDDDRILETTVVELN 522


>gi|194016714|ref|ZP_03055327.1| phosphoglycerate dehydrogenase [Bacillus pumilus ATCC 7061]
 gi|194011320|gb|EDW20889.1| phosphoglycerate dehydrogenase [Bacillus pumilus ATCC 7061]
          Length = 524

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R + I   N D      ++ I + D  G++  VG ILG++ +NIA   +GR +    AI 
Sbjct: 435 RVVSINGFNIDFYPDGHLVYIQHTDAPGVIGKVGQILGDHDVNIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  + + ++++L+    I  V+  + 
Sbjct: 495 MLSFDKHLEDEIVKELTEVHDILSVRLIDL 524


>gi|222056517|ref|YP_002538879.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. FRC-32]
 gi|221565806|gb|ACM21778.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. FRC-32]
          Length = 540

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 50/94 (53%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++ + D      M+ +   D  G++  +G I+G +GINIA  +LGR +   
Sbjct: 436 EGAPRIVRLRDYSMDFAPDEHMLLLNYTDRPGMIGQIGTIMGTHGINIASMNLGRREKKG 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++   V+E++   +   +++    
Sbjct: 496 EAMVILSLDSAVPPEVVEEMKTAIDATYIRAIHM 529


>gi|39996300|ref|NP_952251.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens PCA]
 gi|39983180|gb|AAR34574.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens PCA]
 gi|298505310|gb|ADI84033.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens KN400]
          Length = 542

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 51/94 (54%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++ + D      M+ +  AD  G++  +G I+G++ INIA  +LGRS+   
Sbjct: 436 EGLPRIVRLRDYSMDFAPEEHMLLLHYADRPGMIGKIGTIMGQHEINIASMNLGRSEKKG 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++   VLE++       F+K    
Sbjct: 496 EAMVILSLDSAVPPQVLEEVRAATDATFIKAIHM 529


>gi|157692807|ref|YP_001487269.1| D-3-phosphoglycerate dehydrogenase [Bacillus pumilus SAFR-032]
 gi|157681565|gb|ABV62709.1| phosphoglycerate dehydrogenase [Bacillus pumilus SAFR-032]
          Length = 524

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R + I   N D      ++ I + D  G++  VG ILG++ +NIA   +GR +    AI 
Sbjct: 435 RVVSINGFNIDFYPDGHLVYIQHTDAPGVIGKVGQILGDHDVNIATMQVGRKEKGGEAIM 494

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L  D  + + ++++L+    I  V+  + 
Sbjct: 495 MLSFDKHLEDEIVKELTEVHDILSVRLIDL 524


>gi|254486096|ref|ZP_05099301.1| phosphoglycerate dehydrogenase [Roseobacter sp. GAI101]
 gi|214042965|gb|EEB83603.1| phosphoglycerate dehydrogenase [Roseobacter sp. GAI101]
          Length = 531

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D +IG  M+   N D+ GI+  +G  LG  G+NIA+F LGRS 
Sbjct: 432 VFSDGKPRFIQIKGINIDAEIGAHMLYTTNEDVPGIIGTLGQTLGANGVNIANFTLGRSV 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L ID  +  + +++L        VK+ EF+V
Sbjct: 492 AKGEAIALLYIDDVLPATAIKQLQDTGLFTQVKELEFDV 530


>gi|319892782|ref|YP_004149657.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162478|gb|ADV06021.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464187|gb|ADX76340.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           ED99]
          Length = 531

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/98 (35%), Positives = 47/98 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +   PR ++I +   D       + I + D  GIV   G ILGE+G+NIA  HLGRSQ
Sbjct: 432 VLNGFGPRIVRINDYPVDFKPEHYQLVIHHFDRPGIVGKTGQILGEHGVNIASMHLGRSQ 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A+  L ID  I  +V E L      + V Q   +
Sbjct: 492 IGGDAMMILSIDHPINETVREALLKIDGFQSVLQVTLD 529


>gi|159903950|ref|YP_001551294.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9211]
 gi|159889126|gb|ABX09340.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9211]
          Length = 528

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 432 VFADGDLRITCIDEFPVNVAPSRHMLFTRHRDMPGIIGKIGSLLGVHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I + +L+ +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPSELLKSILQIQGINEAHPVTL 528


>gi|76800791|ref|YP_325799.1| D-3-phosphoglycerate dehydrogenase [Natronomonas pharaonis DSM
           2160]
 gi|76556656|emb|CAI48227.1| phosphoglycerate dehydrogenase [Natronomonas pharaonis DSM 2160]
          Length = 526

 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 42/98 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+D   R +++     D   G  M+   N D  G++  +G ++G Y +NIA     R  
Sbjct: 428 LFADDDARIVRVDGYRVDAIPGGKMMVARNTDEPGVIGHIGTVMGTYDVNIAGMFNARET 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D  + +   E+L  +  I   K    N
Sbjct: 488 HGGEALTVYNVDQEVPDEAREELESDDRIIETKYISLN 525


>gi|257386858|ref|YP_003176631.1| D-3-phosphoglycerate dehydrogenase [Halomicrobium mukohataei DSM
           12286]
 gi|257169165|gb|ACV46924.1| D-3-phosphoglycerate dehydrogenase [Halomicrobium mukohataei DSM
           12286]
          Length = 529

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 44/97 (45%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F+   PR ++I +   D      M+   N D  G + F+G +LGE  INIA    GR   
Sbjct: 430 FAGEDPRIVRIDDHRVDAVPHGHMLVARNRDEPGTIGFIGTVLGESDINIAGMFNGREVI 489

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
              A+S   +D    + VL++L+ +  I   K    +
Sbjct: 490 GGEALSVYNLDEPPTSDVLDRLNGDDRIIETKYISLD 526


>gi|330813822|ref|YP_004358061.1| D-3-phosphoglycerate dehydrogenase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486917|gb|AEA81322.1| D-3-phosphoglycerate dehydrogenase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 527

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 46/94 (48%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GKPR ++++ I  D  +    + I N D  G +  +  +L +  INI  F+LGR +S   
Sbjct: 432 GKPRIVEVKGIEIDAGLSAHNLYISNEDKPGFIRDLSKVLADNKINIGTFNLGRKKSGGE 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
           A++ +  D  I  +V+E +     +   K   FN
Sbjct: 492 AVALISTDSEIEKTVIESIKKIPLVIQAKYLSFN 525


>gi|113954952|ref|YP_731454.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9311]
 gi|113882303|gb|ABI47261.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9311]
          Length = 528

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRVTSIDEFPVNVPPSRHMLFTRHRDMPGIIGHLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++L  +     I+       
Sbjct: 492 VRGDAVMVLSIDDPIPPALLTTIHGINGIQEAHPVTL 528


>gi|78779836|ref|YP_397948.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9312]
 gi|78713335|gb|ABB50512.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9312]
          Length = 528

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I N +L+ +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTIIEVEGITSANPVTL 528


>gi|312621616|ref|YP_004023229.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202083|gb|ADQ45410.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 531

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 44/89 (49%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    IDG + +  +EKL     I  V
Sbjct: 498 KAVMVCEIDGELPDEAVEKLKNTDGILRV 526


>gi|189425146|ref|YP_001952323.1| D-3-phosphoglycerate dehydrogenase [Geobacter lovleyi SZ]
 gi|189421405|gb|ACD95803.1| D-3-phosphoglycerate dehydrogenase [Geobacter lovleyi SZ]
          Length = 535

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 50/94 (53%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++   D      M+ +  AD  G++  +G I+G++ INI   +LGRS+   
Sbjct: 435 EGAPRIVRLRDYAMDFTPEEHMLLLHYADRPGMIGKIGTIMGKHEINIGSMNLGRSEKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L ID ++  +V+E++       F++    
Sbjct: 495 EAMVILSIDSAVSQAVIEEIKQATEATFIRAIHM 528


>gi|294010170|ref|YP_003543630.1| D-3-phosphoglycerate dehydrogenase [Sphingobium japonicum UT26S]
 gi|292673500|dbj|BAI95018.1| D-3-phosphoglycerate dehydrogenase [Sphingobium japonicum UT26S]
          Length = 526

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + +PR +++  I  + D+   M+ IVN D  G +  +G+ LGE  +NI  FHLGR  
Sbjct: 429 LFGNAQPRLVELFGIKVEADLAGDMLYIVNQDAPGFIGRLGSTLGEAQVNIGTFHLGRRN 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +DG++  +VL  +     ++ VK   F
Sbjct: 489 QGGEAVLLLSLDGAVNEAVLSDICKLAGVKTVKLLRF 525


>gi|94496033|ref|ZP_01302612.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas sp. SKA58]
 gi|94424725|gb|EAT09747.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas sp. SKA58]
          Length = 517

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 50/97 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   +PR +++  I  + D+G  M+ IVN D  G +  +G+ LGE  +NI  FHLGR  
Sbjct: 420 LFGHAQPRLVELFGIKVEADLGGTMLYIVNQDAPGFIGRLGSTLGEANVNIGTFHLGRRD 479

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +DG++   +  ++     +  VK   F
Sbjct: 480 QGGEAVLLLSVDGTVTEPLRWEICNLTGVNQVKLLRF 516


>gi|289549238|ref|YP_003474226.1| D-3-phosphoglycerate dehydrogenase [Thermocrinis albus DSM 14484]
 gi|289182855|gb|ADC90099.1| D-3-phosphoglycerate dehydrogenase [Thermocrinis albus DSM 14484]
          Length = 530

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 46/88 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I     DV+   +++   N D+ G++  VG+ILG   +NIA F LGR +    A+ 
Sbjct: 441 RLVRIDSYMVDVEPEGILLIFENKDVPGVIGKVGSILGRANVNIAGFRLGREKKGGIALG 500

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            L +D  +   VL +L     I FV+Q 
Sbjct: 501 ILNLDDPVPEEVLAELKAVPEIFFVRQV 528


>gi|160879605|ref|YP_001558573.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium phytofermentans ISDg]
 gi|160428271|gb|ABX41834.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium phytofermentans ISDg]
          Length = 222

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK + ++I  I+ D       + I + D  G+V ++   L E  +NIA   L R +  
Sbjct: 128 GGGKIKIVRINGIDVDFTGEYSTLVIRHHDYPGMVAYIATSLSERNVNIAFMRLFRERKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A S +  D  I   +LEKL  +  +  V   +
Sbjct: 188 ATAYSVVESDEEIPRELLEKLREHPKVEDVMLIQ 221


>gi|289581556|ref|YP_003480022.1| D-3-phosphoglycerate dehydrogenase [Natrialba magadii ATCC 43099]
 gi|289531109|gb|ADD05460.1| D-3-phosphoglycerate dehydrogenase [Natrialba magadii ATCC 43099]
          Length = 528

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 45/98 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR +++     D      M+   N D  G++  +G ++G++G+NIA     R  
Sbjct: 428 LFAGDDPRIVRVDGYRVDAIPHGKMVVTRNTDEPGVIGLIGTVMGKHGVNIAGMFNAREA 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D  + ++  ++L+ +  I  V     N
Sbjct: 488 HGGEALTVYNVDSQVPDAAKDELNEDDRIIGVDYITLN 525


>gi|222530091|ref|YP_002573973.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456938|gb|ACM61200.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor bescii DSM
           6725]
          Length = 531

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 44/89 (49%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    IDG + +  +EKL     I  V
Sbjct: 498 KAVMVCEIDGELPDEAIEKLKNTDGILRV 526


>gi|323135941|ref|ZP_08071024.1| D-3-phosphoglycerate dehydrogenase [Methylocystis sp. ATCC 49242]
 gi|322399032|gb|EFY01551.1| D-3-phosphoglycerate dehydrogenase [Methylocystis sp. ATCC 49242]
          Length = 528

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DGKPR  +I +I  D +    MI   N D  G +     +LGE  +NIA F LGR  
Sbjct: 432 VFHDGKPRIARIGDIGIDAEFAPSMIYTENEDRPGFIGRFAGLLGEAKVNIATFALGRDM 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++ + IDG +   VL  +     ++      F
Sbjct: 492 PGGCAVALVAIDGELPEDVLAAIRDLPGVKQALTLRF 528


>gi|85859018|ref|YP_461220.1| D-3-phosphoglycerate dehydrogenase [Syntrophus aciditrophicus SB]
 gi|85722109|gb|ABC77052.1| D-3-phosphoglycerate dehydrogenase [Syntrophus aciditrophicus SB]
          Length = 527

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I +   DV     ++ + N D  G++  +G  +G   INIA  H  R Q
Sbjct: 431 LFGRRDPRIVRINQFTVDVIPEGHLLMLYNHDKPGVIGNIGTAIGSANINIARMHWSRLQ 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + + A+     D  +   +L+KL     +  V++ + 
Sbjct: 491 AEQKAMVVFSTDTPVDAQLLKKLKETPNVISVQELDM 527


>gi|325284843|ref|YP_004264305.1| D-3-phosphoglycerate dehydrogenase [Deinococcus proteolyticus MRP]
 gi|324316558|gb|ADY27670.1| D-3-phosphoglycerate dehydrogenase [Deinococcus proteolyticus MRP]
          Length = 534

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 59/99 (59%), Gaps = 1/99 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ G++  +G  LG+ G+NIA+F LGRS 
Sbjct: 437 VFSDGKPRFIQIRGINLDAEVGEHMLYTRNRDVPGVIGSLGTALGDLGVNIANFTLGRSA 496

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
             + AI+ + +D  +  +  + L  +     V+   F +
Sbjct: 497 QGD-AIAIIYLDEPLPAAAAQALRDSGKFIQVRPLHFEL 534


>gi|410116|gb|AAA67502.1| phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 419

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F +   R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR + 
Sbjct: 326 FGE---RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEK 382

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              AI  L  D  + + ++++L+    I  VK  + 
Sbjct: 383 GGEAIMMLSFDRHLEDKIVKELTNVPDIVSVKLIDL 418


>gi|302872524|ref|YP_003841160.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575383|gb|ADL43174.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 531

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 45/89 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    +DG++ +  +EKL     I  V
Sbjct: 498 KAVMVCEVDGALPDEAVEKLKNTDGILRV 526


>gi|148242943|ref|YP_001228100.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. RCC307]
 gi|147851253|emb|CAK28747.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. RCC307]
          Length = 528

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRITSIDEFPLNVPPSRHMLFTRHRDMPGIIGNLGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  I +S L  +     I+       
Sbjct: 492 VRGDAVMVLSLDDPIPSSTLTSVKDINGIQEAHPVTL 528


>gi|197106733|ref|YP_002132110.1| D-3-phosphoglycerate dehydrogenase [Phenylobacterium zucineum HLK1]
 gi|196480153|gb|ACG79681.1| D-3-phosphoglycerate dehydrogenase [Phenylobacterium zucineum HLK1]
          Length = 524

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 50/93 (53%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G PR I+++ ++ D      M+ + N D  G +  +G +LG+  INIA F+LGR  + + 
Sbjct: 432 GAPRIIEVKGMDLDAPFAPQMLYVNNLDKPGFIGALGALLGDAKINIATFNLGRIDAGDD 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI+ + +D +   ++L K+     ++  +   F
Sbjct: 492 AIALVGVDQAPDEALLAKIQKLPHVKEARALRF 524


>gi|223940712|ref|ZP_03632551.1| D-3-phosphoglycerate dehydrogenase [bacterium Ellin514]
 gi|223890639|gb|EEF57161.1| D-3-phosphoglycerate dehydrogenase [bacterium Ellin514]
          Length = 526

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 48/95 (50%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +  +PR +++     +V    ++  + N D  GIV ++G ++G + +NIA   L R  + 
Sbjct: 432 AKKQPRIVRVNGQPVEVVPEGVLFLMTNKDRPGIVGYLGTLMGRHNVNIASMSLSRDIAG 491

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            HA++ L +D     + LE++  +  I  V+  + 
Sbjct: 492 GHALTVLNLDSVPSETALEEIRKDPDISNVRVVKL 526


>gi|254444984|ref|ZP_05058460.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobiae bacterium
           DG1235]
 gi|198259292|gb|EDY83600.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobiae bacterium
           DG1235]
          Length = 545

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 46/94 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
              PR + I     +V+    M+ I N+D LGIV  +G I+G+ G+NIA   L R++   
Sbjct: 452 GNFPRIVSINGREVEVEPHGSMLVIANSDELGIVGKIGEIIGKDGVNIAAMSLSRNEVGG 511

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A++   +D  + ++ + ++     I+  K    
Sbjct: 512 VALNIASLDSDLSDAAMAEIKAIEAIKQAKVVHL 545


>gi|123969087|ref|YP_001009945.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           AS9601]
 gi|123199197|gb|ABM70838.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. AS9601]
          Length = 528

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I N +L+ +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTIIEVEGITNANPVTL 528


>gi|163742511|ref|ZP_02149897.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis 2.10]
 gi|161384096|gb|EDQ08479.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis 2.10]
          Length = 531

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G ILG+ G+NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGQILGDMGVNIANFTLGRSE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  +    L+       +K  +F+V
Sbjct: 492 AGGEAIALLYVDEPVPAAARAALAETEFFNQIKPLQFDV 530


>gi|150399650|ref|YP_001323417.1| D-3-phosphoglycerate dehydrogenase [Methanococcus vannielii SB]
 gi|150012353|gb|ABR54805.1| D-3-phosphoglycerate dehydrogenase [Methanococcus vannielii SB]
          Length = 523

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 46/92 (50%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +  F +I     D+     +  I + D  G+V  VG ILGE+GINIA   +GR +   H+
Sbjct: 432 EVVFREINGYRMDIKPEGTICIIKHIDRPGMVGKVGLILGEHGINIAGMQVGRKEPGGHS 491

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           I FL ID  I   V++++     +R V+    
Sbjct: 492 IMFLDIDHMIPEEVMDEIKKIENVRAVRAINI 523


>gi|312135806|ref|YP_004003144.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor owensensis
           OL]
 gi|311775857|gb|ADQ05344.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor owensensis
           OL]
          Length = 531

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 45/89 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    +DG++ +  +EKL     I  V
Sbjct: 498 KAVMVCEVDGALPDEAVEKLKSTDGILRV 526


>gi|312126868|ref|YP_003991742.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776887|gb|ADQ06373.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 531

 Score =  107 bits (269), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 44/89 (49%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLIIQNIDKPGMIGRIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    IDG + +  +EKL     I  V
Sbjct: 498 KAVMVCEIDGELPDEAVEKLRNTDGILRV 526


>gi|154500566|ref|ZP_02038604.1| hypothetical protein BACCAP_04239 [Bacteroides capillosus ATCC
           29799]
 gi|150270455|gb|EDM97764.1| hypothetical protein BACCAP_04239 [Bacteroides capillosus ATCC
           29799]
          Length = 231

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 34/98 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R   I  ++         + I N D  G V  V  IL    +NIA   L R+   
Sbjct: 133 GGGRVRVNAIDGLDASFTGEYPTLIIRNEDKPGAVAEVTGILSRRQVNIATMQLYRNMRG 192

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
             A+  L  D  I    +E+L     I  V       D
Sbjct: 193 GLAVMVLESDQDIWQEAIEELRACPGIVRVTYLNMEED 230


>gi|305674943|ref|YP_003866615.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|305413187|gb|ADM38306.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 525

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F +   R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR + 
Sbjct: 432 FGE---RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEK 488

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              AI  L  D  + + ++++L+    I  VK  + 
Sbjct: 489 GGEAIMMLSFDRHLEDKIVKELTEVPDIVSVKLIDL 524


>gi|146296326|ref|YP_001180097.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409902|gb|ABP66906.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 531

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 45/89 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    IDG++ +  +EKL     I  V
Sbjct: 498 KAVMVCEIDGALPDEAVEKLKSVDGILRV 526


>gi|126696878|ref|YP_001091764.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9301]
 gi|126543921|gb|ABO18163.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9301]
          Length = 528

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I N +L+ +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTIIEVDGITNANPVTL 528


>gi|163738093|ref|ZP_02145509.1| flagellar L-ring protein precursor H [Phaeobacter gallaeciensis
           BS107]
 gi|161388709|gb|EDQ13062.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis
           BS107]
          Length = 531

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 62/99 (62%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G ILG+ G+NIA+F LGRS+
Sbjct: 432 VFSDGKPRFIQIKGINIDAEVGAHMLYTTNEDVPGIIGTLGQILGDMGVNIANFTLGRSE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +  +    L+       +K  +F+V
Sbjct: 492 AGGEAIALLYVDEPVPAAARAALAETEFFNQIKPLQFDV 530


>gi|312792696|ref|YP_004025619.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179836|gb|ADQ40006.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 531

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 45/89 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGRIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    IDG++ +  +EKL     I  V
Sbjct: 498 KAVMVCEIDGALPDEAVEKLKNTDGILRV 526


>gi|226312009|ref|YP_002771903.1| D-3-phosphoglycerate dehydrogenase [Brevibacillus brevis NBRC
           100599]
 gi|226094957|dbj|BAH43399.1| D-3-phosphoglycerate dehydrogenase [Brevibacillus brevis NBRC
           100599]
          Length = 527

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 45/95 (47%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +    R +KI +   DV     ++ I + D  G++  VG+ILGE  +NIA   +GR    
Sbjct: 433 NGYGARIVKIDDFAIDVAPEGYLLYIHHNDRPGVIGRVGSILGENSVNIATMQVGRRDIG 492

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             AI  L +D  +   +L+ +     ++ V Q E 
Sbjct: 493 GDAIMMLSVDKPLTPELLDTMGELAEVKSVTQIEL 527


>gi|297622551|ref|YP_003703985.1| D-3-phosphoglycerate dehydrogenase [Truepera radiovictrix DSM
           17093]
 gi|297163731|gb|ADI13442.1| D-3-phosphoglycerate dehydrogenase [Truepera radiovictrix DSM
           17093]
          Length = 524

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 38/87 (43%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             +PR + + E   ++     M+   N D  G V  VG +LG+ G+NI+   L R     
Sbjct: 430 GTEPRIVSVDEYPIELRPEGTMLICTNYDRPGAVGKVGTVLGDAGVNISGMQLSRVGENG 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIR 90
            A+  L +D     SVLE L     + 
Sbjct: 490 LALFALGLDQEPPESVLEVLRSLPNVL 516


>gi|312878276|ref|ZP_07738197.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311794944|gb|EFR11352.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 531

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 29/89 (32%), Positives = 45/89 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEYGINIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGRIGTIVGEYGINIATMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    IDG++ +  +EKL     I  V
Sbjct: 498 KAVMVCEIDGALPDEAVEKLKNTDGILRV 526


>gi|317121362|ref|YP_004101365.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter marianensis DSM
           12885]
 gi|315591342|gb|ADU50638.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter marianensis DSM
           12885]
          Length = 571

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 43/93 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG PR + +  +  D+     ++   + D  G++  VG++LG   INIA   + R Q   
Sbjct: 443 DGLPRLVHLDGLPLDMVPAPRLLLTRHHDRPGMIGKVGSLLGAREINIAAMQVARRQVRG 502

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            AI  L +D  +  ++L ++     +   +  +
Sbjct: 503 EAIMVLALDDPVPAALLAEIRRLPGMEEARLVQ 535


>gi|302390824|ref|YP_003826644.1| D-3-phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM
           5501]
 gi|302202901|gb|ADL11579.1| D-3-phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM
           5501]
          Length = 527

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D   R ++I     +      ++   + D  G+V  +G +LGE  INIA+  LGR  
Sbjct: 431 VFDDTDLRIVEINGYRVNAISEGNLLITNHTDKPGVVGKIGTLLGENDINIANMQLGRHD 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  + ID  + + V EKL     I  +K+   
Sbjct: 491 AGGEAVMVMGIDNELNSEVKEKLLTIDGISDIKEVNL 527


>gi|320101741|ref|YP_004177332.1| D-3-phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
 gi|319749023|gb|ADV60783.1| D-3-phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
          Length = 544

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 43/97 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   + R + +     D D+  +M+   + D  G++  +G ++G + +NIA  ++GR+ 
Sbjct: 437 LFGRQRMRLVGLGPYQIDCDLEGVMLIFTHLDRPGLIGSIGTLMGNHNVNIAQMNVGRAV 496

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  + +D       LE L     +  V   + 
Sbjct: 497 KGGEAIGVVNLDSIPPEEALEALRALPDLYSVTVIQL 533


>gi|33240885|ref|NP_875827.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
 gi|33238414|gb|AAQ00480.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 528

 Score =  107 bits (267), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +DG+ R   I E   +V   R M+   + D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 432 VLADGELRISSIDEFPINVSPSRYMLFTRHRDMPGIIGKLGSLLGTHNVNIAAMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I + +L  +     I       F
Sbjct: 492 VRGEAVMVLSIDDPIPSELLTSILAVEGINQAHAVTF 528


>gi|150402759|ref|YP_001330053.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C7]
 gi|150033789|gb|ABR65902.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C7]
          Length = 523

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 47/93 (50%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            +  F +I     D+     +  I + D  G+V  VG +LGE+GINIA   +GR +   H
Sbjct: 431 NEIVFREINGYRMDIKPEGTICIIKHIDRPGMVGKVGVLLGEHGINIAGMQVGRREPGGH 490

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +I FL +D  I + V+E++     +R VK    
Sbjct: 491 SIMFLDVDHMISDDVMEEIQKIENVRAVKSINI 523


>gi|260574246|ref|ZP_05842251.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sp. SW2]
 gi|259023712|gb|EEW27003.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sp. SW2]
          Length = 531

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 43/98 (43%), Positives = 61/98 (62%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D +IGR M+   N D+ GI+  +G  +G+  +NIA+F LGRS  
Sbjct: 433 FSDGKPRFIQIKGINIDAEIGRHMLYTTNEDVPGIIGLLGMTMGKNSVNIANFTLGRSGV 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            + AI+ L +D  I   V++ L      + VK  EF+V
Sbjct: 493 GQDAIAILYLDQRIDPKVVDTLESTGLFQQVKALEFDV 530


>gi|221314548|ref|ZP_03596353.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|255767495|ref|NP_390188.2| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|321311779|ref|YP_004204066.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis BSn5]
 gi|251757445|sp|P35136|SERA_BACSU RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|225185123|emb|CAB14239.2| 3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291484735|dbj|BAI85810.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp. natto
           BEST195]
 gi|320018053|gb|ADV93039.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis BSn5]
          Length = 525

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F +   R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR + 
Sbjct: 432 FGE---RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEK 488

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              AI  L  D  + + ++++L+    I  VK  + 
Sbjct: 489 GGEAIMMLSFDRHLEDKIVKELTNVPDIVSVKLIDL 524


>gi|221310225|ref|ZP_03592072.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221319470|ref|ZP_03600764.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323746|ref|ZP_03605040.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. SMY]
          Length = 525

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F +   R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR + 
Sbjct: 432 FGE---RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEK 488

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              AI  L  D  + + ++++L+    I  VK  + 
Sbjct: 489 GGEAIMMLSFDRHLEDKIVKELTNVPDIVSVKLIDL 524


>gi|1146196|gb|AAC83943.1| phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 525

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F +   R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR + 
Sbjct: 432 FGE---RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEK 488

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              AI  L  D  + + ++++L+    I  VK  + 
Sbjct: 489 GGEAIMMLSFDRHLEDKIVKELTNVPDIVSVKLIDL 524


>gi|196233471|ref|ZP_03132314.1| D-3-phosphoglycerate dehydrogenase [Chthoniobacter flavus Ellin428]
 gi|196222467|gb|EDY16994.1| D-3-phosphoglycerate dehydrogenase [Chthoniobacter flavus Ellin428]
          Length = 530

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 47/96 (48%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F    PR +K+   + +     ++    N D  G+V  VG +LG++ +NIA   L R++ 
Sbjct: 435 FFGTTPRIVKVNGRHVEAKPEGVLFLFENRDRPGVVGHVGTLLGKHKVNIAGMSLSRNEE 494

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              A++ L +D     +++++L+    I  V+  + 
Sbjct: 495 GGEALTLLNLDSVPSEAIIKELTAGGDIHSVQVVQL 530


>gi|114800302|ref|YP_761802.1| D-3-phosphoglycerate dehydrogenase [Hyphomonas neptunium ATCC
           15444]
 gi|114740476|gb|ABI78601.1| D-3-phosphoglycerate dehydrogenase [Hyphomonas neptunium ATCC
           15444]
          Length = 531

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/93 (34%), Positives = 54/93 (58%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GKPR ++++ +  + D   + + + N D  G +  +G +LGE  +NIA FHLGR ++   
Sbjct: 439 GKPRIVEVKGMALEGDFSPVTLYVNNIDKPGFIGALGQMLGEAKVNIATFHLGRQEAGGE 498

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI+ + ID +   S++EKL     +R+VK   F
Sbjct: 499 AIALIGIDSTPPASLVEKLDALPQVRYVKVLSF 531


>gi|302384761|ref|YP_003820583.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium saccharolyticum WM1]
 gi|302195389|gb|ADL02960.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium saccharolyticum WM1]
          Length = 222

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK + I+I  I+ D       + I + D  G+V ++   L E  +NIA   L R +  
Sbjct: 128 GGGKVKIIRINGIDVDFTGEYSTLVIRHLDYPGMVAYIATSLSERNVNIAFMRLFRERKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A S +  D  I   +LEKL  +  +  V   +
Sbjct: 188 ATAYSVVESDEEIPQELLEKLREHPKVEDVMLIQ 221


>gi|322419774|ref|YP_004198997.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M18]
 gi|320126161|gb|ADW13721.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M18]
          Length = 532

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 49/92 (53%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +K+++   D      M+ +  AD  GI+  +G ILG++ INIA  +LGR +   
Sbjct: 435 EGIPRIVKLRDYQMDFRPEEHMLLLAYADRPGIIGKIGTILGKHEINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            A+  L +D ++   V+E++       F+K  
Sbjct: 495 EAMVILSLDSAVPADVVEEVREATDATFIKPL 526


>gi|23100081|ref|NP_693547.1| D-3-phosphoglycerate dehydrogenase [Oceanobacillus iheyensis
           HTE831]
 gi|22778312|dbj|BAC14582.1| phosphoglycerate dehydrogenase [Oceanobacillus iheyensis HTE831]
          Length = 528

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +   PR +++ E   D+     M+ I + D  G++  +G+ + ++ INIA   + RS 
Sbjct: 432 LLNGLGPRLVRVDEYRVDITPEGHMVVIQHRDQPGVIGRMGSTIAKHDINIATMQVDRSD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  L ID  + +  L ++     I+ V   + 
Sbjct: 492 IGGDAIMILTIDRHLADEALNEIESLDEIKSVTAIDL 528


>gi|45359151|ref|NP_988708.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis S2]
 gi|45048026|emb|CAF31144.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis S2]
          Length = 523

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 46/93 (49%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            +  F +I     D+     +  I + D  G+V  VG +LGE+GINIA   +GR +   H
Sbjct: 431 NEVVFREINGYRMDIKPEGTICIIKHIDRPGMVGKVGVLLGEHGINIAGMQVGRREPGGH 490

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +I FL ID  I + VL+++     +R  K    
Sbjct: 491 SIMFLDIDHMISDEVLDEIRKMENVRAAKSINI 523


>gi|114769879|ref|ZP_01447489.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium HTCC2255]
 gi|114549584|gb|EAU52466.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium HTCC2255]
          Length = 529

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 59/99 (59%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D ++G  M+   N DI GI+  +G  +GEY +NIA+F LGR  
Sbjct: 431 VFSDGKPRFIQIKGINIDAEVGSHMLYTTNKDIPGIIGTLGQTMGEYDVNIANFTLGRKN 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D +   + ++ L      + V   +F V
Sbjct: 491 TGGDAIALLYLDCAPNQNAMDSLQKTGIFQTVSALKFEV 529


>gi|123966748|ref|YP_001011829.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9515]
 gi|123201114|gb|ABM72722.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9515]
          Length = 528

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG++ +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRFMLITRHRDMPGIIGKLGSLLGDHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++LE +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPTNLLESILEVEGITSSDPVTL 528


>gi|328552773|gb|AEB23265.1| D-3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens
           TA208]
 gi|328912429|gb|AEB64025.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens LL3]
          Length = 525

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F +   R +++   N D+     ++ I + D  G++  VG ILG+  INIA   +GR + 
Sbjct: 432 FGE---RIVELNGFNIDLHPAGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEK 488

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              AI  L  D  + + V+ +L+    I  VK  + 
Sbjct: 489 GGEAIMMLSFDKHLDDKVVNELASIQDIVSVKLIDL 524


>gi|33861910|ref|NP_893471.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|33640278|emb|CAE19813.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
          Length = 528

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ R I I +   +V   R M+   + D+ GI+  +G++LG++ +NIA   +GR  
Sbjct: 432 IFADGELRIISIDQYPVNVSPSRFMLITRHRDMPGIIGKLGSLLGDHNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I  ++LE +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPTNLLESILEVEGITSSDPVTL 528


>gi|328952982|ref|YP_004370316.1| D-3-phosphoglycerate dehydrogenase [Desulfobacca acetoxidans DSM
           11109]
 gi|328453306|gb|AEB09135.1| D-3-phosphoglycerate dehydrogenase [Desulfobacca acetoxidans DSM
           11109]
          Length = 526

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 39/97 (40%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   +PR ++I     +      M+ I N D  G++  +G  +G + INIA   +G+ +
Sbjct: 430 IFGRYEPRLVRINAFRLEAVPEGHMLFIYNTDRPGVIGAIGTTIGNHKINIARMTVGQEK 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                I  L  D S+    L  +     +      E 
Sbjct: 490 ERGQNIILLTTDTSVTPECLADVRALPHVASAHPLEL 526


>gi|303244898|ref|ZP_07331224.1| D-3-phosphoglycerate dehydrogenase [Methanothermococcus okinawensis
           IH1]
 gi|302484715|gb|EFL47653.1| D-3-phosphoglycerate dehydrogenase [Methanothermococcus okinawensis
           IH1]
          Length = 523

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 47/94 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   +I     D+    ++  I + D  G+V  VG +LG+YG+NIA   +GR +   
Sbjct: 430 DGNPVLREINGYKVDIKPEGIICVIKHIDRPGMVGKVGLLLGDYGVNIAGMQVGRKEPGG 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            +I  L +D  I + V+EKL     I+  K  + 
Sbjct: 490 ESIMVLNVDHMIPDEVIEKLKKLENIKDAKIIDL 523


>gi|87301209|ref|ZP_01084050.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 5701]
 gi|87284177|gb|EAQ76130.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 5701]
          Length = 528

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DG  R   I E   +V   R M+   + D+ GI+  +G++LGE+ +NIA   +GR  
Sbjct: 432 VFADGDLRITTIDEFPVNVMPTRHMLITRHRDMPGIIGNIGSLLGEHNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  I  S+L  +     I+       
Sbjct: 492 VRGDAVMVLSLDDPIPPSLLISIHGINGIQEAHPVTL 528


>gi|284163372|ref|YP_003401651.1| D-3-phosphoglycerate dehydrogenase [Haloterrigena turkmenica DSM
           5511]
 gi|284013027|gb|ADB58978.1| D-3-phosphoglycerate dehydrogenase [Haloterrigena turkmenica DSM
           5511]
          Length = 528

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 43/98 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR +++     D      M+   N D  G++  +G+++G++ +NIA     R  
Sbjct: 428 LFAGDDPRIVRVDGYRVDAIPHGKMVVTRNTDEPGVIGLIGSVMGDHDVNIAGMFNARET 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               A++   +D  I +   E+L  +  I  +     N
Sbjct: 488 IGGEALTVYNVDSEIPDGAREELEADERIIGLNYITLN 525


>gi|253576381|ref|ZP_04853711.1| phosphoglycerate dehydrogenase [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844274|gb|EES72292.1| phosphoglycerate dehydrogenase [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 529

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +    R ++I +   DV     +I I + D  GI+  VG +LG+  +NIA   +GR  
Sbjct: 432 LLNGYGARIVQIDKFPVDVAPEGHLIFISHNDKPGIIGHVGTLLGKNVVNIASMQVGRKL 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  L +D ++   VL++L+    I   +   F
Sbjct: 492 VGGEAIMVLTVDKAVTKEVLDELTKLPEINKAQHIIF 528


>gi|304319942|ref|YP_003853585.1| putative phosphoglycerate dehydrogenase [Parvularcula bermudensis
           HTCC2503]
 gi|303298845|gb|ADM08444.1| putative phosphoglycerate dehydrogenase [Parvularcula bermudensis
           HTCC2503]
          Length = 527

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 45/94 (47%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
            G+PR ++I  +  + +    M+ + N D  G +  +G +L    INIA F+LGR+    
Sbjct: 434 GGEPRAVRIGNVRLESNFAPHMLYVQNKDKPGFIGNLGKLLSSKDINIATFNLGRAAPGG 493

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A + L +D  + +  L+ LS    I   +   F
Sbjct: 494 TAYALLAVDQPLDDDTLKALSDLPQIDEARMLSF 527


>gi|308174098|ref|YP_003920803.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens DSM 7]
 gi|307606962|emb|CBI43333.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens DSM 7]
          Length = 525

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F +   R +++   N D+     ++ I + D  G++  VG ILG+  INIA   +GR + 
Sbjct: 432 FGE---RIVELNGFNIDLHPAGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEK 488

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              AI  L  D  + + V+ +L+    I  VK  + 
Sbjct: 489 GGEAIMMLSFDKHLDDKVVNELASIQDIVSVKLIDL 524


>gi|154686553|ref|YP_001421714.1| D-3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens
           FZB42]
 gi|154352404|gb|ABS74483.1| SerA [Bacillus amyloliquefaciens FZB42]
          Length = 525

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 3/96 (3%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F +   R +++   N D++    ++ I + D  G++  VG ILG+  INIA   +GR + 
Sbjct: 432 FGE---RIVELNGFNIDLNPAGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEK 488

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              AI  L  D  + + V+ +L+    I  VK  + 
Sbjct: 489 GGEAIMMLSFDKHLDDKVVNELTSIQDIVSVKLIDL 524


>gi|15678988|ref|NP_276105.1| D-3-phosphoglycerate dehydrogenase [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|3122860|sp|O27051|SERA_METTH RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|2622068|gb|AAB85466.1| phosphoglycerate dehydrogenase [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 525

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 41/92 (44%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +P  I I     DV     MI     D+ G +  +G  LG++GINIA   +GR +    A
Sbjct: 434 EPTIIGINGYRVDVKPEGTMIIARYRDLPGTIGAIGTKLGQHGINIATMQVGRKEIGGEA 493

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +  L +D S+   V+E++     +      E 
Sbjct: 494 VMVLKVDQSVPAEVIEEVKKLDNVDDAVAIEI 525


>gi|308234584|ref|ZP_07665321.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit
           [Atopobium vaginae DSM 15829]
          Length = 517

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 38/95 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R   I  I+ ++      + + + D+ G++  +  IL  Y INIA     R++  
Sbjct: 115 GGGRIRISSIDGISVEITGDYPTLFVAHQDVAGVLAALTGILSTYEINIATMRTFRAKRG 174

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A +   +D  +   +L +L     +  V     
Sbjct: 175 GKAYTVFEVDNPLQGDLLTRLRNVEHVHLVNTVNI 209


>gi|328944373|ref|ZP_08241836.1| L-serine ammonia-lyase beta subunit [Atopobium vaginae DSM 15829]
 gi|327491088|gb|EGF22864.1| L-serine ammonia-lyase beta subunit [Atopobium vaginae DSM 15829]
          Length = 530

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 38/95 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R   I  I+ ++      + + + D+ G++  +  IL  Y INIA     R++  
Sbjct: 128 GGGRIRISSIDGISVEITGDYPTLFVAHQDVAGVLAALTGILSTYEINIATMRTFRAKRG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A +   +D  +   +L +L     +  V     
Sbjct: 188 GKAYTVFEVDNPLQGDLLTRLRNVEHVHLVNTVNI 222


>gi|253700874|ref|YP_003022063.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M21]
 gi|251775724|gb|ACT18305.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M21]
          Length = 532

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 47/92 (51%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +K+++   D      M+ +   D  GI+  +G ILG + INIA  +LGR +   
Sbjct: 435 EGIPRIVKLRDYQMDFRPEEHMLLMAYGDRPGIIGKIGTILGTHEINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            A+  L +D ++   V+E++       FVK  
Sbjct: 495 EAMVILSLDSAVTPEVVEEVRGATDATFVKPL 526


>gi|229543101|ref|ZP_04432161.1| D-3-phosphoglycerate dehydrogenase [Bacillus coagulans 36D1]
 gi|229327521|gb|EEN93196.1| D-3-phosphoglycerate dehydrogenase [Bacillus coagulans 36D1]
          Length = 541

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 3/96 (3%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F     R +K+ +   D+   + ++ I + DI G++  VG+ILG    NI    +GR + 
Sbjct: 435 FGG---RIVKLNDYRVDLRPEQHLLYIRHLDIPGMIGQVGSILGSNDTNIGTMQVGRKEI 491

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              AI  L +D +    VL++L   + I+ V+  E 
Sbjct: 492 GGEAIMVLTLDKTASRQVLDQLKEVIGIKAVQTLEL 527


>gi|296445352|ref|ZP_06887310.1| D-3-phosphoglycerate dehydrogenase [Methylosinus trichosporium
           OB3b]
 gi|296257113|gb|EFH04182.1| D-3-phosphoglycerate dehydrogenase [Methylosinus trichosporium
           OB3b]
          Length = 528

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D +PR + I  +  +      MI + N D  G +     +LGE G+NIA   LGR +
Sbjct: 432 VFHDDEPRIVAIDGVRLETAFAPRMIFVSNEDRPGFMGLFAGLLGEAGVNIATCALGRDR 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A + + +D       + +++    +RF    EF
Sbjct: 492 PGGSARALVGVDEPAPERAMARIAALPGVRFAAALEF 528


>gi|221633751|ref|YP_002522977.1| D-3-phosphoglycerate dehydrogenase [Thermomicrobium roseum DSM
           5159]
 gi|221157124|gb|ACM06251.1| phosphoglycerate dehydrogenase SerA [Thermomicrobium roseum DSM
           5159]
          Length = 745

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 37/89 (41%)

Query: 9   FIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISF 68
            +++   + +  +   M+   + D  GI+  +G ILG Y +NIA   +GR      AI  
Sbjct: 633 IMEVDRFSLERPLAGHMLITHHLDRPGIIGRIGTILGRYEVNIAGMQVGRRARGGEAIMV 692

Query: 69  LCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           L +D  I  + L ++     +        
Sbjct: 693 LNVDDPIPEAALNEILQIPDVWTAYVVSL 721


>gi|77918032|ref|YP_355847.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
 gi|77544115|gb|ABA87677.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
          Length = 534

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 50/94 (53%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G+PR +++++   D      M+ I   D  G++  +G ILGE+ INIA  +LGR +   
Sbjct: 434 EGQPRIVRLRDYQVDFAPEEHMLVITYRDQPGMIGKIGQILGEHDINIAAMNLGRQEKLG 493

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++ + V+ ++   V   F+K    
Sbjct: 494 EAMVILSLDSAVASHVVAEIGSVVDATFIKYLHL 527


>gi|84514603|ref|ZP_01001967.1| D-3-phosphoglycerate dehydrogenase [Loktanella vestfoldensis SKA53]
 gi|84511654|gb|EAQ08107.1| D-3-phosphoglycerate dehydrogenase [Loktanella vestfoldensis SKA53]
          Length = 530

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 61/99 (61%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+DGKPRFI+I+ IN D ++G  M+   N D+ GI+  +G+ILG   +NIA+F LGR++
Sbjct: 432 VFNDGKPRFIQIKGINIDAEVGENMVYTTNNDVPGIIGVLGSILGTNSVNIANFTLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           +   AI+ L +D  +    + +L      + VK   F++
Sbjct: 492 AKGEAIALLYLDEPLPAKAVAELEGTGKFKQVKPLRFDI 530


>gi|197123004|ref|YP_002134955.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. K]
 gi|196172853|gb|ACG73826.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. K]
          Length = 528

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V+   + R +++     +      +I   N D  G+V  +G  LG  G+NIA   L R  
Sbjct: 432 VYGKREARLVRVDGFRLEAVPEGHVILCENDDAPGVVGNLGTALGAAGVNIARISLSRLD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A +FL +D +    VLE++     +R V+    
Sbjct: 492 DHSRAFAFLNVDSAPAPGVLEQVRRLPHVRAVRSIHL 528


>gi|218781218|ref|YP_002432536.1| D-3-phosphoglycerate dehydrogenase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762602|gb|ACL05068.1| D-3-phosphoglycerate dehydrogenase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 526

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 43/97 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           ++   +P+ ++I     ++     ++ I N D  G +  VG++LGE  +NIA   +G+ +
Sbjct: 430 IYGKAEPKIVRIDSFRVEMVPEGHVLLIHNVDKPGAIGSVGSMLGEASVNIARMQVGQEE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                   +  D    + V+ KL     ++ V   E 
Sbjct: 490 DGNRNFIVMETDTETPDDVVAKLRELPLVKSVITVEL 526


>gi|220917793|ref|YP_002493097.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955647|gb|ACL66031.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 528

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V+   + R +++     +      +I   N D  G+V  +G  LG  G+NIA   L R  
Sbjct: 432 VYGKREARLVRVDGFRLEAVPEGHVILCENDDAPGVVGNLGTALGAAGVNIARISLSRLD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A +FL +D +    VLE++     +R V+    
Sbjct: 492 DHSRAFAFLNVDSAPAPGVLEQVRRLPHVRTVRSIHL 528


>gi|308274573|emb|CBX31172.1| D-3-phosphoglycerate dehydrogenase [uncultured Desulfobacterium
           sp.]
          Length = 526

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 41/97 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I     ++     +  + N D  G +  +G +LG   INI    +G+ +
Sbjct: 430 IFGKKDPRIVRINNFRLEMHPSGHLALVHNLDKPGAIGSIGTVLGRNSINIGRMQVGQEE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E  I  L  D  I   VLE+L     ++ V   E 
Sbjct: 490 EGERNIILLKTDLPIPEPVLEELKALPLVKTVTLLEL 526


>gi|295706456|ref|YP_003599531.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium DSM 319]
 gi|294804115|gb|ADF41181.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium DSM 319]
          Length = 524

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 45/95 (47%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +   PR + I   + D      ++ I ++D  G++  VG +LG+  INIA   +GR Q  
Sbjct: 430 AGYGPRIVNIDSFDIDFYPEGHLLYIRHSDQPGVIGNVGKVLGDLRINIATMQVGRKQKG 489

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             AI  L  D  + +SV+  L     I  +++ E 
Sbjct: 490 GEAIMMLTFDKLLDDSVIASLKQTSEIVTIQRIEL 524


>gi|86157688|ref|YP_464473.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774199|gb|ABC81036.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 528

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V+   + R +++     +      +I   N D  G+V  +G  LG  G+NIA   L R  
Sbjct: 432 VYGKREARLVRVDGFRLEAVPEGHVILCENDDAPGVVGNLGTALGAAGVNIARISLSRLD 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A +FL +D +    VLE++     +R V+    
Sbjct: 492 DHSRAFAFLNVDSAPAPGVLEQVRRLPHVRAVRSIHL 528


>gi|148654451|ref|YP_001274656.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus sp. RS-1]
 gi|148566561|gb|ABQ88706.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus sp. RS-1]
          Length = 524

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 38/93 (40%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+P  ++             M+   + D  G++  VG +LGE  +NIA   +GR    E 
Sbjct: 432 GEPHVVEADGFWVTFVPEGPMLFTYHRDRPGMIGKVGTLLGEADVNIASMDVGRLAPREQ 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           A+  L +D  +   V+ +L     I+       
Sbjct: 492 AMMVLRLDDPVPPHVIARLREEPDIQHATTLII 524


>gi|224476814|ref|YP_002634420.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421421|emb|CAL28235.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 530

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +   PR ++I +   D       + I + D  GIV   G ILGEY INIA  HLGR++
Sbjct: 432 VLNGYGPRIVRINDYPVDFKPAEYQLIINHTDRPGIVGRTGQILGEYDINIASMHLGRAE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  + +D ++   +++ L      + ++  + 
Sbjct: 492 EGGDAMMIISVDHTVSEDIIKALFQIDGFKNIQFVDL 528


>gi|197118344|ref|YP_002138771.1| D-3-phosphoglycerate dehydrogenase [Geobacter bemidjiensis Bem]
 gi|197087704|gb|ACH38975.1| D-3-phosphoglycerate dehydrogenase [Geobacter bemidjiensis Bem]
          Length = 532

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 47/92 (51%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +K+++   D      M+ +   D  GI+  +G ILG + INIA  +LGR +   
Sbjct: 435 EGIPRIVKLRDYQMDFRPEEHMLLMAYGDRPGIIGKIGTILGTHEINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            A+  L +D ++   V+E++       FVK  
Sbjct: 495 EAMVILSLDSAVTPEVVEEVRGATDATFVKPL 526


>gi|113477612|ref|YP_723673.1| D-3-phosphoglycerate dehydrogenase [Trichodesmium erythraeum
           IMS101]
 gi|110168660|gb|ABG53200.1| D-3-phosphoglycerate dehydrogenase [Trichodesmium erythraeum
           IMS101]
          Length = 527

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 41/92 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +    + R   I     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 LLGKDEIRITNIDGFPINVPPSPYMLLTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L ++     IR  
Sbjct: 491 VRGDAVMVLSVDDPLPEEILTEILKEPGIRNA 522


>gi|170077862|ref|YP_001734500.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7002]
 gi|169885531|gb|ACA99244.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7002]
          Length = 525

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG  R   I     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGDIRITSINGFPINVPPTGYMLFTLHRDVPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   VL +++    IR  
Sbjct: 489 VRGDAVMVLSLDDPLPEGVLSEITKVTGIRDA 520


>gi|254526871|ref|ZP_05138923.1| phosphoglycerate dehydrogenase [Prochlorococcus marinus str. MIT
           9202]
 gi|221538295|gb|EEE40748.1| phosphoglycerate dehydrogenase [Prochlorococcus marinus str. MIT
           9202]
          Length = 528

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ + + I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELKIMSIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I N +L+ +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTIIEVEGITNANPVTL 528


>gi|56752495|ref|YP_173196.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           6301]
 gi|81300310|ref|YP_400518.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           7942]
 gi|56687454|dbj|BAD80676.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           6301]
 gi|81169191|gb|ABB57531.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           7942]
          Length = 546

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  DG+ R   + E   +V   R M+   + D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 450 LLGDGEIRITNVDEFPVNVPPSRYMLFTRHRDMPGIIGKIGSLLGSFNVNIASMQVGRRI 509

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    I   
Sbjct: 510 VRGDAVMVLSLDDPLPEGILAEITKVAGISDA 541


>gi|78223581|ref|YP_385328.1| D-3-phosphoglycerate dehydrogenase [Geobacter metallireducens
           GS-15]
 gi|78194836|gb|ABB32603.1| D-3-phosphoglycerate dehydrogenase [Geobacter metallireducens
           GS-15]
          Length = 541

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 47/94 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +K+++   D      M+ +   D  G++  +G I+G + INIA  +LGR +   
Sbjct: 435 EGSPRIVKLRDYQVDFAPDEHMLSLTYEDRPGMIGKIGTIMGAHDINIASMNLGRREKRG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++   V+E++       F+K    
Sbjct: 495 EAMVILSLDSAVPPFVVEEVRKATDATFIKPIHM 528


>gi|154151703|ref|YP_001405321.1| D-3-phosphoglycerate dehydrogenase [Candidatus Methanoregula boonei
           6A8]
 gi|154000255|gb|ABS56678.1| D-3-phosphoglycerate dehydrogenase [Methanoregula boonei 6A8]
          Length = 534

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 42/92 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF  G+ R + + +   D+     +I   + D  G++     ILG+  INIA   +GR  
Sbjct: 433 VFVKGRSRIVSVDKYTMDLIPEGYVIVSRHLDKPGVIGRASTILGKCNINIAGMQVGRIN 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + E A+  L +D  +   V++++     I   
Sbjct: 493 AGEEALMVLNVDSEVPEDVMKEIRSMPGIFSA 524


>gi|304315109|ref|YP_003850256.1| phosphoglycerate dehydrogenase [Methanothermobacter marburgensis
           str. Marburg]
 gi|302588568|gb|ADL58943.1| phosphoglycerate dehydrogenase [Methanothermobacter marburgensis
           str. Marburg]
          Length = 525

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 41/92 (44%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +P  I I     DV     MI     D+ G +  +G  LGE+ INIA   +GR +    A
Sbjct: 434 EPTIIGINGYRVDVKPEGTMIIARYRDLPGTIGAIGTKLGEHQINIATMQVGRKEIGGEA 493

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +  L +D S+ + V++++     +      E 
Sbjct: 494 VMVLKVDQSVPSEVIDEVKKLDNVDDAVAIEI 525


>gi|283782491|ref|YP_003373246.1| D-3-phosphoglycerate dehydrogenase [Pirellula staleyi DSM 6068]
 gi|283440944|gb|ADB19386.1| D-3-phosphoglycerate dehydrogenase [Pirellula staleyi DSM 6068]
          Length = 542

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 47/99 (47%), Gaps = 2/99 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +  PR I++ +   +  +   ++   + D+ GI+  VG I G + +NI    +GR+ 
Sbjct: 432 LFGNNMPRLIRLGDYRLEAYLDGNLLIFTHHDVPGIIGAVGTIFGNHKVNIGQMSVGRAG 491

Query: 61  --STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                 A+  L +D     + ++++  +  I+ VK  E 
Sbjct: 492 IIPGGGAVGVLNLDNVPPQAAIDEVQQHPDIQSVKIIEL 530


>gi|157413916|ref|YP_001484782.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9215]
 gi|157388491|gb|ABV51196.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9215]
          Length = 528

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+DG+ + + I +   +V   R M+   + D+ GI+  +G++LG   +NIA   +GR  
Sbjct: 432 IFADGELKIMSIDQYPVNVSPSRYMLVTRHRDMPGIIGKLGSLLGSNNVNIASMQVGRKI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I N +L+ +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPNKLLDTIIEVEGITNANPVTL 528


>gi|257437689|ref|ZP_05613444.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Faecalibacterium prausnitzii A2-165]
 gi|257199996|gb|EEU98280.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Faecalibacterium prausnitzii A2-165]
          Length = 227

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 38/96 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R  +I  +  D       + I N D  G +  V   L    IN+A   + R+ + 
Sbjct: 124 GGGRIRVTEIDGVPADFGGDSNTLIIHNEDTPGCIAEVTTCLAVRRINVASMQVFRAGTG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            +A+  L  D  I + + +KL+    I  V     +
Sbjct: 184 GYAVMVLECDSHIPHPLEQKLATLPGILKVTCLNID 219


>gi|254412600|ref|ZP_05026373.1| D-3-phosphoglycerate dehydrogenase [Microcoleus chthonoplastes PCC
           7420]
 gi|196180335|gb|EDX75326.1| D-3-phosphoglycerate dehydrogenase [Microcoleus chthonoplastes PCC
           7420]
          Length = 527

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+     I E   +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 LLSDGEIHITSIDEFPINVPPSHHMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  +   +L +++    IR  
Sbjct: 491 VRGDAVMVLSIDDPLPEGILTEITKVPGIRDA 522


>gi|56963608|ref|YP_175339.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
 gi|56909851|dbj|BAD64378.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
          Length = 533

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 42/91 (46%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR + I   + DV     ++ I + D  G++  +G +L ++ +NIA   +GR  +   AI
Sbjct: 443 PRIVSINGFSVDVVAEGHILYIQHFDRPGVIGKMGQLLAKHDVNIATMQVGRKSAGGEAI 502

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + +D  +  +V++ L     I      + 
Sbjct: 503 MIVQVDKHVDQTVIDGLLTFDEIAIANVIDL 533


>gi|225377473|ref|ZP_03754694.1| hypothetical protein ROSEINA2194_03121 [Roseburia inulinivorans DSM
           16841]
 gi|225210665|gb|EEG93019.1| hypothetical protein ROSEINA2194_03121 [Roseburia inulinivorans DSM
           16841]
          Length = 264

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 34/95 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    +I  +  +       + + N D  G V  V ++L    +NIA   L R+   
Sbjct: 169 GGGRIEICEIDGLTANFSGDYPTLIVHNIDQPGHVTEVTSMLAHKSVNIATMQLYRASRG 228

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            +A+  +  D  I    L+ L     I  V     
Sbjct: 229 GNAVMVIECDQEIPADALKWLERMEGILKVTYLSL 263


>gi|167465145|ref|ZP_02330234.1| phosphoglycerate dehydrogenase [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 527

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 39/97 (40%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +    R ++I     D      ++ + + D  GI+  VG +LG    NIA   +GR  
Sbjct: 431 LLAGYGERIVRIDRFPVDFAPDGHILLVSHNDKPGIIGKVGTLLGTKDFNIATMQVGREI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  L ID  +   VL++      I  V+    
Sbjct: 491 IGGSAIMVLTIDRPVSQDVLDQFVRLPEIVNVRALTL 527


>gi|313902560|ref|ZP_07835960.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter subterraneus
           DSM 13965]
 gi|313467126|gb|EFR62640.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter subterraneus
           DSM 13965]
          Length = 579

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 42/96 (43%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR + +  +  D+     ++   + D  G++  VG +LG   INIA   + R Q   
Sbjct: 437 EGLPRLVHLDGLPLDMVPAPRLLLTRHHDRPGMIGKVGGLLGMGEINIAAMQVARRQVRG 496

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            AI  L +D  +  S+L ++     +   +     V
Sbjct: 497 EAIMVLALDDPLPPSLLAEIRRLPGMEEARLVHVPV 532


>gi|294085874|ref|YP_003552634.1| phosphoglycerate dehydrogenase and related dehydrogenase
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665449|gb|ADE40550.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 527

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 50/97 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +    K R +++Q I  + D    ++ + N D  G +  +G + G+YG+NIA FHLGR  
Sbjct: 429 LVGGDKARIVEVQHIAVESDFPAHLLYLRNYDKPGFIGDLGTLCGKYGVNIATFHLGRRD 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++ + IDG + +S+L  L     +  V   +F
Sbjct: 489 VGGEAVALVEIDGELPDSMLGDLRALKQVVRVDALQF 525


>gi|163781587|ref|ZP_02176587.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882807|gb|EDP76311.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 530

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 48/95 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V      R ++I +   D++   +++   N D+ G++  +G++LG   +NIA F LGR +
Sbjct: 434 VLEGQLLRIVQIDKYRVDIEPEGILLVFENKDVPGVIGKIGSVLGSASVNIAGFRLGREK 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
               A+  L +D  +   V+E L     I FVKQ 
Sbjct: 494 KGGIALGILNLDDQVPEHVIEDLRGIPEILFVKQV 528


>gi|195953161|ref|YP_002121451.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobaculum sp. Y04AAS1]
 gi|195932773|gb|ACG57473.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobaculum sp. Y04AAS1]
          Length = 527

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 48/89 (53%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I     DV+   +M+   N D  G++  +G+ILG+  +NIA F LGR +    A+
Sbjct: 437 PRILQIDRFYVDVEPEGVMLVFENKDAPGVIGTIGSILGQANVNIAGFRLGREKKGGLAL 496

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             L +D  + + VLEKL     I  +KQ 
Sbjct: 497 GVLNLDSKVSDEVLEKLKRIPQIISMKQV 525


>gi|325294449|ref|YP_004280963.1| D-3-phosphoglycerate dehydrogenase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064897|gb|ADY72904.1| D-3-phosphoglycerate dehydrogenase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 529

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  D  P+ ++I    FD+      + I N D+ G++  +G+ILG+Y +NIA F LGR +
Sbjct: 433 VMDDQFPKIVEINGFLFDLTPKGKFLLIKNFDVPGVIGKLGSILGKYNVNIAGFQLGRIE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A   + +D  +    + ++     I  VKQ   
Sbjct: 493 RGKEAKGVILVDNDVPQEAINEIKKIPEILEVKQINL 529


>gi|118580120|ref|YP_901370.1| D-3-phosphoglycerate dehydrogenase [Pelobacter propionicus DSM
           2379]
 gi|118502830|gb|ABK99312.1| D-3-phosphoglycerate dehydrogenase [Pelobacter propionicus DSM
           2379]
          Length = 539

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 49/94 (52%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++ + D      M+ +   D+ G++  +G I+G + INIA  +LGR +   
Sbjct: 435 EGAPRIVRLRDFSIDFSPEEHMLLLHYIDLPGMIGRIGTIMGTHDINIASMNLGRREKKG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++   V+E++       F+K    
Sbjct: 495 EAMVILSLDSAVPLQVVEEIRTATDASFIKPLHL 528


>gi|282163065|ref|YP_003355450.1| D-3-phosphoglycerate dehydrogenase [Methanocella paludicola SANAE]
 gi|282155379|dbj|BAI60467.1| D-3-phosphoglycerate dehydrogenase [Methanocella paludicola SANAE]
          Length = 526

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +   R + I     + +    MI  ++ D  G++  VG ILG+  INIA   +GR  
Sbjct: 430 IFGNKDARIVGIDNYRIEANPAGYMIVTMHKDRPGVIGNVGTILGKNDINIAGMVVGREA 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  L +D ++   VL+++     +   +  + 
Sbjct: 490 VRGEAIMILNVDDAVPQPVLKEMIEKAGLYDARYVKL 526


>gi|322381790|ref|ZP_08055744.1| D-3-phosphoglycerate dehydrogenase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321154178|gb|EFX46500.1| D-3-phosphoglycerate dehydrogenase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 535

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 39/97 (40%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +    R ++I     D      ++ + + D  GI+  VG +LG    NIA   +GR  
Sbjct: 439 LLAGYGERIVRIDRFPVDFAPDGHILLVSHNDKPGIIGKVGTLLGTKDFNIATMQVGREI 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  L ID  +   VL++      I  V+    
Sbjct: 499 IGGSAIMVLTIDRPVSQDVLDQFVRLPEIVNVRALTL 535


>gi|159905466|ref|YP_001549128.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C6]
 gi|159886959|gb|ABX01896.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C6]
          Length = 523

 Score =  103 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 45/93 (48%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            +  F +I     D+     +  I + D  G+V  VG +LGE+GINIA   +GR +   H
Sbjct: 431 NEIVFREINGYRMDIKPEGTICIIKHIDRPGMVGKVGVLLGEHGINIAGMQVGRREPGGH 490

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +I FL +D  I + V+ ++     +R  K    
Sbjct: 491 SIMFLDVDHMISDDVMAEIMKIENVRAAKSINI 523


>gi|241762175|ref|ZP_04760258.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373425|gb|EER63025.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 527

 Score =  103 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R ++I  I  + ++   M+ IVN D  G +  +G +LG+ G+NI  FHLGR  
Sbjct: 430 LFGSEGTRLVEIFGIKVEANLSGDMLYIVNDDAPGFIGRLGTLLGKAGVNIGTFHLGRRN 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +    + K++    +R VK   F
Sbjct: 490 TGGEAVLLLSVDSPVTAGKMAKVAELSGVREVKSLHF 526


>gi|224417936|ref|ZP_03655942.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|253827274|ref|ZP_04870159.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|313141477|ref|ZP_07803670.1| d-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|253510680|gb|EES89339.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|313130508|gb|EFR48125.1| d-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
          Length = 527

 Score =  103 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++  P+ ++I     D+     MI   N D  G++ FVG  L ++ INIA F LGR  
Sbjct: 433 VFNENTPKIVEINHFELDIAPKGRMILFRNNDTPGVIGFVGTTLAKHNINIADFRLGRY- 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             + A++ + +D  + N V+++L+       +K  
Sbjct: 492 -GKEALAVILVDDEVSNEVIKELAGIEACLSIKYV 525


>gi|119491306|ref|ZP_01623360.1| D-3-phosphoglycerate dehydrogenase [Lyngbya sp. PCC 8106]
 gi|119453470|gb|EAW34632.1| D-3-phosphoglycerate dehydrogenase [Lyngbya sp. PCC 8106]
          Length = 527

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 41/92 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +    + R   I     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 LLGSSEMRITNIDGFPINVPPTHHMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  +   +L ++     IR  
Sbjct: 491 VRGEAVMVLSIDDPLPEGLLSEIMKVPGIRDA 522


>gi|77920705|ref|YP_358520.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
 gi|77546788|gb|ABA90350.1| D-3-phosphoglycerate dehydrogenase [Pelobacter carbinolicus DSM
           2380]
          Length = 535

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 50/95 (52%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G P+ +K+++ N D      M+ I  AD  G++  +G ILGE GINI   +LGR   + 
Sbjct: 435 EGIPKIVKMRDFNTDFQPEEHMLVISYADKPGLIGKIGTILGEAGINIGSMNLGRRAKSG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            A+  L +D      VLE+L+ ++   F++     
Sbjct: 495 EAMVVLSLDTPAPAEVLEQLATSIDAAFIRSIHME 529


>gi|260753763|ref|YP_003226656.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258553126|gb|ACV76072.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 527

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R ++I  I  + ++   M+ IVN D  G +  +G +LG+ G+NI  FHLGR  
Sbjct: 430 LFGSEGTRLVEIFGIKVEANLSGDMLYIVNDDAPGFIGRLGTLLGKAGVNIGTFHLGRRN 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +    + K++    +R VK   F
Sbjct: 490 TGGEAVLLLSVDSPVTAGKMAKVAELSGVREVKSLHF 526


>gi|291279254|ref|YP_003496089.1| D-3-phosphoglycerate dehydrogenase [Deferribacter desulfuricans
           SSM1]
 gi|290753956|dbj|BAI80333.1| D-3-phosphoglycerate dehydrogenase [Deferribacter desulfuricans
           SSM1]
          Length = 540

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R +   +   D+      +   N D  G++  VG ILGE  INIA F L R  
Sbjct: 445 VFNNKEGRIVLFDDFRIDIIPEGTFLYFRNIDRPGVIGKVGTILGENNINIAGFELARQ- 503

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+F+ +D  I  SVL ++     +  V   E 
Sbjct: 504 KGGEAIAFVSVDNEIPESVLSEIKKIDGMLEVNLVEL 540


>gi|312137068|ref|YP_004004405.1| d-3-phosphoglycerate dehydrogenase [Methanothermus fervidus DSM
           2088]
 gi|311224787|gb|ADP77643.1| D-3-phosphoglycerate dehydrogenase [Methanothermus fervidus DSM
           2088]
          Length = 526

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 41/88 (46%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            KP+ I I     DV+    M+ +   D+ G +  +G  LGE+ INIA   +GR +    
Sbjct: 432 NKPKIININGYKVDVEPKGNMMIVKYRDLPGTIGAIGTKLGEHDINIAIMQVGREKPGGE 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFV 92
           A+  L +D  +   VLE++     +   
Sbjct: 492 AVMVLKVDQKVPEDVLEEVKSLKNVEDA 519


>gi|218133785|ref|ZP_03462589.1| hypothetical protein BACPEC_01673 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991160|gb|EEC57166.1| hypothetical protein BACPEC_01673 [Bacteroides pectinophilus ATCC
           43243]
          Length = 223

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 34/96 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
              +    +I  I+ +       + + N D  G V  V ++L   G+NIA   L RS   
Sbjct: 128 GGARINIAQIDGIDTNFSGDYPTLVVHNLDQPGHVAEVTSMLSHKGVNIATMQLYRSNRG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
             A+  L  D  I    +  L     ++ V      
Sbjct: 188 GEAVMVLECDQEIPEDGIRWLEKVEGVKKVTYLSIE 223


>gi|16127445|ref|NP_422009.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 gi|221236257|ref|YP_002518694.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
 gi|13424897|gb|AAK25177.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 gi|220965430|gb|ACL96786.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
          Length = 526

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 49/93 (52%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G PR ++++ +  D      M+ + N D  G +  +G +LGE G+NIA F+LGR  + E 
Sbjct: 434 GAPRIVEVKGMELDAAFSPAMLYVNNLDKPGFIGALGMLLGEAGVNIATFNLGRVSADED 493

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI+ + +D +    +L K+     ++  +   F
Sbjct: 494 AIALVGVDQAPDAGLLAKIQALPHVKEARALTF 526


>gi|117924723|ref|YP_865340.1| D-3-phosphoglycerate dehydrogenase [Magnetococcus sp. MC-1]
 gi|117608479|gb|ABK43934.1| D-3-phosphoglycerate dehydrogenase [Magnetococcus sp. MC-1]
          Length = 527

 Score =  103 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 32/97 (32%), Positives = 56/97 (57%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+  +PR I + EI  +     L++ + N D  G++  VG +LGE G+NI+ FHLGR Q
Sbjct: 431 LFNGTEPRLISMDEIPIEAQPEGLLLFVANDDTPGLIGRVGTLLGEAGVNISSFHLGREQ 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   AI+F+ +D  +   ++++L     +R VK   +
Sbjct: 491 AGGRAIAFINVDSEVPAPLMQQLHETANVREVKLIRY 527


>gi|148263798|ref|YP_001230504.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
 gi|146397298|gb|ABQ25931.1| D-3-phosphoglycerate dehydrogenase [Geobacter uraniireducens Rf4]
          Length = 541

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 49/94 (52%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G PR +++++ + D      M+ +   D  G++  +G I+G + INIA  +LGR +   
Sbjct: 436 EGAPRIVRLRDYSMDFAPAEHMLLLNYEDRPGMIGKIGTIMGAHSINIASMNLGRREEKG 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++   V+E++ +     F++    
Sbjct: 496 EAMVILSLDSAVPLEVMEEVRIATEATFIRAIHM 529


>gi|308067179|ref|YP_003868784.1| Probable L-serine dehydratase, beta chain (L-serine deaminase)
           [Paenibacillus polymyxa E681]
 gi|305856458|gb|ADM68246.1| Probable L-serine dehydratase, beta chain (L-serine deaminase)
           [Paenibacillus polymyxa E681]
          Length = 229

 Score =  103 bits (259), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 17/95 (17%), Positives = 39/95 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++ E   ++      + ++++D  G +  + + LG   INIA+ H+ R    
Sbjct: 126 GGGSIHVQQLNEFRVNLTGELPTLVLLHSDKPGTLGAITSALGAAHINIAYMHVDRKGRD 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A++ +  D S    ++ +L     +  +K    
Sbjct: 186 GEALTAIETDSSAPAELIAELRSLPHMYEIKMINL 220


>gi|158334453|ref|YP_001515625.1| D-3-phosphoglycerate dehydrogenase [Acaryochloris marina MBIC11017]
 gi|158304694|gb|ABW26311.1| D-3-phosphoglycerate dehydrogenase [Acaryochloris marina MBIC11017]
          Length = 527

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  + + R   I +   +V   R M+  V+ D+ GI+  +G+ LG + +NIA   +GR  
Sbjct: 430 ILGEDELRITNIDDFPINVVPTRHMLLTVHRDMPGIIGQIGSQLGSFNVNIASMQVGRKM 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  +   VL +++    IR       
Sbjct: 490 VRGSAVMVLSLDDPLPEGVLSEITNVEGIRDAYIVNL 526


>gi|134046847|ref|YP_001098332.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C5]
 gi|132664472|gb|ABO36118.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C5]
          Length = 523

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 46/93 (49%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            +  F +I     D+     +  I + D  G+V  VG +LGE+GINIA   +GR +   H
Sbjct: 431 NEIVFREINGYRMDIKPEGTICIIKHIDRPGMVGKVGVLLGEHGINIAGMQVGRREPGGH 490

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +I FL +D  I + V+ +++    +R  K    
Sbjct: 491 SIMFLDVDHMISDEVMAEITKMENVRAAKSINI 523


>gi|312128646|ref|YP_003993520.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778665|gb|ADQ08151.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 531

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 43/89 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I       D    + M+ I N D  G++  +G I+GEY INIA   + R++  E
Sbjct: 438 NNEGRIIDFFGYKVDFKPEKYMLLIQNIDKPGMIGKIGTIVGEYDINIAQMQVSRNKKGE 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            A+    +DG + N  +EKL     I  V
Sbjct: 498 KAVMVCEVDGIVPNEAIEKLKNTDGILRV 526


>gi|297568578|ref|YP_003689922.1| D-3-phosphoglycerate dehydrogenase [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924493|gb|ADH85303.1| D-3-phosphoglycerate dehydrogenase [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 528

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 43/97 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   +PR ++      +      M+ + N D+ G++  + + +G+ G+NIA   +GR Q
Sbjct: 431 VFGKKEPRLVRFNTFRLEALPEGPMLFVHNNDVPGVIGKLASTIGDAGVNIARMTVGREQ 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            +   I  L  D  +   +L+K+     I      + 
Sbjct: 491 DSGRNIILLNTDSLLDRELLKKVKALDNIHDAMVLDL 527


>gi|153005366|ref|YP_001379691.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. Fw109-5]
 gi|152028939|gb|ABS26707.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. Fw109-5]
          Length = 528

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 40/95 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V+   + R +++     +      ++   N D  G+V  +G  L   G+NIA   L R +
Sbjct: 432 VYGKREARVVRVNAFRVEAVPDGNVLLCENDDAPGVVGNLGTTLAAAGVNIAQISLSRLE 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
               A +FL +D      +LEK+     +R  +  
Sbjct: 492 DRSGAFAFLNVDSPPSAELLEKVRKLPHVRSARAI 526


>gi|225028928|ref|ZP_03718120.1| hypothetical protein EUBHAL_03217 [Eubacterium hallii DSM 3353]
 gi|224953767|gb|EEG34976.1| hypothetical protein EUBHAL_03217 [Eubacterium hallii DSM 3353]
          Length = 222

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 33/93 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    +I  I  +       + + N D  G V  V ++L   G+NIA   L RS   
Sbjct: 124 GGGRINIAEIDGIETNFSGENPTLIVHNLDQPGHVSEVTSMLAHKGVNIATMQLYRSSKG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  +  D  +    +  L     +  V   
Sbjct: 184 GKAVMVVECDQEVPQEGIRWLERVEGVLKVTYL 216


>gi|220928617|ref|YP_002505526.1| D-3-phosphoglycerate dehydrogenase [Clostridium cellulolyticum H10]
 gi|219998945|gb|ACL75546.1| D-3-phosphoglycerate dehydrogenase [Clostridium cellulolyticum H10]
          Length = 535

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+  + R +       D +    ++ I N D+ GI+  +G ILG   INIA     R+ 
Sbjct: 439 VFAIQEIRVVDFFGYKLDFEPTPYVLAIQNVDVPGIIGQIGTILGASDINIAAMQWSRNH 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E A++F+ +D  +  +VLE L     +  V   +F
Sbjct: 499 KGEKAVAFVSVDCEVPANVLELLKKINGVLKVTLLKF 535


>gi|56552581|ref|YP_163420.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56544155|gb|AAV90309.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 527

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R ++I  I  + ++   M+ IVN D  G +  +G +LG+ G+NI  FHLGR  
Sbjct: 430 LFGSEGTRLVEIFGIKIEANLSGDMLYIVNDDAPGFIGRLGTLLGKAGVNIGTFHLGRRN 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +D  +    + K++    +R VK   F
Sbjct: 490 TGGEAVLLLSVDSPVTAGKMAKVAELSGVREVKSLHF 526


>gi|222445984|ref|ZP_03608499.1| hypothetical protein METSMIALI_01632 [Methanobrevibacter smithii
           DSM 2375]
 gi|261349477|ref|ZP_05974894.1| phosphoglycerate dehydrogenase [Methanobrevibacter smithii DSM
           2374]
 gi|222435549|gb|EEE42714.1| hypothetical protein METSMIALI_01632 [Methanobrevibacter smithii
           DSM 2375]
 gi|288861840|gb|EFC94138.1| phosphoglycerate dehydrogenase [Methanobrevibacter smithii DSM
           2374]
          Length = 524

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 26/92 (28%), Positives = 40/92 (43%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
            P+ +K+ +   DV     M      D+ G +  +G  LGEYGINI    +GR +    A
Sbjct: 433 DPKILKVNDYWVDVKPEGHMFIAKYEDVPGSIGKIGTALGEYGINIGIMQVGRDEKGGRA 492

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           I  L +D  I   V++K+     +      E 
Sbjct: 493 IMILTLDKEIPKEVIKKIQDLDNVYDAIGLEL 524


>gi|124026487|ref|YP_001015602.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL1A]
 gi|123961555|gb|ABM76338.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. NATL1A]
          Length = 528

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DG      I E   +    R M+   + D+ GI+  +G++LG+Y +NIA   +GR  
Sbjct: 432 VFGDGDLGITSIDEYPINFVPSRHMLFTRHRDMPGIIGQIGSLLGKYNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I + +L  +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPSELLGSILSMQGINEAHSVTL 528


>gi|159031923|dbj|BAF91727.1| 3-phosphoglycerate dehydrogenase [Aphanothece halophytica]
          Length = 526

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SD + R   +     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLSDQEMRITNVDGFPINVPPNNYMLFTLHRDMPGIIGKIGSLLGGFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  +   VL+++     IR     + 
Sbjct: 490 VRGDAVMVLSIDDPLPEGVLDEIMKVPGIRDAYTIKL 526


>gi|290967984|ref|ZP_06559533.1| phosphoglycerate dehydrogenase [Megasphaera genomosp. type_1 str.
           28L]
 gi|290781890|gb|EFD94469.1| phosphoglycerate dehydrogenase [Megasphaera genomosp. type_1 str.
           28L]
          Length = 530

 Score =  103 bits (258), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 40/96 (41%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+  +P+ ++I     D      ++   + D   ++  +  +LG+ GINI    +GR  
Sbjct: 431 LFNKKEPKIVQIDSCRVDFTPEGYLLLAPHRDEPNMIGQISTVLGQAGINITSMQVGRMN 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
                I  + +   I N ++ KL     I  +K   
Sbjct: 491 EDGTNIMAIAVAEDIPNDIMLKLRAIDGILDMKLIH 526


>gi|72382765|ref|YP_292120.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL2A]
 gi|72002615|gb|AAZ58417.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL2A]
          Length = 528

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF DG      I E   +    R M+   + D+ GI+  +G++LG+Y +NIA   +GR  
Sbjct: 432 VFGDGDLGITSIDEYPINFVPSRHMLFTRHRDMPGIIGQIGSLLGKYNVNIASMQVGRRI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  I + +L  +     I        
Sbjct: 492 VRGEAVMVLSIDDPIPSELLGSILSMQGINEAHSVTL 528


>gi|295688138|ref|YP_003591831.1| D-3-phosphoglycerate dehydrogenase [Caulobacter segnis ATCC 21756]
 gi|295430041|gb|ADG09213.1| D-3-phosphoglycerate dehydrogenase [Caulobacter segnis ATCC 21756]
          Length = 526

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 49/93 (52%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G PR ++++ +  D      M+ I N D  G +  +G +LGE G+NIA F+LGR  + E 
Sbjct: 434 GAPRIVEVKGMELDAAFSPAMLYINNLDKPGFIGALGMMLGEAGVNIATFNLGRLAADED 493

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI+ + +D +    +L K+     ++  +   F
Sbjct: 494 AIALVGVDQAPSADLLAKIEALPHVKESRALTF 526


>gi|168700983|ref|ZP_02733260.1| phosphoglycerate dehydrogenase [Gemmata obscuriglobus UQM 2246]
          Length = 539

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F D   R +++     +  +  +++   + D+ G++ FVG I G++ +NIA   +GR+ 
Sbjct: 432 LFGDQYVRLVQLGPFRMEGYLDGVLLVFRHHDVPGLIGFVGTIFGKHKVNIAQMTVGRTS 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  L +D    +  + ++  +  I  V   + 
Sbjct: 492 PGGEAIGILNLDNWPSDEAVAEVKAHPQISSVTVVKL 528


>gi|124514290|gb|EAY55804.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum rubarum]
          Length = 535

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF     R + + ++  +V    +MI ++N D  G+V  VG +LG + +NI+    GR  
Sbjct: 434 VFQRKDYRIVSLDDLPVEVVPEPIMIYLINQDQPGVVGSVGTVLGTHKVNISRMQFGRDF 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+S + +D +I   +LE+L     +  +K    
Sbjct: 494 PGGKAVSMIGVDQNIDAKLLEELRALPNVLSLKVLHL 530


>gi|91202994|emb|CAJ72633.1| similar to D-3-phosphoglycerate dehydrogenase (PGDH) [Candidatus
           Kuenenia stuttgartiensis]
          Length = 535

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 40/97 (41%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   +PR + I     +  +   ++ +   D  G +  VG++LG   INIAH   GR +
Sbjct: 439 VFGKNEPRLVDINGYGVEAILNEQILVLFGRDKPGFIGQVGSLLGNKNINIAHMTFGRKE 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              + IS L ID       L ++     I      + 
Sbjct: 499 VGGNTISILNIDAVPPQDCLNEIKQLNHIDAAFLVQL 535


>gi|220908749|ref|YP_002484060.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7425]
 gi|219865360|gb|ACL45699.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7425]
          Length = 652

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +    + R   I +   +V   R M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 556 LLGADELRITDIDDFPINVPPTRHMLLTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKM 615

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A+  L +D  +   +L +++    IR       
Sbjct: 616 VRGNAVMVLSLDDPLPEGLLTEITKVSGIRDAYIVNL 652


>gi|311068824|ref|YP_003973747.1| D-3-phosphoglycerate dehydrogenase [Bacillus atrophaeus 1942]
 gi|310869341|gb|ADP32816.1| D-3-phosphoglycerate dehydrogenase [Bacillus atrophaeus 1942]
          Length = 525

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 3/96 (3%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F +   R +++   N D      ++ I + D  G++  VG ILG+  INIA   +GR + 
Sbjct: 432 FGE---RIVELNGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEK 488

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              AI  L  D  +   V+ +LS    I  VK  + 
Sbjct: 489 GGEAIMMLSFDRHLEEKVVNELSDVADIVSVKLIDL 524


>gi|121533529|ref|ZP_01665357.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermosinus carboxydivorans Nor1]
 gi|121308088|gb|EAX49002.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermosinus carboxydivorans Nor1]
          Length = 219

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 34/90 (37%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I     ++      +  V+ D  G++  V ++L + G+NIA   + R +  
Sbjct: 124 GGGNIVITEIDGYAVELTGEYYTLITVHRDKPGVIALVTHVLAQEGVNIAFMRVSRQERG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  L  D  I    L  +     ++  
Sbjct: 184 AQALMILEADQPIPEHALAAVRHVPAVQTA 213


>gi|67920676|ref|ZP_00514196.1| D-3-phosphoglycerate dehydrogenase [Crocosphaera watsonii WH 8501]
 gi|67858160|gb|EAM53399.1| D-3-phosphoglycerate dehydrogenase [Crocosphaera watsonii WH 8501]
          Length = 525

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+ R   +     +V     M+  V+ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGEIRITDVDGFPINVPPSNYMLFTVHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    IR  
Sbjct: 489 VRGDAVMALSLDDPLPEGLLNEITKVDGIRDA 520


>gi|156740285|ref|YP_001430414.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus castenholzii DSM
           13941]
 gi|156231613|gb|ABU56396.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus castenholzii DSM
           13941]
          Length = 524

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 38/93 (40%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+P  ++             M+   + D  G++  VG +LGE  +NIA   +GR    E 
Sbjct: 432 GEPHVVEADGFWVTFVPAGPMLFTYHRDRPGMIGKVGTLLGEADVNIASMDVGRLAPREQ 491

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           A+  L +D  +   V+ +L     I+       
Sbjct: 492 AMMVLRLDDPVPPHVIARLREEPDIQHATTLII 524


>gi|237752566|ref|ZP_04583046.1| d-3-phosphoglycerate dehydrogenase [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376055|gb|EEO26146.1| d-3-phosphoglycerate dehydrogenase [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 527

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++  P+ + I     D++    MI   N D  G++ FVG  L ++ INIA F LGR  
Sbjct: 433 VFNENTPKIVNINNFALDIEPKGKMILFRNDDTPGVIGFVGTTLAKHNINIADFRLGRY- 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
             + A++ + +D +I  SVL++L+       +K 
Sbjct: 492 -GKEALALIIVDDAISQSVLDELASLEACISIKY 524


>gi|167648422|ref|YP_001686085.1| D-3-phosphoglycerate dehydrogenase [Caulobacter sp. K31]
 gi|167350852|gb|ABZ73587.1| D-3-phosphoglycerate dehydrogenase [Caulobacter sp. K31]
          Length = 526

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 50/93 (53%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G PR ++++ +  D      M+ I N D  G +  +G +LGE G+NIA F+LGR  + E 
Sbjct: 434 GAPRMVEVKGMELDAGFAPAMLYINNLDKPGFIGALGMLLGEAGVNIATFNLGRLSADED 493

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI+ + +D +   ++L K+     ++  +   F
Sbjct: 494 AIALVGVDQAPDEALLAKIQALPHVKEARALTF 526


>gi|298706859|emb|CBJ25823.1| Phosphoglycerate dehydrogenase / Phosphoserine aminotransferase
           [Ectocarpus siliculosus]
          Length = 965

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 45/95 (47%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
               R + +  +  D +    M+   N D  G++  V  ILG+ GINIA F LGR ++  
Sbjct: 476 GTDTRVVDVDGLEIDFNPSGHMLMFNNPDSPGMLRAVAAILGDQGINIASFALGRVRTGG 535

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            A+S L +D      +LE++     IR V Q   +
Sbjct: 536 VAMSCLNLDTPCTEGMLEEIRKIPDIRNVVQASID 570


>gi|294501109|ref|YP_003564809.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium QM B1551]
 gi|294351046|gb|ADE71375.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium QM B1551]
          Length = 524

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 45/95 (47%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +   PR I I   + D      ++ I ++D  G++  VG +LG+  INIA   +GR Q  
Sbjct: 430 AGYGPRIINIDSFDIDFYPEGHLLYIRHSDQPGVIGNVGKVLGDLRINIATMQVGRKQKG 489

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             AI  L  D  + +SV+  L     I  +++ E 
Sbjct: 490 GEAIMMLTFDKLLDDSVISSLKQTSEIVTIQRIEL 524


>gi|206602883|gb|EDZ39364.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum sp. Group II
           '5-way CG']
          Length = 535

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 48/97 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF     R + + ++  +V    +MI ++N D  G+V  VG +LG + +NI+    GR  
Sbjct: 434 VFQRKDYRIVSLDDLPVEVVPEPIMIYLINQDQPGVVGSVGTVLGTHKVNISRMQFGRDF 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+S + +D +I + +LE+L     +  +K    
Sbjct: 494 PGGKAVSMIGVDQNIDSKLLEELRALPNVLSLKVLHL 530


>gi|126179793|ref|YP_001047758.1| D-3-phosphoglycerate dehydrogenase [Methanoculleus marisnigri JR1]
 gi|125862587|gb|ABN57776.1| D-3-phosphoglycerate dehydrogenase [Methanoculleus marisnigri JR1]
          Length = 527

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 41/97 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V    + R + I     D+     ++   + D  G++     ILG   +NIA   +GR++
Sbjct: 431 VSGPNRARIVSIGGYMTDLTPTGHVVISRHTDKPGVIGKAATILGSVNVNIAGMQVGRNK 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E A+  L +D ++    ++++     I   K  E 
Sbjct: 491 PGEEALMVLTVDSAVPADAMDEIKKIDGIHTAKHAEI 527


>gi|292657076|ref|YP_003536973.1| D-3-phosphoglycerate dehydrogenase [Haloferax volcanii DS2]
 gi|291370333|gb|ADE02560.1| D-3-phosphoglycerate dehydrogenase [Haloferax volcanii DS2]
          Length = 525

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 1/98 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+   PR ++I     D      M+   N D  G++ F+G +LGE  +NIA     R  
Sbjct: 428 LFTGEDPRIVRINGYRLDAIPYGQMLVARNYDKPGVIGFIGTVLGENDVNIAGMFNARRA 487

Query: 61  S-TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                A++   +D  +  SV EKL  +  I  V     
Sbjct: 488 KAGGEALTVYNLDDDVPESVREKLLADARIIDVDLITL 525


>gi|319956089|ref|YP_004167352.1| d-3-phosphoglycerate dehydrogenase [Nitratifractor salsuginis DSM
           16511]
 gi|319418493|gb|ADV45603.1| D-3-phosphoglycerate dehydrogenase [Nitratifractor salsuginis DSM
           16511]
          Length = 530

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +G  R + I     D++    MI   N D  G++  VG I+ E G+NI  F LGR  
Sbjct: 435 VFEEGIQRIVDIDGYTLDLEPKGRMILFKNNDEPGVIGDVGRIIAENGLNIGDFRLGRDS 494

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A++ + +DG I   ++++L+       VK    
Sbjct: 495 N-GQALAVVRVDGEIPKKLIDELAALPACISVKAVSL 530


>gi|291534471|emb|CBL07583.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Roseburia intestinalis M50/1]
 gi|291541312|emb|CBL14423.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Roseburia intestinalis XB6B4]
          Length = 221

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 33/92 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ +  ++  I  +       + + N D  G V  V ++L   G+NIA   L R    
Sbjct: 124 GGGRIQICELDGITANFSGDYPTLIVHNIDQPGHVTEVTSMLAHKGVNIATMQLYRKSRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
             A+  +  D  +    L  L     I  V  
Sbjct: 184 GSAVMVIECDQEVPKESLAWLERLEGILKVTY 215


>gi|303239457|ref|ZP_07325984.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Acetivibrio cellulolyticus CD2]
 gi|302593020|gb|EFL62741.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Acetivibrio cellulolyticus CD2]
          Length = 224

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 38/98 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  +I  ++ ++      + + N D  G V  V ++LG   +NIA   L R +  
Sbjct: 124 GGGTIKICQIDGLHANICATYPTLIVHNMDQPGHVSEVTSMLGHKSVNIAAMQLYRDKRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            +A+  +  D  +    L+ L     +  V       D
Sbjct: 184 GNAVMVIECDQEVPLESLDWLRKLEGVVKVTYLSLEED 221


>gi|88604291|ref|YP_504469.1| D-3-phosphoglycerate dehydrogenase [Methanospirillum hungatei JF-1]
 gi|88189753|gb|ABD42750.1| D-3-phosphoglycerate dehydrogenase [Methanospirillum hungatei JF-1]
          Length = 528

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 41/97 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V   G  R + I     D+     +I   + D  G++     ILGE+ INIA   +GR Q
Sbjct: 432 VLYKGGARIVSIAGYTMDMVPEGAVIISRHLDRPGVIGRASTILGEHQINIAGMQVGRFQ 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E AI  L +DG +   V+E +     I   K    
Sbjct: 492 PGEEAIMVLNVDGDVPEEVMEAIRGMPGIYSAKFARI 528


>gi|251771412|gb|EES51991.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum
           ferrodiazotrophum]
          Length = 537

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R + +  +  +V    +M+ + N D  G+V  VG++LG +GINI+    GR  
Sbjct: 436 IFQKKDFRIVSLDSLPVEVVPDPIMLYLTNQDQPGVVGLVGSLLGSHGINISRMQFGRDF 495

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+S + +D     +VLE++  N  I  +K    
Sbjct: 496 PGGKAVSMIGVDSEPPAAVLEEIRKNPKIIALKLLRL 532


>gi|289523971|ref|ZP_06440825.1| phosphoglycerate dehydrogenase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289502627|gb|EFD23791.1| phosphoglycerate dehydrogenase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 544

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 49/97 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +GK R + + +   D      ++   N D  G++  +G +LG+YG+NIA+F LGR  
Sbjct: 445 VTEEGKKRIVGVDDYEIDFVPEGWVLLFSNHDRPGVIGKIGTLLGDYGVNIANFALGRKN 504

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            +  AI+ L +D SI    +EK+  +  + +      
Sbjct: 505 GSGLAIAALQLDSSIPKEAMEKIQKDADLIWAHLINL 541


>gi|153952246|ref|YP_001398036.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939692|gb|ABS44433.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 527

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKIDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDS 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VL++L       FV+  E 
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVEI 527


>gi|57167923|ref|ZP_00367063.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
 gi|57021045|gb|EAL57709.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
          Length = 527

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFQTDFKPKGKMIIFKNKDIPGVIAKISSVLASKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VLE+L       FV+  E 
Sbjct: 492 F-GYALAVVLIDEKVQKEVLEELRQLEACIFVQYVEI 527


>gi|269838299|ref|YP_003320527.1| D-3-phosphoglycerate dehydrogenase [Sphaerobacter thermophilus DSM
           20745]
 gi|269787562|gb|ACZ39705.1| D-3-phosphoglycerate dehydrogenase [Sphaerobacter thermophilus DSM
           20745]
          Length = 737

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 38/89 (42%)

Query: 9   FIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISF 68
            ++I   + +  +   ++   + D  G+V  VG ILG Y +NIA   +GR +    AI  
Sbjct: 629 IMEIDRFSLERPLAGDLLITRHWDRPGVVGRVGTILGRYNVNIAGMQVGRHERGGQAIMV 688

Query: 69  LCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           L +D  I  + L ++     I        
Sbjct: 689 LNVDDIIPEAALAEIVTIPGIESAYVVSL 717


>gi|294678963|ref|YP_003579578.1| phosphoglycerate dehydrogenase [Rhodobacter capsulatus SB 1003]
 gi|294477783|gb|ADE87171.1| phosphoglycerate dehydrogenase [Rhodobacter capsulatus SB 1003]
          Length = 531

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/98 (40%), Positives = 62/98 (63%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           FSDGKPRFI+I+ IN D ++GR M+   N D+ GI+  +G +LGE  +N+A+F LGR+ +
Sbjct: 433 FSDGKPRFIQIKGINVDAEVGRHMLYTTNKDVPGIIGKLGTLLGENKVNLANFTLGRAAA 492

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
              AI+   +D ++   V+ +L      + VK  EFN+
Sbjct: 493 GGEAIAIAYLDEALDAKVVSELEATGLFQQVKPLEFNI 530


>gi|330839849|ref|YP_004414429.1| D-3-phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC
           35185]
 gi|329747613|gb|AEC00970.1| D-3-phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC
           35185]
          Length = 527

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 44/95 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R + I     DVD    ++   + +  G++  VG ++GE G+NI+   +GR+    
Sbjct: 431 GTEGRIVSINGYRVDVDPHDRILICPHINRPGVIGTVGTMMGERGVNISSMQVGRTDKEG 490

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
             +  L +D  I   +L++++    I   +   F+
Sbjct: 491 TNVMVLTVDHDIPEDLLQQITAVDGIFGARLVNFH 525


>gi|297619680|ref|YP_003707785.1| D-3-phosphoglycerate dehydrogenase [Methanococcus voltae A3]
 gi|297378657|gb|ADI36812.1| D-3-phosphoglycerate dehydrogenase [Methanococcus voltae A3]
          Length = 525

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 47/94 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG+  F KI   + DV     +  I + D  G+V  VG +LGEYGINIA   +GR +   
Sbjct: 432 DGEVVFRKINGYDIDVKPEGDLCVIRHIDRPGMVGKVGVLLGEYGINIAKMQVGRKEPGG 491

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           H+I  L +D +I   V+ KL     +R  K    
Sbjct: 492 HSIMILDVDHTISEDVMSKLKEMDNVRTAKMVTL 525


>gi|126657695|ref|ZP_01728849.1| phosphoglycerate dehydrogenase [Cyanothece sp. CCY0110]
 gi|126620912|gb|EAZ91627.1| phosphoglycerate dehydrogenase [Cyanothece sp. CCY0110]
          Length = 525

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+ R   +     +V     M+  V+ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGEIRITDVDGFPINVPPSNYMLFTVHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    IR  
Sbjct: 489 VRGDAVMALSLDDPLPEGLLTEITKVSGIRDA 520


>gi|260888757|ref|ZP_05900020.1| phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC 35185]
 gi|260861510|gb|EEX76010.1| phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC 35185]
          Length = 529

 Score =  102 bits (254), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 44/95 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R + I     DVD    ++   + +  G++  VG ++GE G+NI+   +GR+    
Sbjct: 433 GTEGRIVSINGYRVDVDPHDRILICPHINRPGVIGTVGTMMGERGVNISSMQVGRTDKEG 492

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
             +  L +D  I   +L++++    I   +   F+
Sbjct: 493 TNVMVLTVDHDIPEDLLQQITAVDGIFGARLVNFH 527


>gi|196247676|ref|ZP_03146378.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Geobacillus sp. G11MC16]
 gi|196212460|gb|EDY07217.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Geobacillus sp. G11MC16]
          Length = 220

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 42/93 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++   +  +      + I++ D  G +  V + L ++ INI H  + R +  
Sbjct: 126 GGGKIEIIELNGFDLKLSGHHPALLIMHNDRYGTIGAVASTLAKHAINIGHMEVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A+  + +D  + + ++++L     I  V + 
Sbjct: 186 KEALMTIEVDQPLSDDLIQELEQLPNIIQVTKL 218


>gi|305432051|ref|ZP_07401218.1| phosphoglycerate dehydrogenase [Campylobacter coli JV20]
 gi|304445135|gb|EFM37781.1| phosphoglycerate dehydrogenase [Campylobacter coli JV20]
          Length = 527

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFQTDFKPKGKMIIFKNKDIPGVIAKISSVLASKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VLE+L       FV+  E 
Sbjct: 492 F-GYALAVVLIDEKVQKEVLEELRQLEACIFVQYVEI 527


>gi|240145234|ref|ZP_04743835.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Roseburia intestinalis L1-82]
 gi|257202698|gb|EEV00983.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Roseburia intestinalis L1-82]
          Length = 221

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 32/92 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ +  ++  I  +       + + N D  G V  V ++    G+NIA   L R    
Sbjct: 124 GGGRIQICELDGITANFSGDYPTLIVHNIDQPGHVTEVTSMFAHKGVNIATMQLYRKSRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
             A+  +  D  +    L  L     I  V  
Sbjct: 184 GSAVMVIECDQEVPKESLAWLERLEGILKVTY 215


>gi|296109202|ref|YP_003616151.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus infernus ME]
 gi|295434016|gb|ADG13187.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus infernus ME]
          Length = 523

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 49/95 (51%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           S+ KP  ++I+    +     +++ I + D  G++  VG ILGEYGINIA   +GR +  
Sbjct: 429 SNNKPIILEIEGYEVNFIPESVVLIIRHIDKPGMIGKVGTILGEYGINIAEMQVGRKEPG 488

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             ++  + +D ++   VL+K+     I+     + 
Sbjct: 489 GDSVMLIKLDHNVPEEVLKKIKEIENIKDAVVVKL 523


>gi|138894704|ref|YP_001125157.1| L-serine dehydratase subunit beta [Geobacillus thermodenitrificans
           NG80-2]
 gi|134266217|gb|ABO66412.1| L-serine dehydratase (beta chain) [Geobacillus thermodenitrificans
           NG80-2]
          Length = 220

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 42/93 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++   +  +      + I++ D  G +  V + L ++ INI H  + R +  
Sbjct: 126 GGGKIEIIELNGFDLKLSGHHPALLIMHNDRYGTIGAVASTLAKHAINIGHMEVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A+  + +D  + + ++++L     I  V + 
Sbjct: 186 KEALMTIEVDQPLSDDLIQELEQLPNIIQVTKL 218


>gi|15669207|ref|NP_248012.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus jannaschii
           DSM 2661]
 gi|3122874|sp|Q58424|SERA_METJA RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|1591676|gb|AAB99020.1| phosphoglycerate dehydrogenase (serA) [Methanocaldococcus
           jannaschii DSM 2661]
          Length = 524

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 42/94 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + KP  +++           ++  I + D  G +  V   LG+YGINIA   +GR +   
Sbjct: 431 NNKPVILEVDGYEVSFIPEGVLAIIKHIDRPGTIGRVCITLGDYGINIASMQVGRKEPGG 490

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            ++  L +D ++   V+EK+     I+ V     
Sbjct: 491 ESVMLLNLDHTVPEEVIEKIKEIPNIKDVAVINL 524


>gi|163845877|ref|YP_001633921.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222523594|ref|YP_002568064.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus sp. Y-400-fl]
 gi|163667166|gb|ABY33532.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222447473|gb|ACM51739.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus sp. Y-400-fl]
          Length = 525

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 42/93 (45%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+P  +++     D      ++   + D  G++  VG +LG   +NI+  ++GR    E 
Sbjct: 433 GEPHIVQMDGYFVDFVPQGSLLITYHHDQPGMIGKVGQLLGAADVNISGMYVGRRAPRER 492

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           A+  L +D      V+E+++    I+     E 
Sbjct: 493 AVMVLTLDEPAPPQVMEQIATIPGIQAAFSVEL 525


>gi|325290387|ref|YP_004266568.1| D-3-phosphoglycerate dehydrogenase [Syntrophobotulus glycolicus DSM
           8271]
 gi|324965788|gb|ADY56567.1| D-3-phosphoglycerate dehydrogenase [Syntrophobotulus glycolicus DSM
           8271]
          Length = 527

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 50/99 (50%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   + R ++I +   D+D    +I I + D  G+V  VG ILGEY INI    + +++
Sbjct: 429 LFGKKEGRIVQIDKHRVDIDPQGWLIIIPHEDYPGMVGKVGTILGEYSININSMQVEKTE 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
                I  + +   I + V+ K+     I+ VK+  F++
Sbjct: 489 DIGMNIMIVGVQSDIGSEVMNKIKQLNGIQNVKKVYFDL 527


>gi|172037049|ref|YP_001803550.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. ATCC 51142]
 gi|171698503|gb|ACB51484.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. ATCC 51142]
          Length = 525

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+ R   +     +V     M+  V+ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGEIRITDVDGFPINVPPSNYMLFTVHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    IR  
Sbjct: 489 VRGDAVMALSLDDPLPEGLLTEITKVSGIRDA 520


>gi|296123070|ref|YP_003630848.1| D-3-phosphoglycerate dehydrogenase [Planctomyces limnophilus DSM
           3776]
 gi|296015410|gb|ADG68649.1| D-3-phosphoglycerate dehydrogenase [Planctomyces limnophilus DSM
           3776]
          Length = 546

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 44/99 (44%), Gaps = 2/99 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLG--R 58
           +F     R +++ + + D  +   ++   + D  G++  +G   G++ +NIAH  +G  R
Sbjct: 433 IFGRQFLRLVRVNQFHLDAYLDGTLLLYRHIDRPGVIGTIGTACGQHNVNIAHMAVGRER 492

Query: 59  SQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           ++    A++ L +D       L  +  N  +  V+    
Sbjct: 493 NEPGGEALAILNLDNEPSAEALAAVQANPAVTSVQLLRL 531


>gi|78044395|ref|YP_361252.1| iron-sulfur-dependent L-serine dehydratase subunit beta
           [Carboxydothermus hydrogenoformans Z-2901]
 gi|77996510|gb|ABB15409.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 218

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 32/87 (36%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      I      +      + + +AD  G V  V ++L  +GINIA   + R Q  
Sbjct: 123 GGGAVLITGINGYPVKITAKYPTLVVPHADRPGAVAKVTSVLAWHGINIAQMSVSRQQKG 182

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTI 89
             A+  +  D  +    L ++     I
Sbjct: 183 AEALMVIETDQPVDEETLWEIKRLPGI 209


>gi|304437357|ref|ZP_07397316.1| phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369613|gb|EFM23279.1| phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 563

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 1/98 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + + R ++I     DVD    ++   + +  G++  +G+I+G  GINI+   +G+S 
Sbjct: 465 LFGE-EGRIVRINRFRVDVDPHARILICPHINRPGVIGTIGSIMGAAGINISSMQVGKSD 523

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
                I  L ID  I + VL ++     I   K   F+
Sbjct: 524 RKGMNIMVLTIDHDISDDVLARVLAVEGIFDAKLVNFD 561


>gi|147920120|ref|YP_686117.1| D-3-phosphoglycerate dehydrogenase [uncultured methanogenic
           archaeon RC-I]
 gi|110621513|emb|CAJ36791.1| D-3-phosphoglycerate dehydrogenase [uncultured methanogenic
           archaeon RC-I]
          Length = 526

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F     R ++IQ    D      MI   + D  G++  VG ILG+  INI+   +GR  
Sbjct: 430 IFGKSDARIVEIQGYRVDAVPSGTMIVTRHQDRPGVIGKVGMILGKLNINISGMVVGRDA 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  +  + L+++     +   K  + 
Sbjct: 490 VRGDAVMILTVDDEVPAATLKQMISEAELYDAKYVKL 526


>gi|167759959|ref|ZP_02432086.1| hypothetical protein CLOSCI_02323 [Clostridium scindens ATCC 35704]
 gi|167662578|gb|EDS06708.1| hypothetical protein CLOSCI_02323 [Clostridium scindens ATCC 35704]
          Length = 223

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 36/94 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ +  K+  I+ +       + I N D  G ++ V   L +  INIA   + R +  
Sbjct: 125 GGGRIKVCKLDGIDVNFSGESYTLIIRNVDEPGRIMEVAAALSKAEINIATMQVFRDKRG 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  +    ++ L     I  VK   
Sbjct: 185 GFAVMVVETDQVVPQEAIDALESKEGIIRVKFLN 218


>gi|148642517|ref|YP_001273030.1| D-3-phosphoglycerate dehydrogenase [Methanobrevibacter smithii ATCC
           35061]
 gi|148551534|gb|ABQ86662.1| D-3-phosphoglycerate dehydrogenase, SerA [Methanobrevibacter
           smithii ATCC 35061]
          Length = 524

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 39/92 (42%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
            P+ +K+ +   DV     M      D+ G +  +G  LGEYGINI    +GR +    A
Sbjct: 433 DPKILKVNDYWVDVKPEGHMFIAKYEDVPGSIGKIGTALGEYGINIGIMQVGRDEKGGRA 492

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           I  L +D  I   V++ +     +      E 
Sbjct: 493 IMILTLDKEIPKEVIKGIQDLDNVYDAIGLEL 524


>gi|118443172|ref|YP_879194.1| D-3-phosphoglycerate dehydrogenase [Clostridium novyi NT]
 gi|118133628|gb|ABK60672.1| D-3-phosphoglycerate dehydrogenase [Clostridium novyi NT]
          Length = 530

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 48/94 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V S+ + + ++IQ    DV     M+ + N D+ G++  VG I+G  GIN+A   +GR  
Sbjct: 434 VSSNHEGKIVEIQGYEVDVKPSTHMVFVQNKDVPGVIGQVGTIIGMEGINVATMQVGRKA 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
             E+A+  L +D  + +  ++K      I  VK 
Sbjct: 494 KGENALMILNVDSEVSDESIKKFKEVQDIIEVKA 527


>gi|218247173|ref|YP_002372544.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8801]
 gi|257060245|ref|YP_003138133.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8802]
 gi|218167651|gb|ACK66388.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8801]
 gi|256590411|gb|ACV01298.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8802]
          Length = 525

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  DG+ R   +     +V     M+  V+ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLGDGEIRITDVDGFPINVPPSNYMLFTVHRDMPGIIGKIGSLLGGFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    IR  
Sbjct: 489 VRGDAVMALSLDDPLPEGLLSEITKVAGIRDA 520


>gi|323489160|ref|ZP_08094392.1| D-3-phosphoglycerate dehydrogenase [Planococcus donghaensis MPA1U2]
 gi|323397047|gb|EGA89861.1| D-3-phosphoglycerate dehydrogenase [Planococcus donghaensis MPA1U2]
          Length = 528

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +    R +K+ +   DV     ++ + + D  G++  VG +LG+  +NIA   +GRS 
Sbjct: 432 LLNGQGARIVKVDDYLVDVVPEGHLLYVSHNDRPGVIGRVGTLLGQENVNIATMQVGRSI 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  L ID S   S LE+L+    I+ V     
Sbjct: 492 VGGSAIMMLSIDKSAETSSLEQLAKLDEIQAVTAINL 528


>gi|238927354|ref|ZP_04659114.1| phosphoglycerate dehydrogenase [Selenomonas flueggei ATCC 43531]
 gi|238884636|gb|EEQ48274.1| phosphoglycerate dehydrogenase [Selenomonas flueggei ATCC 43531]
          Length = 565

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/98 (26%), Positives = 46/98 (46%), Gaps = 1/98 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + + R ++I     DVD    ++   + +  G++  +G+I+G  GINI+   +G+S 
Sbjct: 467 LFGE-EGRIVRINRFRVDVDPHARILICPHINRPGVIGTIGSIMGAAGINISSMQVGKSD 525

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
                I  L ID  I + VL ++     I   K   F 
Sbjct: 526 RKGMNIMVLTIDHDISDDVLARVLAVEGIFDAKLVNFE 563


>gi|315929501|gb|EFV08695.1| ACT domain protein [Campylobacter jejuni subsp. jejuni 305]
          Length = 330

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 235 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 294

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VL++L       FV+  E 
Sbjct: 295 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVEI 330


>gi|295101836|emb|CBK99381.1| L-serine ammonia-lyase [Faecalibacterium prausnitzii L2-6]
          Length = 227

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 40/96 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R  +I  +  D       + I N D  G +  V   L    INIA   + R+ + 
Sbjct: 124 GGGRIRVTEIDGVPADFGGDSNTLIIHNEDTPGCIAEVTMSLARRRINIASMQVFRAAAG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            +A+  L  D  I + + ++++V   IR V     +
Sbjct: 184 GYAVMVLECDSHIPHVLEQQMAVMPGIRKVTCLNID 219


>gi|309791398|ref|ZP_07685905.1| D-3-phosphoglycerate dehydrogenase [Oscillochloris trichoides DG6]
 gi|308226531|gb|EFO80252.1| D-3-phosphoglycerate dehydrogenase [Oscillochloris trichoides DG6]
          Length = 525

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 37/88 (42%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+P  ++      D      ++   + D  G++  VG +LGE  +NI+  ++GR    + 
Sbjct: 433 GEPHIVQADGYFVDFVPQGSLLITYHRDRPGMIGRVGTLLGENDVNISGMYVGRLSPRDR 492

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFV 92
           A+  L +D      VL  +     I   
Sbjct: 493 AMMVLTLDEPASEEVLNLVRALDDIDQA 520


>gi|197302071|ref|ZP_03167132.1| hypothetical protein RUMLAC_00799 [Ruminococcus lactaris ATCC
           29176]
 gi|197298880|gb|EDY33419.1| hypothetical protein RUMLAC_00799 [Ruminococcus lactaris ATCC
           29176]
          Length = 222

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 35/94 (37%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    +I  I  +       + + N D  G V  V ++L +  INIA   L RS   
Sbjct: 124 GGGRINIAQIDGIETNFSGENPTLIVHNQDQPGHVAEVTSMLAQKKINIATLQLYRSGKG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  +    LE L     I  V   +
Sbjct: 184 GRAVMVVECDQDVPEDGLEWLEKVEGIIKVTYLK 217


>gi|256810586|ref|YP_003127955.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus fervens
           AG86]
 gi|256793786|gb|ACV24455.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus fervens
           AG86]
          Length = 525

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 45/95 (47%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           ++ KP  +++     +     ++  + + D  G +  V   LG+YGINIA   +GR +  
Sbjct: 430 ANNKPVILEVDGYEVNFIPEGVLAIVKHVDRPGTIGRVCITLGDYGINIAGMQVGRKEPG 489

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             ++  L +D ++ + V+EK+     I+ V     
Sbjct: 490 GESVMLLNLDHTVPDEVVEKIKEIPNIKDVAIINL 524


>gi|296332953|ref|ZP_06875410.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|296149804|gb|EFG90696.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
          Length = 517

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 3/89 (3%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F +   R ++I   N D      ++ I + D  G++  VG ILG+  INIA   +GR + 
Sbjct: 432 FGE---RIVEINGFNIDFYPTGHLVYIQHQDTTGVIGRVGRILGDNDINIATMQVGRKEK 488

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIR 90
              AI  L  D  + + ++++L+    I 
Sbjct: 489 GGEAIMMLSFDRHLEDKIVKELTEVPDIV 517


>gi|198283146|ref|YP_002219467.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667460|ref|YP_002425374.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|198247667|gb|ACH83260.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218519673|gb|ACK80259.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 527

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 52/97 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  + + R +++  I+ ++ +   ++ I N D  G++  +G +LG  GINIA FHLGR +
Sbjct: 431 LVHEHQARLVQLDGIDVEMPLAGDLLYIQNRDEPGLIGRIGGLLGAAGINIAQFHLGREK 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+SF+ +D  +   +LE+++    +   +    
Sbjct: 491 PAGAALSFIAVDQPLTEVLLEQVASLPGVLAARMLRL 527


>gi|283954452|ref|ZP_06371972.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794069|gb|EFC32818.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 521

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 426 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 485

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VL++L       FV+  E 
Sbjct: 486 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVEI 521


>gi|219850460|ref|YP_002464893.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aggregans DSM
           9485]
 gi|219544719|gb|ACL26457.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aggregans DSM
           9485]
          Length = 525

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 40/85 (47%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+P  +++     D      ++   + D  G++  VG +LG   +NI+  ++GR    E 
Sbjct: 433 GEPHIVQMDGYFVDFVPQGSLLITYHHDQPGMIGKVGQLLGAADVNISGMYVGRRAPREQ 492

Query: 65  AISFLCIDGSILNSVLEKLSVNVTI 89
           A+  L +D      V+E+++    I
Sbjct: 493 AVMVLTLDEPAPPQVMEQVAAIPGI 517


>gi|297530641|ref|YP_003671916.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Geobacillus sp. C56-T3]
 gi|297253893|gb|ADI27339.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Geobacillus sp. C56-T3]
          Length = 220

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++      +      + I++ D  G +  V ++L +  INI H  + R +  
Sbjct: 126 GGGKIEIVELNGFALKLSGHHPALLIMHNDRYGTIGAVASVLAKQKINIGHMEVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  + + ++++L     I  V
Sbjct: 186 KEALMAIEVDQPLTDDLIQELEQLPNIIQV 215


>gi|167044704|gb|ABZ09375.1| putative D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
           domain protein [uncultured marine microorganism
           HF4000_APKG7H23]
          Length = 491

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 18/95 (18%), Positives = 40/95 (42%), Gaps = 1/95 (1%)

Query: 4   DGKPRFIKIQEINFDVDIGR-LMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           + +   +++ + + D+      M+   + D  G++  +G I GE+ INI+   +GR    
Sbjct: 397 NDQVHLVRVNDFSLDLQPTGRFMMFTEHTDRPGMIGRMGTIAGEHDINISFMEVGRRAPR 456

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A   + +D  I +  L +      +  V+    
Sbjct: 457 GEATMIVGLDDPISDEALAEFRAIPHVSRVRVVAI 491


>gi|225873973|ref|YP_002755432.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium capsulatum ATCC
           51196]
 gi|225792519|gb|ACO32609.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium capsulatum ATCC
           51196]
          Length = 525

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 2/99 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V      R + +  I+ +  +  +++ + N D+ G++  VG ILG++ INI +F LGRS 
Sbjct: 427 VLHGNSARLLNLDGIDIEAPLEGMLLSLRNLDVPGVIGRVGTILGDHQINIGNFALGRSD 486

Query: 61  ST--EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                 A++ + +DG++   VL+ L     I  V+    
Sbjct: 487 RDHHGTALAVIQVDGAVTEQVLQALRGVEAITEVRLVTL 525


>gi|225573358|ref|ZP_03782113.1| hypothetical protein RUMHYD_01550 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039271|gb|EEG49517.1| hypothetical protein RUMHYD_01550 [Blautia hydrogenotrophica DSM
           10507]
          Length = 222

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 34/94 (36%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    K+  I+ +       + + N D  G V  V ++L    +NIA+  L R +  
Sbjct: 124 GGGRIMVNKLDGIDVNCSCEMPTLIVHNLDQPGHVCEVTSMLAHKSVNIANMSLYRDRRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  I    +  L     +  V    
Sbjct: 184 GRAVMVIETDQPIPEEAVRWLEHLEGVLKVTYIN 217


>gi|205356376|ref|ZP_03223141.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|205345761|gb|EDZ32399.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8421]
          Length = 489

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 394 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 453

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VL++L       FV+  E 
Sbjct: 454 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVEI 489


>gi|315453857|ref|YP_004074127.1| D-3-phosphoglycerate dehydrogenase [Helicobacter felis ATCC 49179]
 gi|315132909|emb|CBY83537.1| D-3-phosphoglycerate dehydrogenase [Helicobacter felis ATCC 49179]
          Length = 525

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFS+   +   I     D+     MI   N D  G++  VG+ L ++GINIA F LGR+ 
Sbjct: 430 VFSEDILKITNIDGFEMDIQPQGTMILFKNTDKPGVIGNVGHTLAKHGINIADFRLGRNA 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  I +++L  L        V     
Sbjct: 490 K-KEALAVILVDTPINSAILHDLQEVPHCLGVSLVSI 525


>gi|261403538|ref|YP_003247762.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus vulcanius
           M7]
 gi|261370531|gb|ACX73280.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus vulcanius
           M7]
          Length = 524

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + KP  + +   + +      +  I + D  G +  V  +LG+YGINIA   +GR +   
Sbjct: 431 NNKPVILDVDGYDVNFIPEGALAIIKHIDRPGTIGRVCILLGDYGINIAGMQVGRKEPGG 490

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            ++  L +D ++   V+EK+     I+ V     
Sbjct: 491 ESVMLLNLDHTVPEDVIEKIKEIPNIKDVAVINL 524


>gi|317182310|dbj|BAJ60094.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F57]
          Length = 524

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFASHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLKVLEELKNIPACLSVHYVVI 524


>gi|116750521|ref|YP_847208.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116699585|gb|ABK18773.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 525

 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V    + R I+I +   + ++  + + I N D  G +  +G  LG + +NIA+ HL R+ 
Sbjct: 430 VLQGHEIRLIRINDYRLEAELEGINLLIQNYDKPGTIGLIGTTLGSHQVNIANMHLSRTP 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + AI+ + +D       +E L  + +I  V+Q + 
Sbjct: 490 R-DKAIAIIRLDNEAPPEAIETLRRHPSIISVQQVKL 525


>gi|327399776|ref|YP_004340645.1| D-3-phosphoglycerate dehydrogenase [Hippea maritima DSM 10411]
 gi|327182405|gb|AEA34586.1| D-3-phosphoglycerate dehydrogenase [Hippea maritima DSM 10411]
          Length = 529

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 53/97 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   K R + +   + ++++   +I   N D  GI+  VG ILG++ INIA F LGR Q
Sbjct: 433 VFEPNKARIVYMDGFDMEIELTGNIIVFRNYDKPGIIGKVGEILGKHNINIADFRLGRKQ 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+SF+ +D  + +++L+++        + + + 
Sbjct: 493 ALGEALSFIKVDQEVNDAILKEILSIDGAISIAKVKI 529


>gi|288932457|ref|YP_003436517.1| D-3-phosphoglycerate dehydrogenase [Ferroglobus placidus DSM 10642]
 gi|288894705|gb|ADC66242.1| D-3-phosphoglycerate dehydrogenase [Ferroglobus placidus DSM 10642]
          Length = 527

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 37/96 (38%), Gaps = 2/96 (2%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR--S 59
           F     R I+I     D       I  ++ D  G++  VG + G+Y INIA   +GR   
Sbjct: 430 FGRDDYRIIRIDRYKVDFVPRGHYIISLHEDKPGVIGRVGTLFGQYNINIAGMIVGRYGD 489

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           +     +  L +D      VLEK+     I      
Sbjct: 490 KPGGVQLMLLLVDDPPTEEVLEKMVKLDGIIDATYI 525


>gi|150400998|ref|YP_001324764.1| D-3-phosphoglycerate dehydrogenase [Methanococcus aeolicus
           Nankai-3]
 gi|150013701|gb|ABR56152.1| D-3-phosphoglycerate dehydrogenase [Methanococcus aeolicus
           Nankai-3]
          Length = 523

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 42/94 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G P   +I     D+    ++  I + D  GI+     +LG+YG+NIA   +GR +   
Sbjct: 430 EGAPVLKEINNYKIDIKPEGIVCVIKHMDKPGIIGKASTLLGDYGVNIAGMQVGRQEPGG 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            ++  L +D  I   V+ KL     I   K  + 
Sbjct: 490 ESVMVLNLDHVITEEVISKLKNIDNIIDAKIIKL 523


>gi|119717608|ref|YP_924573.1| D-3-phosphoglycerate dehydrogenase [Nocardioides sp. JS614]
 gi|119538269|gb|ABL82886.1| D-3-phosphoglycerate dehydrogenase [Nocardioides sp. JS614]
          Length = 536

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 43/92 (46%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           K R +++   + D++    +  +   D  G+V  VG I+G+ GINIA   + R      A
Sbjct: 444 KERLVEVNGFDVDLEPTEHLAFLTYEDRPGMVGTVGVIIGDAGINIAGMQVARDAKGGRA 503

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +  L +D +I   VL ++   +    V+  + 
Sbjct: 504 LVALSVDTAIPAEVLAEMQHAIDAISVRAVDL 535


>gi|310639883|ref|YP_003944641.1| l-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Paenibacillus polymyxa SC2]
 gi|309244833|gb|ADO54400.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Paenibacillus polymyxa SC2]
          Length = 229

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 18/95 (18%), Positives = 38/95 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++ E   ++      + ++++D  G +  V + LG   INIA+ H+ R    
Sbjct: 126 GGGSIHVQQLNEFRVNLTGELSTLVLLHSDKPGTLGAVTSALGAADINIAYMHVDRKGRD 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A++ +  D      ++ KL     +  +K    
Sbjct: 186 GEALTAIETDSLPTAELIAKLQSLPHMYEIKMINL 220


>gi|331270622|ref|YP_004397114.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           BKT015925]
 gi|329127172|gb|AEB77117.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           BKT015925]
          Length = 530

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 44/93 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S+ + + ++IQ    DV     M+ + N D+ G++  VG I+G   IN+A   +GR  
Sbjct: 434 LSSNHEGKLVEIQGYEVDVKPSTHMLFVQNKDVPGVIGQVGTIIGMENINVATMQVGRKA 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
             E A+  L +D  +    L K      I  VK
Sbjct: 494 KGEIALMILNVDSEVAKESLNKFKEIENIIEVK 526


>gi|56419719|ref|YP_147037.1| L-serine dehydratase (L-serine deaminase) subunit beta [Geobacillus
           kaustophilus HTA426]
 gi|56379561|dbj|BAD75469.1| L-serine dehydratase (L-serine deaminase) beta chain [Geobacillus
           kaustophilus HTA426]
          Length = 220

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++      +      + I++ D  G +  V ++L +  INI H  + R +  
Sbjct: 126 GGGKIEIVELNGFALKLSGHHPALLIMHNDRYGTIGAVASVLAKQKINIGHMEVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  + + ++++L     I  V
Sbjct: 186 KEALMAIEVDQPLTDDLIQELEQLPNIIQV 215


>gi|261419382|ref|YP_003253064.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Geobacillus sp. Y412MC61]
 gi|319766197|ref|YP_004131698.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Geobacillus sp. Y412MC52]
 gi|261375839|gb|ACX78582.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Geobacillus sp. Y412MC61]
 gi|317111063|gb|ADU93555.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Geobacillus sp. Y412MC52]
          Length = 220

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++      +      + I++ D  G +  V ++L +  INI H  + R +  
Sbjct: 126 GGGKIEIVELNGFALKLSGHHPALLIMHNDRYGTIGAVASVLAKRKINIGHMEVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  + + ++++L     I  V
Sbjct: 186 KEALMAIEVDQPLTDDLIQELEQLPNIIQV 215


>gi|94967146|ref|YP_589194.1| D-3-phosphoglycerate dehydrogenase [Candidatus Koribacter
           versatilis Ellin345]
 gi|94549196|gb|ABF39120.1| D-3-phosphoglycerate dehydrogenase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 531

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 2/99 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V     PR +    I+ +  +   ++ I N DI G+V  VG ILGE+ +NIA+F LGR  
Sbjct: 433 VLHGNSPRLLSFDNIDVEAPLEGTLLVIRNRDIPGVVGRVGTILGEHEVNIANFALGRPS 492

Query: 61  --STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             S  +AI+ + +DG +   VL++L     I      +F
Sbjct: 493 GNSGGNAIAAVQVDGPLKEPVLQQLRQQKAILAANVVQF 531


>gi|307747791|gb|ADN91061.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni M1]
          Length = 527

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VL++L       FV+  E 
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVEI 527


>gi|166367810|ref|YP_001660083.1| D-3-phosphoglycerate dehydrogenase [Microcystis aeruginosa
           NIES-843]
 gi|166090183|dbj|BAG04891.1| D-3-phosphoglycerate dehydrogenase [Microcystis aeruginosa
           NIES-843]
          Length = 525

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S+G+ R   + E   +V     M+  ++ D+ GI+  +G +LG + +NIA   +GR  
Sbjct: 429 LLSNGEIRITDLDEFPINVPPSNHMLFTLHQDMPGIIGKIGALLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    IR  
Sbjct: 489 IRGDAVMALSLDDPLPEGLLSEITKVPGIRDA 520


>gi|313896711|ref|ZP_07830259.1| putative phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312974628|gb|EFR40095.1| putative phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 366

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 43/95 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++I     DVD    ++   + +  G++  +G+I+GE G+NI+   +G+S    
Sbjct: 270 GTEGRIVRINRFRVDVDPHARILICPHINRPGVIGTIGSIMGEAGVNISAMQVGKSDRAG 329

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
             I  L +D  I +  L ++     I   K   F 
Sbjct: 330 TNIMVLTVDHDISDETLARVVALDGIFDAKLVNFE 364


>gi|237745935|ref|ZP_04576415.1| L-serine dehydratase [Oxalobacter formigenes HOxBLS]
 gi|229377286|gb|EEO27377.1| L-serine dehydratase [Oxalobacter formigenes HOxBLS]
          Length = 222

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 37/95 (38%), Gaps = 1/95 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIV-NADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
             G+    +I  I  +       + +  + D  G V  V   L ++GINIA   L R   
Sbjct: 124 GGGRILVSRIDGITTNFSGDENTLIVHTHYDRPGHVALVTAALAKHGINIATMQLYRRSK 183

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              A+  +  D  IL  ++EKLS    I  V    
Sbjct: 184 GGQAVMVIECDDPILPGLVEKLSQMEGILKVTYLN 218


>gi|57237720|ref|YP_178968.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni RM1221]
 gi|86150274|ref|ZP_01068501.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88597554|ref|ZP_01100788.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|218562511|ref|YP_002344290.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|57166524|gb|AAW35303.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni RM1221]
 gi|85839390|gb|EAQ56652.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88190146|gb|EAQ94121.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360217|emb|CAL35012.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|284926125|gb|ADC28477.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|315058331|gb|ADT72660.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni S3]
 gi|315927558|gb|EFV06891.1| phosphoglycerate dehydrogenase [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 527

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VL++L       FV+  E 
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVEI 527


>gi|302390335|ref|YP_003826156.1| L-serine ammonia-lyase [Thermosediminibacter oceani DSM 16646]
 gi|302200963|gb|ADL08533.1| L-serine ammonia-lyase [Thermosediminibacter oceani DSM 16646]
          Length = 219

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 32/90 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ +   I     D       I  V+ D  GIV  V   L E G NIA   + R    
Sbjct: 124 GGGRVKITAIDGFEVDFSGEYPTIITVHRDRPGIVARVTTHLAEKGFNIAQMRVSRKTKG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E A+  +  D  +   + E L     I  +
Sbjct: 184 EQALMIIETDEPLPEGIKEVLESIEDIYRI 213


>gi|157415148|ref|YP_001482404.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|157386112|gb|ABV52427.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81116]
          Length = 527

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VL++L       FV+  E 
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVEI 527


>gi|320529979|ref|ZP_08031055.1| phosphoglycerate dehydrogenase [Selenomonas artemidis F0399]
 gi|320137776|gb|EFW29682.1| phosphoglycerate dehydrogenase [Selenomonas artemidis F0399]
          Length = 534

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 43/95 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++I     DVD    ++   + +  G++  +G+I+GE G+NI+   +G+S    
Sbjct: 438 GTEGRIVRINRFRVDVDPHARILICPHINRPGVIGTIGSIMGEAGVNISAMQVGKSDRAG 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
             I  L +D  I +  L ++     I   K   F 
Sbjct: 498 TNIMVLTVDHDISDETLARVVALDGIFDAKLVNFE 532


>gi|315932626|gb|EFV11557.1| phosphoglycerate dehydrogenase [Campylobacter jejuni subsp. jejuni
           327]
          Length = 527

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VL++L       FV+  E 
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVEI 527


>gi|283956236|ref|ZP_06373716.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283791956|gb|EFC30745.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 527

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VL++L       FV+  E 
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVEI 527


>gi|86152140|ref|ZP_01070352.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315124387|ref|YP_004066391.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85840925|gb|EAQ58175.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315018109|gb|ADT66202.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 527

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VL++L       FV+  E 
Sbjct: 492 FG-YALAVVLIDEKVQKEVLDELKQLEACVFVQYVEI 527


>gi|86606026|ref|YP_474789.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. JA-3-3Ab]
 gi|86554568|gb|ABC99526.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. JA-3-3Ab]
          Length = 527

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 44/95 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
            + + R  +I E   +V     M+  ++ D+ GI+  +G +LG Y +NIA   +GR    
Sbjct: 433 GEREVRITQIDEFPVNVPPSANMLMTLHRDMPGIIGRIGTLLGAYNVNIASMQVGRKIIR 492

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A+  L +D  + + +LE++     IR       
Sbjct: 493 GDAVMVLSLDDPLPDGILEEVLKQPGIRDAFVVNL 527


>gi|260881561|ref|ZP_05404709.2| phosphoglycerate dehydrogenase [Mitsuokella multacida DSM 20544]
 gi|260848763|gb|EEX68770.1| phosphoglycerate dehydrogenase [Mitsuokella multacida DSM 20544]
          Length = 558

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++I +   DVD    ++   + +  G++  VG +LG  G+NI+   +G ++   
Sbjct: 462 GTQGRIVRINDFRVDVDPHARILICPHINRPGVIGTVGTLLGGNGVNISAMQVGTTEEEG 521

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             +  L +D  I  ++LE +     I   K   F
Sbjct: 522 KNLMVLTVDNDIPAALLETVKALDGIFDAKLVNF 555


>gi|322379237|ref|ZP_08053628.1| D-3-phosphoglycerate dehydrogenase [Helicobacter suis HS1]
 gi|321148377|gb|EFX42886.1| D-3-phosphoglycerate dehydrogenase [Helicobacter suis HS1]
          Length = 524

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 42/97 (43%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   +   I     DV     MI   N D  G++  VG  L +Y INIA F LGR+ 
Sbjct: 429 VFADNLLKITNINGFEMDVKPQGTMILFKNTDKPGVIGNVGQTLAKYDINIADFRLGRNS 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D SI   +L  L        V     
Sbjct: 489 K-QEALAVILVDASISPKILHALQEIPYCLSVCLVSI 524


>gi|297584460|ref|YP_003700240.1| D-3-phosphoglycerate dehydrogenase [Bacillus selenitireducens
           MLS10]
 gi|297142917|gb|ADH99674.1| D-3-phosphoglycerate dehydrogenase [Bacillus selenitireducens
           MLS10]
          Length = 536

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 42/91 (46%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR ++I E +F+   G+  + + + D  G++  VG +LG + +NIA   +GR      AI
Sbjct: 446 PRIVRINEFSFEFQPGKHTLFVQHNDRPGVIGKVGQLLGTHDVNIATMQVGRHSEGGKAI 505

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             L  D +    V+        +  V+  E 
Sbjct: 506 MLLGTDKACNGDVITAFETFDEVESVQTIEL 536


>gi|210615487|ref|ZP_03290614.1| hypothetical protein CLONEX_02830 [Clostridium nexile DSM 1787]
 gi|210150336|gb|EEA81345.1| hypothetical protein CLONEX_02830 [Clostridium nexile DSM 1787]
          Length = 222

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 40/95 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK + ++I  I+ +       + +   D  G+V  +   L E  +NIA   L R    
Sbjct: 128 GGGKMKIVRINNIDVEFTGEYSTLIVQQKDTPGVVAHITQALSEQEVNIAFMRLFREDKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            +A + +  D  I  +VL+K+  N  +  +   + 
Sbjct: 188 ANAYTVVESDEPIPEAVLDKIKTNPHVSDLMLIQM 222


>gi|167766000|ref|ZP_02438053.1| hypothetical protein CLOSS21_00491 [Clostridium sp. SS2/1]
 gi|167712357|gb|EDS22936.1| hypothetical protein CLOSS21_00491 [Clostridium sp. SS2/1]
          Length = 222

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 32/93 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ +   I  +  +       + + N D  G V  V ++L    +NIA   L R    
Sbjct: 124 GGGRIKICTIDGLEANFSGEYTTLVVHNDDQPGHVAEVTSMLAHKSVNIATMQLYRDHRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  +  D  I    L  L     I+ V   
Sbjct: 184 GSAVMVIECDKEIPEEGLNFLERLEGIQKVTYL 216


>gi|222824187|ref|YP_002575761.1| D-3-phosphoglycerate dehydrogenase [Campylobacter lari RM2100]
 gi|222539409|gb|ACM64510.1| D-3-phosphoglycerate dehydrogenase [Campylobacter lari RM2100]
          Length = 526

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + + R +++   + D      MI + N DI G++  V  IL +  +NIA F LGR+ 
Sbjct: 431 IFGENEQRIVELNGFDVDFKPKGKMIILNNNDIPGVIANVSGILAKNNVNIADFRLGRNG 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  I  ++LE+L       F +  E 
Sbjct: 491 FGK-ALAVILLDAKISKALLEELRAIDACIFAEYAEI 526


>gi|304406983|ref|ZP_07388637.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus curdlanolyticus
           YK9]
 gi|304343970|gb|EFM09810.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus curdlanolyticus
           YK9]
          Length = 530

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +   PR ++I     DV     +I I + D  GI+  VG +LG   +NIA   +GR  
Sbjct: 433 LLTGYGPRIVQIDSYPVDVAPEGNLILISHNDKPGIIGRVGTLLGSNDVNIAAMQVGRKL 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  L +D     SV+E+++    +   K+   
Sbjct: 493 VGGAAIMVLTVDKGAAKSVIEEVAQLSDLNSAKEIHL 529


>gi|300866531|ref|ZP_07111221.1| D-3-phosphoglycerate dehydrogenase [Oscillatoria sp. PCC 6506]
 gi|300335488|emb|CBN56381.1| D-3-phosphoglycerate dehydrogenase [Oscillatoria sp. PCC 6506]
          Length = 527

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  + + R   + E   +V   R M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 VLGEDEIRITSVDEFPVNVSPSRHMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRRI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L ++     IR  
Sbjct: 491 VRGDAVMVLSLDDPLPEGILAEIIKLAGIRDA 522


>gi|37521708|ref|NP_925085.1| D-3-phosphoglycerate dehydrogenase [Gloeobacter violaceus PCC 7421]
 gi|35212706|dbj|BAC90080.1| D-3-phosphoglycerate dehydrogenase [Gloeobacter violaceus PCC 7421]
          Length = 526

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 43/97 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + ++ + R   I E    V   R M+  ++ D+ GI+  VG+ LG Y +NIA   +GR  
Sbjct: 430 LLAEDELRITNIDEFPISVAPSRYMLITLHRDMPGIIGKVGSFLGSYNVNIAGMQVGRKL 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  + +D  +   +L ++     IR       
Sbjct: 490 VRGDAVMMVSLDDPLPEGLLGEIESVPGIRKAYTVNL 526


>gi|325958180|ref|YP_004289646.1| D-3-phosphoglycerate dehydrogenase [Methanobacterium sp. AL-21]
 gi|325329612|gb|ADZ08674.1| D-3-phosphoglycerate dehydrogenase [Methanobacterium sp. AL-21]
          Length = 525

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 41/93 (44%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            +P+ I I     DV+    M+     D  G++  +G  +G++ INIA   +GR +    
Sbjct: 433 DEPKIIMINGYQVDVETEGTMLISKYKDKPGVIGAIGTKIGKHNINIAKMQVGRKELGGE 492

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           A+  L +D  +  +V+E+L     +        
Sbjct: 493 AVMVLKVDQQVPLNVIEELKQLEDVNDAVAVNL 525


>gi|298491116|ref|YP_003721293.1| D-3-phosphoglycerate dehydrogenase ['Nostoc azollae' 0708]
 gi|298233034|gb|ADI64170.1| D-3-phosphoglycerate dehydrogenase ['Nostoc azollae' 0708]
          Length = 526

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGDKEIHLTDVDGFPINVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  + + +L++++    IR  
Sbjct: 490 VRGDAVMALSIDDPLPDGILDEITKVPGIRDA 521


>gi|331091763|ref|ZP_08340595.1| L-serine dehydratase [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330402662|gb|EGG82229.1| L-serine dehydratase [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 222

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 40/95 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK + ++I  I+ +       + +   D  G+V  +   L E  +NIA   L R    
Sbjct: 128 GGGKMKIVRINNIDVEFTGEYSTLIVQQTDKPGVVAHITQCLSEENVNIAFMRLFREDKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A + +  D  I   +L+K+ VN  ++ +   + 
Sbjct: 188 ATAFTIVESDEKIPEEILDKIRVNEHVKDLMLIQM 222


>gi|302335864|ref|YP_003801071.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit
           [Olsenella uli DSM 7084]
 gi|301319704|gb|ADK68191.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit
           [Olsenella uli DSM 7084]
          Length = 529

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 33/95 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R   I  +  ++      + + + D  G++  +   L     NIA     R +  
Sbjct: 128 GGGRIRIGAINGVRVEISGDYPTLFVTHLDRPGVLASLTGALSASSSNIATMRTYRERRG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A +   +D  I   +L  LS    +   +  + 
Sbjct: 188 GSAHTVFELDDGIDPDLLSGLSAAPNVVSARVVDI 222


>gi|209523822|ref|ZP_03272375.1| D-3-phosphoglycerate dehydrogenase [Arthrospira maxima CS-328]
 gi|209495854|gb|EDZ96156.1| D-3-phosphoglycerate dehydrogenase [Arthrospira maxima CS-328]
          Length = 527

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D + R   I +   +V   R M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 LLGDREIRVTNIDDFPINVPPTRYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  + + +L ++     IR  
Sbjct: 491 VRGEAVMVLSLDDPLPDGLLSEIMKVAGIRDA 522


>gi|224370615|ref|YP_002604779.1| D-3-phosphoglycerate dehydrogenase [Desulfobacterium autotrophicum
           HRM2]
 gi|223693332|gb|ACN16615.1| SerA1 [Desulfobacterium autotrophicum HRM2]
          Length = 526

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 2/99 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR I+I +   +V     +  I N D  G +  +G  LG++ INIA   +GR  
Sbjct: 430 IFGKDDPRIIRINKFRLEVIPDGHLALIHNIDKPGSIGNIGTCLGKHDINIAKMMVGRED 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
             +  I FL  D  I   + E++S    +  +    F +
Sbjct: 490 DGDRNIIFLQTDTPISAEIAEEISGLGLVNSM--VTFEL 526


>gi|261406015|ref|YP_003242256.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. Y412MC10]
 gi|261282478|gb|ACX64449.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. Y412MC10]
          Length = 530

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 42/88 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++ +   D+     +I I + D  GI+  VG +LGE  +NIA   +GR      AI 
Sbjct: 440 RIVRLDKFPVDISPEGHLILISHNDKPGIIGRVGTLLGENDVNIASMQVGRKVIGGEAIM 499

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            L +D  +   VL KL+    +   +Q 
Sbjct: 500 LLTVDKDVPKDVLIKLTGLSELNTAQQI 527


>gi|260588469|ref|ZP_05854382.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Blautia
           hansenii DSM 20583]
 gi|331082254|ref|ZP_08331381.1| L-serine dehydratase [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260540944|gb|EEX21513.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Blautia
           hansenii DSM 20583]
 gi|330403048|gb|EGG82613.1| L-serine dehydratase [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 223

 Score = 99.7 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 41/95 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK + +K+ +I  D       + +   D  G+V  +  +L E G+NIA   L R +  
Sbjct: 129 GGGKVKIVKLNQIEVDFTGEYSTLIVSQTDKPGVVAHITRVLSEEGVNIAFMRLFREEKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A + +  D  I   VL+++  N  +  +   + 
Sbjct: 189 AAAFTVVESDEKIPAKVLDRIRENPLVSDITLVQL 223


>gi|78043987|ref|YP_359554.1| iron-sulfur-dependent L-serine dehydratase subunit beta
           [Carboxydothermus hydrogenoformans Z-2901]
 gi|77996102|gb|ABB15001.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 218

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 16/88 (18%), Positives = 31/88 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      I      +      + + + D  G V  V +++  +GINIA   + R +  
Sbjct: 123 GGGAVLITDINGYPVRITAKYPTLIVPHNDQPGAVAKVTSVIAWHGINIAQMSVARQKKG 182

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIR 90
             A+  +  D  I     +++     I 
Sbjct: 183 AEALMVIETDQPIDEETCKEIKRLPGIT 210


>gi|217966485|ref|YP_002351991.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 6724]
 gi|217335584|gb|ACK41377.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 6724]
          Length = 525

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 48/90 (53%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           S  + R + IQ+ + D+ + + M+   + D  GI+  VG +LG+  INIA   +GR +  
Sbjct: 431 SRNQERILAIQDYHLDLALSQYMLIAFHIDRPGIIGQVGTVLGKNNINIAAMQVGRKEIG 490

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  L ID  + + VL +L     I+ V
Sbjct: 491 KDAVMVLVIDNPVDDKVLRELKNIENIKEV 520


>gi|291558791|emb|CBL37591.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [butyrate-producing bacterium SSC/2]
          Length = 222

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 32/93 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ +   I  +  +       + + N D  G V  V ++L    +NIA   L R    
Sbjct: 124 GGGRIKICTIDGLEANFSGEYTTLVVHNDDQPGHVAEVTSMLAHKSVNIATMQLYRDHRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  +  D  I    L  L     I+ V   
Sbjct: 184 GSAVMVIECDKEIPEEGLNFLERLEGIQKVTYI 216


>gi|149176983|ref|ZP_01855592.1| phosphoglycerate dehydrogenase [Planctomyces maris DSM 8797]
 gi|148844238|gb|EDL58592.1| phosphoglycerate dehydrogenase [Planctomyces maris DSM 8797]
          Length = 541

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 51/99 (51%), Gaps = 2/99 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR-- 58
           +F     R  ++ E   D  +   ++   + D+ G++ ++G +LG + +NIAH  LGR  
Sbjct: 432 IFGQDFLRLTRLDEFYLDGYLDGNLLIYRHNDVPGLIGYIGTVLGNHNVNIAHMALGRLQ 491

Query: 59  SQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +Q    AI+ L +DG +  + + ++S +  +  VK  + 
Sbjct: 492 NQPGGEAIAVLNVDGEVPEAAIAEVSSHKDVSCVKLIKM 530


>gi|75909963|ref|YP_324259.1| D-3-phosphoglycerate dehydrogenase [Anabaena variabilis ATCC 29413]
 gi|75703688|gb|ABA23364.1| D-3-phosphoglycerate dehydrogenase [Anabaena variabilis ATCC 29413]
          Length = 526

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGDKEIHLTDVDGFPINVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  + + +L +++    IR  
Sbjct: 490 VRGDAVMALSIDDPLPDGILAEITKVPGIRDA 521


>gi|288559935|ref|YP_003423421.1| phosphoglycerate dehydrogenase SerA [Methanobrevibacter ruminantium
           M1]
 gi|288542645|gb|ADC46529.1| phosphoglycerate dehydrogenase SerA [Methanobrevibacter ruminantium
           M1]
          Length = 524

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 34/92 (36%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           + + IK+     DV     M      DI G +  +G   GE  INI    +GR  +   A
Sbjct: 433 EAKIIKVNGYWVDVKPEGNMFIAKYKDIPGSIGAIGTKFGEENINIGIMQVGRDSTGGEA 492

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           I  L +D       ++K+     +      + 
Sbjct: 493 IMILTLDERPSKEAVKKIKDLDNVSDATCLKL 524


>gi|284052483|ref|ZP_06382693.1| D-3-phosphoglycerate dehydrogenase [Arthrospira platensis str.
           Paraca]
 gi|291569633|dbj|BAI91905.1| D-3-phosphoglycerate dehydrogenase [Arthrospira platensis NIES-39]
          Length = 527

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D + R   I +   +V   R M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 431 LLGDREIRVTNIDDFPINVPPTRYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  + + +L ++     IR  
Sbjct: 491 VRGEAVMVLSLDDPLPDGLLSEIMKVAGIRDA 522


>gi|86608852|ref|YP_477614.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557394|gb|ABD02351.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 526

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 44/95 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
            + + R  +I E   +V     M+  ++ D+ GI+  +G +LG Y +NIA   +GR    
Sbjct: 432 GEREVRITQIDEFPVNVPPSANMLMTLHRDMPGIIGRIGTLLGAYNVNIASMQVGRKIIR 491

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A+  L +D  + + +LE++     IR       
Sbjct: 492 GDAVMVLSLDDPLPDGILEEVLKQPGIRDAFVVNL 526


>gi|329929876|ref|ZP_08283552.1| phosphoglycerate dehydrogenase [Paenibacillus sp. HGF5]
 gi|328935854|gb|EGG32315.1| phosphoglycerate dehydrogenase [Paenibacillus sp. HGF5]
          Length = 530

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 42/88 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++ +   D+     +I I + D  GI+  VG +LGE  +NIA   +GR      AI 
Sbjct: 440 RIVRLDKFPVDISPEGHLILISHNDKPGIIGRVGTLLGENDVNIASMQVGRKVIGGEAIM 499

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            L +D  +   VL KL+    +   +Q 
Sbjct: 500 LLTVDKDVPKDVLIKLTGLSELNTAQQI 527


>gi|323141567|ref|ZP_08076450.1| phosphoglycerate dehydrogenase [Phascolarctobacterium sp. YIT
           12067]
 gi|322413909|gb|EFY04745.1| phosphoglycerate dehydrogenase [Phascolarctobacterium sp. YIT
           12067]
          Length = 528

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 43/96 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   +P+ ++I + + D +    ++   + +   ++  +  ILG  GINI    +G + 
Sbjct: 430 LFDGKQPKIVQIDQYHVDFNPEGYLLLAPHVNKPNMIGQMATILGSAGININGMQVGSTP 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            ++  I  + +   I N ++ +L     I  VK   
Sbjct: 490 KSDTNIMAIAVGDDIPNDIMLQLRGVEGIIDVKLIN 525


>gi|317497191|ref|ZP_07955516.1| L-serine dehydratase [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316895517|gb|EFV17674.1| L-serine dehydratase [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 222

 Score = 99.3 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 32/93 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ +   I  +  +       + + N D  G V  V ++L    +NIA   L R    
Sbjct: 124 GGGRIKICTIDGLEANFSGEYTTLVVHNDDQPGHVAEVTSMLAHKAVNIATMQLYRDHRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  +  D  I    L  L     I+ V   
Sbjct: 184 GSAVMVIECDKEIPEEGLNFLERLEGIQKVTYL 216


>gi|22297868|ref|NP_681115.1| D-3-phosphoglycerate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
 gi|22294046|dbj|BAC07877.1| D-3-phosphoglycerate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
          Length = 527

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 43/97 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S  + R   I +    V   R M+  ++ D+ GI+  +G  LG + +NIA   +GR  
Sbjct: 431 LLSHNELRITSIDDFPISVAPTRYMLLTLHRDMPGIIGKIGTQLGSFNVNIASMQVGRKM 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A+  + +D  +   +LE++     IR       
Sbjct: 491 VRGNAVMVISLDDPLPEGLLEEILKVPGIRDAYIVNL 527


>gi|319892223|ref|YP_004149098.1| L-serine dehydratase, beta subunit [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317161919|gb|ADV05462.1| L-serine dehydratase, beta subunit [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464680|gb|ADX76833.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit 2
           [Staphylococcus pseudintermedius ED99]
          Length = 221

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 37/90 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   + I      +      + + + D  G +  V NILG+ GIN+    + R +  
Sbjct: 126 GGGKIEIVAINGFPLAISGNYPTLLVFHQDTFGTIGKVANILGDDGINVGSMQVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+    +D  + + +L+ +     +  V
Sbjct: 186 DQALMTCELDDEVNDKILDAIRQVPGVVTV 215


>gi|160943482|ref|ZP_02090715.1| hypothetical protein FAEPRAM212_00972 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445161|gb|EDP22164.1| hypothetical protein FAEPRAM212_00972 [Faecalibacterium prausnitzii
           M21/2]
 gi|295103745|emb|CBL01289.1| L-serine ammonia-lyase [Faecalibacterium prausnitzii SL3/3]
          Length = 226

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/96 (22%), Positives = 39/96 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R  +I  +  D       + I N D  G +  V   L    INIA   + R+ + 
Sbjct: 124 GGGRIRVTEIDGVPADFGGDSNTLIIHNEDTPGCIAEVTMALALRRINIASMQVFRAAAG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            +A+  L  D  I +++  +L+V   +  V     +
Sbjct: 184 GYAVMVLECDSHIPHALERQLAVMPGLLKVTCLNVD 219


>gi|121612205|ref|YP_001000566.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167005499|ref|ZP_02271257.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|87249339|gb|EAQ72299.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
          Length = 527

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      M+   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMVIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VL++L       FV+  E 
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVEI 527


>gi|86153461|ref|ZP_01071665.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|85843187|gb|EAQ60398.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni HB93-13]
          Length = 527

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      M+   N DI G++  + ++L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMVIFKNKDIPGVIAKISSVLAAKNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VL++L       FV+  E 
Sbjct: 492 F-GYALAVVLIDEKVQKEVLDELKQLEACVFVQYVEI 527


>gi|225849496|ref|YP_002729661.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643873|gb|ACN98923.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 529

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 48/94 (51%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F D  PR + +     D++   +++   N D+ G++  +G IL  + INIA F LGR + 
Sbjct: 434 FYDKLPRIMLVDNYWIDIEPSGVILMFENKDVPGVIGKLGTILARHNINIAGFRLGRLEK 493

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            + A+  L +D  +  +VLE++     I   KQ 
Sbjct: 494 GKIALGALQLDDKLNEAVLEEIHQIPEIIKAKQV 527


>gi|34557674|ref|NP_907489.1| D-3-phosphoglycerate dehydrogenase [Wolinella succinogenes DSM
           1740]
 gi|34483391|emb|CAE10389.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Wolinella succinogenes]
          Length = 528

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 1/90 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   R ++I     D++    MI   N D+ G++  +G  L ++ INIA F LGR+ 
Sbjct: 433 VFDENVQRIVEINGFGLDIEPKGRMILFKNTDVPGVIGMIGTTLAKHQINIADFRLGRNN 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIR 90
               A++ + +D  +   V+E+L       
Sbjct: 493 H-NQALAVIIVDDDVKKEVIEELRAIKACL 521


>gi|152990413|ref|YP_001356135.1| D-3-phosphoglycerate dehydrogenase [Nitratiruptor sp. SB155-2]
 gi|151422274|dbj|BAF69778.1| D-3-phosphoglycerate dehydrogenase [Nitratiruptor sp. SB155-2]
          Length = 529

 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +   R + I     DV+    MI   N D+ G++  VG IL ++ INIA F LGR  
Sbjct: 434 IFEENVQRIVDINNFALDVEPKGKMILFKNTDVPGVIGEVGMILAKHNINIADFRLGRDN 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
              HA++ + +D  +   VL++LS       V  
Sbjct: 494 HG-HALAVIIVDDDVSKEVLKELSNLKACISVSY 526


>gi|331086303|ref|ZP_08335383.1| L-serine dehydratase [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330406069|gb|EGG85592.1| L-serine dehydratase [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 222

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 43/95 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK + ++I +I+ +       + +   D  G+V  +   L E  +NIA   L R    
Sbjct: 128 GGGKMKIVRINQIDVEFTGEYSTLIVSQTDKPGVVAHITQCLSEENVNIAFMRLFREDKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            +A + +  D +I +SVLEK+  +  +  +   + 
Sbjct: 188 ANAFTVVESDETIPSSVLEKIKTHEHVSDLMLIQM 222


>gi|308069541|ref|YP_003871146.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Paenibacillus polymyxa
           E681]
 gi|305858820|gb|ADM70608.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Paenibacillus polymyxa
           E681]
          Length = 530

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/98 (25%), Positives = 45/98 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +    R +++ +   DV      + I + D  GI+  VG +LGE G+NIA   +GR  
Sbjct: 433 LLAGYGERIVRLNQFPVDVAPEAHFLLISHNDKPGIIGRVGTLLGENGVNIASMQVGRKI 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               AI  L +D ++   VL +L     +   ++   +
Sbjct: 493 VGGEAIMILTVDKAVPKDVLIQLVGLPELNTAQEVVLD 530


>gi|325662533|ref|ZP_08151136.1| L-serine dehydratase [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471229|gb|EGC74454.1| L-serine dehydratase [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 222

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 43/95 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK + ++I +I+ +       + +   D  G+V  +   L E  +NIA   L R    
Sbjct: 128 GGGKMKIVRINQIDVEFTGEYSTLIVSQTDKPGVVAHITQCLSEENVNIAFMRLFREDKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            +A + +  D +I +SVL+K+  +  +  +   + 
Sbjct: 188 ANAFTVVESDETIPSSVLDKIKTHEHVSDLMLIQM 222


>gi|292669667|ref|ZP_06603093.1| phosphoglycerate dehydrogenase [Selenomonas noxia ATCC 43541]
 gi|292648464|gb|EFF66436.1| phosphoglycerate dehydrogenase [Selenomonas noxia ATCC 43541]
          Length = 526

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 43/95 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++I     DVD    ++   + +  G++  +G+I+GE GINI+   +G+S    
Sbjct: 430 GTEGRIVRINRFRVDVDPHARILICPHINRPGVIGMIGSIMGEAGINISSMQVGKSDREG 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
             I  L ID  I +  L ++     I   K   F 
Sbjct: 490 MNIMVLTIDHDIPDDTLARVLAVDGIFDAKLVNFE 524


>gi|182415332|ref|YP_001820398.1| D-3-phosphoglycerate dehydrogenase [Opitutus terrae PB90-1]
 gi|177842546|gb|ACB76798.1| D-3-phosphoglycerate dehydrogenase [Opitutus terrae PB90-1]
          Length = 529

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 40/93 (43%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            + R + +     +V     ++ + N D  G+V  +G ILG+ G+NIA   L R      
Sbjct: 437 NQARIVSVNGREVEVAAEGKLLVLENLDQPGMVGEIGTILGQDGVNIADMSLSRLIPGGT 496

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           A   + +D    ++  + +  +  I+  K  + 
Sbjct: 497 AYMVVRVDTEPSDNARKIIKGHPAIKQAKFVQL 529


>gi|57242228|ref|ZP_00370167.1| D-3-phosphoglycerate dehydrogenase [Campylobacter upsaliensis
           RM3195]
 gi|57016908|gb|EAL53690.1| D-3-phosphoglycerate dehydrogenase [Campylobacter upsaliensis
           RM3195]
          Length = 527

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      M+   N DI G++  + + L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMLIFKNKDIPGVISKISSTLAAQNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + +D  I   VL++L+      FV+  E 
Sbjct: 492 F-GYALAVVLVDEVISKEVLDELNKLEVCVFVQYVEI 527


>gi|150391963|ref|YP_001322012.1| D-3-phosphoglycerate dehydrogenase [Alkaliphilus metalliredigens
           QYMF]
 gi|149951825|gb|ABR50353.1| D-3-phosphoglycerate dehydrogenase [Alkaliphilus metalliredigens
           QYMF]
          Length = 526

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 44/97 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+    R + +    FDV     M+   N D  G++  +G++LGE  +NIA   + R  
Sbjct: 430 VFAKKDMRIVDVNGFVFDVTPTPYMLVANNTDKPGMIGKMGSLLGENNVNIATMQVSRKH 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A+ FL +D  +    L  ++    I  +K  + 
Sbjct: 490 KDKEAMMFLAVDSEVNKETLNIINKAEGILQIKFVKL 526


>gi|315638687|ref|ZP_07893861.1| phosphoglycerate dehydrogenase [Campylobacter upsaliensis JV21]
 gi|315481311|gb|EFU71941.1| phosphoglycerate dehydrogenase [Campylobacter upsaliensis JV21]
          Length = 527

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      M+   N DI G++  + + L    INIA F LGR  
Sbjct: 432 VFNENEQRIVGLNGFKTDFKPKGKMLIFKNKDIPGVISKISSTLAAQNINIADFRLGRDG 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + +D  I   VL++L+      FV+  E 
Sbjct: 492 F-GYALAVVLVDEVISKEVLDELNKLEVCVFVQYVEI 527


>gi|159897613|ref|YP_001543860.1| D-3-phosphoglycerate dehydrogenase [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890652|gb|ABX03732.1| D-3-phosphoglycerate dehydrogenase [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 524

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 42/95 (44%), Gaps = 4/95 (4%)

Query: 2   FSD----GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLG 57
           F      G+   ++I E   D+     M+   + D  G +  +G +LG   INI+  H+G
Sbjct: 425 FGGTVVRGEAHIVQINEFWLDLVPTSSMLFTFHQDRPGFIGRIGTLLGTADINISAMHVG 484

Query: 58  RSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           RS     AI  L +D +I +  L  ++  V I   
Sbjct: 485 RSSPRGTAIMVLTVDEAIPSETLTDINNQVDIERA 519


>gi|289193097|ref|YP_003459038.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus sp.
           FS406-22]
 gi|288939547|gb|ADC70302.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus sp.
           FS406-22]
          Length = 524

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 45/94 (47%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + KP  +++           ++  + + D  GI+  VG  LG+YGINIA   +GR +   
Sbjct: 431 NNKPVILEVDGYEVSFIPEGVLAIVKHIDRPGIIGRVGVTLGDYGINIAGMQVGRKEPGG 490

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            ++  + +D ++ + V+EKL     I+ +     
Sbjct: 491 DSVMLINLDHTVPDEVVEKLKKIPNIKDIAIVNL 524


>gi|254422032|ref|ZP_05035750.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7335]
 gi|196189521|gb|EDX84485.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7335]
          Length = 526

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +    + R I +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGGSEVRIIDMDGFPINVPPTQYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  +   +LE++     IR  
Sbjct: 490 VRGDAVMVLSIDDPLPAGILEEIKKEQGIRDA 521


>gi|87312269|ref|ZP_01094368.1| phosphoglycerate dehydrogenase [Blastopirellula marina DSM 3645]
 gi|87285007|gb|EAQ76942.1| phosphoglycerate dehydrogenase [Blastopirellula marina DSM 3645]
          Length = 539

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +  PR I +     +  +   +    + D+ GI+  VG I G + +NIA   +GRS 
Sbjct: 433 LFGNDMPRLILVDGQRLEAYLDGTLFLFAHNDVPGIIGRVGTIFGNHNVNIAQMAVGRSS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +   A+  L +DG+   S ++++  +  I   +  E 
Sbjct: 493 TGG-AVGVLNLDGAPPQSAVDEVLKSADITTARIIEL 528


>gi|139436893|ref|ZP_01771053.1| Hypothetical protein COLAER_00024 [Collinsella aerofaciens ATCC
           25986]
 gi|133776540|gb|EBA40360.1| Hypothetical protein COLAER_00024 [Collinsella aerofaciens ATCC
           25986]
          Length = 535

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 40/95 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R  +I  +  D+      + + + D+ G++  + N+L    +NIA     R++  
Sbjct: 135 GGGKMRISRINGVGVDISGMYSTLFVAHKDVPGVLAALTNLLAYAHVNIAFCRTYRTEVG 194

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A S    DG+  ++V+  L     + +    E 
Sbjct: 195 GQAYSVFETDGAPDDTVVPMLRKLDNVDYATFIEL 229


>gi|159027379|emb|CAO90566.1| serA [Microcystis aeruginosa PCC 7806]
          Length = 525

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 42/88 (47%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+ R   + E   +V     M+  ++ D+ GI+  +G +LG + +NIA   +GR      
Sbjct: 433 GEIRITDLDEFPINVPPSNHMLFTLHQDMPGIIGKIGALLGSFNVNIASMQVGRKIIRGD 492

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFV 92
           A+  L +D  +   +L +++    IR  
Sbjct: 493 AVMALSLDDPLPEGLLSEITKVPGIRDA 520


>gi|332178487|gb|AEE14176.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfobium narugense DSM
           14796]
          Length = 528

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 46/95 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SD KPR I+I     D      ++   + D  GI+   G ILG+  INIA   LGR+ 
Sbjct: 431 ILSDQKPRIIEIDSYRVDAFPEGYLLVSRHRDKPGIIGRFGTILGKNNINIAGMQLGRNL 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           ++  A+  L +D  + + VL +L     I  ++  
Sbjct: 491 TSGLAVMILSVDSEVNDDVLRELISGGDIEELRSI 525


>gi|223039567|ref|ZP_03609854.1| phosphoglycerate dehydrogenase [Campylobacter rectus RM3267]
 gi|222879138|gb|EEF14232.1| phosphoglycerate dehydrogenase [Campylobacter rectus RM3267]
          Length = 525

 Score = 98.6 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 1/94 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + I     D      MI   N D+ G++  +  IL    INIA F LGR  
Sbjct: 430 VFGENQQRIVTINGFKTDFKPKGKMIIFKNNDVPGVIAQISTILAAEKINIADFRLGRDD 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
               A++ + +D  I    L KL+      + K 
Sbjct: 490 H-GMALAVVLVDEKITKETLAKLNELDVCVWAKY 522


>gi|149193714|ref|ZP_01870812.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Caminibacter mediatlanticus
           TB-2]
 gi|149135667|gb|EDM24145.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Caminibacter mediatlanticus
           TB-2]
          Length = 522

 Score = 98.6 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +  PR ++ +  + + +    MI   N D+ G++  VG  L ++ INIA F LGR++   
Sbjct: 430 ENHPRVVEFKGFDLEFEPKGKMIFFKNTDVPGVIGEVGMTLAKHNINIADFRLGRNKE-G 488

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A++ + +D  +   VL +L        V   E 
Sbjct: 489 QAMAVIIVDNDVNEEVLNELKKLKAALSVAYAEI 522


>gi|315646394|ref|ZP_07899512.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus vortex V453]
 gi|315278037|gb|EFU41357.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus vortex V453]
          Length = 530

 Score = 98.6 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 42/88 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R +++ +   D+     +I I + D  GI+  VG +LGE  +NIA   +GR      AI 
Sbjct: 440 RIVRLDKFPVDISPEGHLILISHNDKPGIIGRVGTLLGENDVNIASMQVGRKVIGGEAIM 499

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            L +D  +   VL KL+    +   +Q 
Sbjct: 500 LLTVDKDVPKDVLIKLTGLAELNTAQQI 527


>gi|297624968|ref|YP_003706402.1| L-serine dehydratase, iron-sulfur-dependent subunit beta [Truepera
           radiovictrix DSM 17093]
 gi|297166148|gb|ADI15859.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Truepera
           radiovictrix DSM 17093]
          Length = 238

 Score = 98.6 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 37/93 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  R +++             + + + D  G +  V  IL + G+NIA  H  R Q  
Sbjct: 123 GGGLVRVVRVNGFEILFSGAYHTLLVGHTDQPGAIATVARILADDGVNIATLHCARRQRG 182

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  L ID      VL+ LS    + +++  
Sbjct: 183 GAAMMSLEIDRRPAQFVLDYLSQLRVVSWLRML 215


>gi|256372302|ref|YP_003110126.1| D-3-phosphoglycerate dehydrogenase [Acidimicrobium ferrooxidans DSM
           10331]
 gi|256008886|gb|ACU54453.1| D-3-phosphoglycerate dehydrogenase [Acidimicrobium ferrooxidans DSM
           10331]
          Length = 527

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 42/91 (46%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           +PR + +     +V   R M+ + N D  G+V  VG++LG+ G +I    +        A
Sbjct: 431 EPRVVLVDGHWVEVPPSRWMLVVRNVDRPGMVGVVGSLLGQAGRSIDAMAVSPRTDDGTA 490

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           +  L +DG I + VL +L     I + +   
Sbjct: 491 LMVLGVDGPIPDEVLTELDATDGIIYARTVT 521


>gi|229824710|ref|ZP_04450779.1| hypothetical protein GCWU000182_00058 [Abiotrophia defectiva ATCC
           49176]
 gi|229791039|gb|EEP27153.1| hypothetical protein GCWU000182_00058 [Abiotrophia defectiva ATCC
           49176]
          Length = 206

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 37/93 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ +  KI  I  +       + + N D  G V  V   L   G NIA+  L R++  
Sbjct: 114 GGGRIKVNKIDGIEVNFSGVLPTLIVNNIDAPGHVAAVAGTLSRSGFNIANMQLYRNKRG 173

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  + +D  +   +++++     +  V   
Sbjct: 174 GTAVMIVEMDQKMSPELIKEVESLKGVLRVTYV 206


>gi|84489937|ref|YP_448169.1| D-3-phosphoglycerate dehydrogenase [Methanosphaera stadtmanae DSM
           3091]
 gi|84373256|gb|ABC57526.1| SerA [Methanosphaera stadtmanae DSM 3091]
          Length = 524

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 46/97 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  + + + I I + +  + +   M  I   D+ G +  +G ILG+Y INIA   +GR  
Sbjct: 428 VVENNEAKIISIDDYDVRLTLEGKMAIIKYVDLPGTIGKIGKILGDYKINIAEMQVGRQT 487

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI  L +D  I   V+ KL  +  I FVK  + 
Sbjct: 488 EGGEAIMVLKVDQEITEEVVSKLEDDNDIDFVKPVKL 524


>gi|16330470|ref|NP_441198.1| D-3-phosphoglycerate dehydrogenase [Synechocystis sp. PCC 6803]
 gi|3122863|sp|P73821|SERA_SYNY3 RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|1652961|dbj|BAA17878.1| phosphoglycerate dehydrogenase [Synechocystis sp. PCC 6803]
          Length = 554

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 47/92 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S+G+ R   + E   +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 458 LLSNGEIRITDVDEFPINVPPNNYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 517

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               AI  L +D  + + +L +++    IR  
Sbjct: 518 VRGDAIMALSLDDPLPDGLLSEITKVAGIRDA 549


>gi|242242988|ref|ZP_04797433.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis W23144]
 gi|242233589|gb|EES35901.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis W23144]
          Length = 531

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I + + D    +  +   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VFAGFGPRIVRINDYSLDFKPNQYQLVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRND 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           +   A+  L ID      V++ L+       +
Sbjct: 493 AGGDALMILSIDQQASEEVIKILNETSGFNKI 524


>gi|27468319|ref|NP_764956.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis ATCC
           12228]
 gi|57867245|ref|YP_188860.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           RP62A]
 gi|251811113|ref|ZP_04825586.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282875855|ref|ZP_06284722.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis SK135]
 gi|293366330|ref|ZP_06613010.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27315865|gb|AAO05000.1|AE016748_234 D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis ATCC
           12228]
 gi|57637903|gb|AAW54691.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           RP62A]
 gi|251805333|gb|EES57990.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281294880|gb|EFA87407.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis SK135]
 gi|291319568|gb|EFE59934.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329737454|gb|EGG73708.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU028]
 gi|329737488|gb|EGG73741.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU045]
          Length = 531

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I + + D    +  +   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VFAGFGPRIVRINDYSLDFKPNQYQLVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRND 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           +   A+  L ID      V++ L+       +
Sbjct: 493 AGGDALMILSIDQQASEEVIKILNETSGFNKI 524


>gi|110598440|ref|ZP_01386712.1| D-3-phosphoglycerate dehydrogenase [Chlorobium ferrooxidans DSM
           13031]
 gi|110339974|gb|EAT58477.1| D-3-phosphoglycerate dehydrogenase [Chlorobium ferrooxidans DSM
           13031]
          Length = 526

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 46/95 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D + R + I +   +      +I   N D  G++  V  +L ++ +N+A+  L R +
Sbjct: 430 VFGDKEIRIVMIDQFLVEFKPEGHIIIYNNIDKPGVIAHVTQLLLQHNLNVAYVALSRDE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             + A++ + +DG + +++L+ +S    +      
Sbjct: 490 EKKVAMTAIVVDGEVSDALLQAVSSVNGVSSANLV 524


>gi|89099089|ref|ZP_01171968.1| phosphoglycerate dehydrogenase [Bacillus sp. NRRL B-14911]
 gi|89086219|gb|EAR65341.1| phosphoglycerate dehydrogenase [Bacillus sp. NRRL B-14911]
          Length = 524

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 41/91 (45%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR + +   N D      ++ I + D  G++  VG +LG++ INIA   +GR ++   AI
Sbjct: 434 PRIVFLNGFNIDFLPEGELLYIQHMDRPGVIGRVGKVLGDHSINIAAMQVGRKEAGGEAI 493

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             L  D  +  S  + L     I  ++    
Sbjct: 494 MVLSFDKPLGESSFKLLEGQEDIVSIRNISL 524


>gi|282899725|ref|ZP_06307688.1| D-3-phosphoglycerate dehydrogenase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195340|gb|EFA70274.1| D-3-phosphoglycerate dehydrogenase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 526

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  + +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGEKEIHLTDVDGFPINVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  + + +LE++     IR  
Sbjct: 490 VRGDAVMALSIDDPLPDGILEEIKQVSGIRDA 521


>gi|319401036|gb|EFV89255.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis FRI909]
          Length = 531

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I + + D    +  +   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VFAGFGPRIVRINDYSLDFKPNQYQLVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRND 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           +   A+  L ID      V++ L+       +
Sbjct: 493 AGGDALMILSIDQQASEEVIKILNETSGFNKI 524


>gi|148926576|ref|ZP_01810258.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|145845270|gb|EDK22364.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8486]
          Length = 529

 Score = 98.6 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++ + R + +     D      MI   N DI G++  + ++L    INIA F LGR  
Sbjct: 434 VFNENEQRIVGLNGFKTDFKPKGKMIIFKNKDIPGVIAKISSVLATKNINIADFRLGRDG 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +A++ + ID  +   VL++L       FV+  E 
Sbjct: 494 FG-YALAVVLIDEKVQKEVLDELKQLEVCVFVQYVEI 529


>gi|256396892|ref|YP_003118456.1| D-3-phosphoglycerate dehydrogenase [Catenulispora acidiphila DSM
           44928]
 gi|256363118|gb|ACU76615.1| D-3-phosphoglycerate dehydrogenase [Catenulispora acidiphila DSM
           44928]
          Length = 535

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 39/91 (42%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + +++     DV I   ++ +   D  G+V  +G +LG  GINI    + R+     A+ 
Sbjct: 444 KIVEVDGFQLDVTIAEHLLFLRYTDRPGVVGQLGGVLGAAGINIGGMQVARAAKGGEALV 503

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D  +   +LE++   +    V      
Sbjct: 504 ALTVDSVVPAGLLEEIKAAIGATAVHSISLE 534


>gi|222151058|ref|YP_002560212.1| L-serine dehydratase beta subunit [Macrococcus caseolyticus
           JCSC5402]
 gi|222120181|dbj|BAH17516.1| L-serine dehydratase beta subunit [Macrococcus caseolyticus
           JCSC5402]
          Length = 221

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 38/94 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   + +      +      + + + D  G +  V +IL E+ IN+    + R +  
Sbjct: 126 GGGKIEIVALNGFPIAISGNYPALLVFHKDTFGTIAKVTSILSEHKINVGQMQVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+    +D  I + VLE++     I+ V    
Sbjct: 186 DLALMTCELDDEITDDVLEQIRRCEGIQTVTLMT 219


>gi|312880178|ref|ZP_07739978.1| D-3-phosphoglycerate dehydrogenase [Aminomonas paucivorans DSM
           12260]
 gi|310783469|gb|EFQ23867.1| D-3-phosphoglycerate dehydrogenase [Aminomonas paucivorans DSM
           12260]
          Length = 549

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 48/92 (52%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +G+ R +++ +   D+     ++   N D  G++  VG +LG+ G+NIA+F LGR  
Sbjct: 449 VTEEGRQRVVRLDDYWLDLIPSGRLLLFQNHDRPGVIGKVGTLLGQAGVNIANFALGRKN 508

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
            +  A++ L ID  +   +L  L  +  + + 
Sbjct: 509 GSGLALAALQIDQELGEELLSTLRHDGDLIWA 540


>gi|284992450|ref|YP_003411004.1| D-3-phosphoglycerate dehydrogenase [Geodermatophilus obscurus DSM
           43160]
 gi|284065695|gb|ADB76633.1| D-3-phosphoglycerate dehydrogenase [Geodermatophilus obscurus DSM
           43160]
          Length = 533

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 1   VFSDGK-PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           +F   + P+ +++   + D+D    ++  V  D  G+V  VG  LGE GINIA   + R+
Sbjct: 433 LFGKNQVPKLVEVNGFDMDLDAAGYLLFFVYTDRPGVVGTVGAALGEAGINIAGAQVSRT 492

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
                A+  + +D  +   +L  ++  +  R  +
Sbjct: 493 TRGGEALMAVTVDSPVPAELLGDIAGRIGAREAR 526


>gi|282895559|ref|ZP_06303693.1| D-3-phosphoglycerate dehydrogenase [Raphidiopsis brookii D9]
 gi|281199399|gb|EFA74263.1| D-3-phosphoglycerate dehydrogenase [Raphidiopsis brookii D9]
          Length = 526

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  + +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGEKEIHLTDVDGFPINVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  + + +LE++     IR  
Sbjct: 490 VRGDAVMALSIDDPLPDGILEEIKQVSGIRDA 521


>gi|225849892|ref|YP_002730126.1| D-3-phosphoglycerate dehydrogenase [Persephonella marina EX-H1]
 gi|225646129|gb|ACO04315.1| phosphoglycerate dehydrogenase [Persephonella marina EX-H1]
          Length = 529

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 47/94 (50%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F    P+ + I     D+D   +++   N D+ G++  +G IL  + INIA F LGR + 
Sbjct: 434 FYGKFPKIMLIDRYWIDIDPEGVILVFENKDVPGVIAKLGEILARHNINIAGFRLGRLEK 493

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            + A+  L +D  I  ++LE++     I   K+ 
Sbjct: 494 GKIALGALQLDERINEAILEEIQNIPEIIKAKEI 527


>gi|158522862|ref|YP_001530732.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
 gi|158511688|gb|ABW68655.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
          Length = 527

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 41/98 (41%), Gaps = 1/98 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F    PR ++I +   DV     M+ I++ +  G++  +G   GE G+NI  F +G   
Sbjct: 430 LFGKIYPRIVEINDFRVDVSPEGHMLIILSENKPGVIGRIGTTFGEGGVNIVRFMVGNEA 489

Query: 61  -STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +  +  +  D  +   +LE L     I       F
Sbjct: 490 IEGQKNMVIIKTDEPVPADILETLKSKKVIFEATSVNF 527


>gi|307265064|ref|ZP_07546624.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919862|gb|EFN50076.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 533

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 45/93 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++      + +    M+ + N D+ G++  +GN LG++GINI+   +  +++  
Sbjct: 438 GEEIRIVEYMGHKVNFEPTEHMLFVKNKDVPGVIGHIGNALGDFGINISTMQVSPNKNDG 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  +  D  I +  +E L+   +I   +  +
Sbjct: 498 TALMIVSTDKEIPDEAVESLNKLNSIIKARAVK 530


>gi|118474999|ref|YP_892404.1| D-3-phosphoglycerate dehydrogenase [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118414225|gb|ABK82645.1| D-3-phosphoglycerate dehydrogenase [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 525

 Score = 98.2 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + +     D      MI   N D+ G++  + +IL E  INIA F LGR  
Sbjct: 430 VFGETEQRIVNVNGFKTDFKPKGRMIVFKNTDVPGVISSISSILAEEKINIADFRLGRDD 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
           +   A++ + +D  I   +L KL+   T  + + 
Sbjct: 490 N-GFALAVILVDDDIKKDILAKLNALETCVWAEY 522


>gi|295836361|ref|ZP_06823294.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB74]
 gi|295825983|gb|EFG64595.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB74]
          Length = 531

 Score = 98.2 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E   D+ +   M+ +  AD  G+V  VG +LGE GINIA   + R++    A++
Sbjct: 441 KIVAIGEHTVDLALADHMVVLRYADRPGVVGTVGRVLGEAGINIAGMQVSRAEEGGEALA 500

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D S+   VL +++        +    
Sbjct: 501 VLTVDDSVPADVLAEVAQETGATSARAVNL 530


>gi|166032443|ref|ZP_02235272.1| hypothetical protein DORFOR_02158 [Dorea formicigenerans ATCC
           27755]
 gi|166028166|gb|EDR46923.1| hypothetical protein DORFOR_02158 [Dorea formicigenerans ATCC
           27755]
          Length = 224

 Score = 98.2 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 33/96 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R   +  I  D       + + N D  G +  V   L    IN+A   + R +  
Sbjct: 125 GGGRIRVSILDGIEVDFSGESNTLIVRNIDRPGCITEVTAALSHEKINVATMQVFRHKRG 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
             A+  +  D SI  +V  +L     I  V      
Sbjct: 185 GSAVMVVETDQSIPENVAVELKKKEDILEVILLNLE 220


>gi|206901901|ref|YP_002251552.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
 gi|206741004|gb|ACI20062.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
          Length = 525

 Score = 98.2 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/90 (31%), Positives = 48/90 (53%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           S G+ R + IQ+   D+ + + ++   + D  GI+  VG +LG+  INIA   +GR +  
Sbjct: 431 SRGQERVLAIQDYYLDLALSQYLLIAFHIDRPGIIGKVGTVLGKNNINIAAMQVGRKEIG 490

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  L ID  +   VL++L     I+ V
Sbjct: 491 KDAVMVLVIDNPVDEKVLKELREIENIKEV 520


>gi|153814124|ref|ZP_01966792.1| hypothetical protein RUMTOR_00333 [Ruminococcus torques ATCC 27756]
 gi|317499930|ref|ZP_07958166.1| hypothetical protein HMPREF1026_00108 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331087847|ref|ZP_08336772.1| L-serine dehydratase [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145848520|gb|EDK25438.1| hypothetical protein RUMTOR_00333 [Ruminococcus torques ATCC 27756]
 gi|316898647|gb|EFV20682.1| hypothetical protein HMPREF1026_00108 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330409542|gb|EGG88983.1| L-serine dehydratase [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 228

 Score = 98.2 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 40/93 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R  +I E+  D       + ++  D  G++  + N L E  +NIA+  L R +  
Sbjct: 128 GGGKIRIARINEVEVDFTGEYSTLIVIQQDKPGVIAHITNCLSEMNVNIAYMKLYREEKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A S +  DG +  +V  ++  N  +  V   
Sbjct: 188 CTAYSIVESDGIVPQTVAGRIKENPYVHDVMLV 220


>gi|242309369|ref|ZP_04808524.1| d-3-phosphoglycerate dehydrogenase [Helicobacter pullorum MIT
           98-5489]
 gi|239523940|gb|EEQ63806.1| d-3-phosphoglycerate dehydrogenase [Helicobacter pullorum MIT
           98-5489]
          Length = 117

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF++  P+ ++I     D++    MI   N D  G++  VG  L +Y INIA F LGR  
Sbjct: 23  VFNEDTPKIVEINHFEMDIEPKGRMILFRNNDTPGVIGHVGTTLAKYNINIADFRLGRY- 81

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             + A++ + +D  + N V+++LS       +K  
Sbjct: 82  -GKEALAVILVDDEVSNEVIKELSSIKACLAIKYV 115


>gi|11498419|ref|NP_069647.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus fulgidus DSM
           4304]
 gi|3122861|sp|O29445|SERA_ARCFU RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|2649798|gb|AAB90429.1| phosphoglycerate dehydrogenase (serA) [Archaeoglobus fulgidus DSM
           4304]
          Length = 527

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 38/96 (39%), Gaps = 2/96 (2%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR--SQS 61
             + R +KI   N +       I  ++ D  G++  VG + G   INIA   +GR   + 
Sbjct: 432 GNEYRILKIDVYNVNFVPKGHYIISLHEDKPGVIGRVGTLFGRNNINIAGMIVGRSGDKP 491

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               +  L +D      VLE+++    I      E 
Sbjct: 492 GGIQLMLLLVDDPPTPEVLEEMTKLDGIIDATYVEL 527


>gi|253580324|ref|ZP_04857590.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848417|gb|EES76381.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Ruminococcus sp. 5_1_39BFAA]
          Length = 222

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 41/95 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R +KI  +  D       + +++ D  G+V ++   L +  INIA   L R    
Sbjct: 128 GGGKVRIVKINHVQVDFTGEYSAVIVIHQDTPGVVAYITKCLSDRNINIAFMRLFREGKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + A + +  DG +  +++  +  N  I  V   + 
Sbjct: 188 DIAYTIVESDGKLPENIVPAIRENPNIHEVMIVQM 222


>gi|307352504|ref|YP_003893555.1| D-3-phosphoglycerate dehydrogenase [Methanoplanus petrolearius DSM
           11571]
 gi|307155737|gb|ADN35117.1| D-3-phosphoglycerate dehydrogenase [Methanoplanus petrolearius DSM
           11571]
          Length = 528

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 45/92 (48%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           K R +KI E   D+  G  ++   + D+ G++     I+G+YG+NIA   +GR+Q  E A
Sbjct: 437 KLRIVKIGEYMTDMTPGGDVVISRHHDVPGVIGHFATIIGKYGVNIAGMQVGRNQPGEEA 496

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +  L +D  +    ++K+     +   K    
Sbjct: 497 VMVLNVDSEVPQEAMDKILKIEGVYTAKYAHI 528


>gi|21227855|ref|NP_633777.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina mazei Go1]
 gi|20906268|gb|AAM31449.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina mazei Go1]
          Length = 540

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 41/94 (43%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             +P+ + I +   D+     MI   + +   ++     +LG+  INI+   +GRS+   
Sbjct: 447 GDEPKIVSIDDDKVDIFPAGRMIFAKHINKPNVIGPCCMVLGKNNINISGMQVGRSEVGG 506

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             +  L +D  + +++L+++     I   K    
Sbjct: 507 VTMMVLNVDTDVSDAILDEVRQVPGILNAKLVTL 540


>gi|282861276|ref|ZP_06270341.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. ACTE]
 gi|282563934|gb|EFB69471.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. ACTE]
          Length = 530

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R  +   A+ 
Sbjct: 439 KIVAIGEHDVDLALADHMVVLRYEDRPGVVGAVGKILGEAGLNIAGMQVSRQDAGGEALV 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D +I  SVL +++  +     +    
Sbjct: 499 VLTVDDTIPQSVLSEIAEEIGATSARSVNL 528


>gi|255658218|ref|ZP_05403627.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Mitsuokella multacida DSM 20544]
 gi|260849527|gb|EEX69534.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Mitsuokella multacida DSM 20544]
          Length = 220

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 32/93 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  R   I     ++      +  ++ D  GI+  V  IL  Y  NIA   + R    
Sbjct: 125 GGGNIRITNIDGYEVELTGTYPALITIHHDRPGIITKVTQILARYEYNIAFMRVSRHSRG 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E A+  L +D  +   V+ +      +      
Sbjct: 185 EMAMMILELDEPLDEDVVAECCEVYEVEHAFAI 217


>gi|226225601|ref|YP_002759707.1| D-3-phosphoglycerate dehydrogenase [Gemmatimonas aurantiaca T-27]
 gi|226088792|dbj|BAH37237.1| D-3-phosphoglycerate dehydrogenase [Gemmatimonas aurantiaca T-27]
          Length = 534

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 47/94 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
            G PR  +I   + DV+  + ++ + N D+ G++  VG +LGE G+NIA +H  R     
Sbjct: 438 GGTPRLTRIGSFHVDVNPRQTLLVLTNHDVPGVIGRVGTLLGERGVNIAEYHQARLAQGG 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A++ + +DG++     + L     +R      F
Sbjct: 498 DALAAVSVDGTVSEETRKALLELSDVRSASIVHF 531


>gi|307152719|ref|YP_003888103.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7822]
 gi|306982947|gb|ADN14828.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7822]
          Length = 525

 Score = 97.8 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 45/92 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  +G+ R   + E   +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLGNGEIRITDLDEFPINVPPSNYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L +D  +   +L +++    IR  
Sbjct: 489 VRGDAVMALSLDDPLPEGILSEITKVAGIRDA 520


>gi|312142859|ref|YP_003994305.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Halanaerobium sp. 'sapolanicus']
 gi|311903510|gb|ADQ13951.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Halanaerobium sp. 'sapolanicus']
          Length = 220

 Score = 97.8 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 39/93 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I      +      + I + D  G +  + ++LG++ INIA   + R++  
Sbjct: 125 GGGSIEVREINGSAVKLTGRLPTLWIRHKDRPGEIALITSVLGKHQINIAFMQVYRNRRG 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           +   S L +D     +VL++L     I  ++  
Sbjct: 185 DIGSSILELDQKPPQAVLDELEKCKDIYQLRYL 217


>gi|255322493|ref|ZP_05363638.1| phosphoglycerate dehydrogenase [Campylobacter showae RM3277]
 gi|255300401|gb|EET79673.1| phosphoglycerate dehydrogenase [Campylobacter showae RM3277]
          Length = 525

 Score = 97.8 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + I     D      MI   N D+ G++  + +IL E  INIA F LGR  
Sbjct: 430 VFGENQQRIVTINGFKTDFKPKGKMIIFKNNDVPGVIAKISSILAEEKINIADFRLGRDD 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
               A++ + +D  I    L KL+      + K 
Sbjct: 490 H-GMALAVVLVDEKITKETLAKLNDLDVCVWAKY 522


>gi|218441675|ref|YP_002380004.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7424]
 gi|218174403|gb|ACK73136.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7424]
          Length = 527

 Score = 97.8 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 49/99 (49%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + S+G+ R   + E   +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSNGEIRITDLDEFPINVPPSNYMLFTLHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
               A+  L +D  +   +L +++    IR     + ++
Sbjct: 489 VRGDAVMALSLDDPLPEGILSEITKVAGIRDAYTVKLSI 527


>gi|320170533|gb|EFW47432.1| D-3-phosphoglycerate dehydrogenase [Capsaspora owczarzaki ATCC
           30864]
          Length = 552

 Score = 97.8 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF     RF +I +  F+V     ++   N D  G++  +G  L +  INIA   LGR  
Sbjct: 456 VFGTNNLRFTRIDQFAFEVRPAGHLMFYRNEDKPGVIAAIGTHLAQASINIADLTLGRDD 515

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           S   A+  +  D  I   VL+++     I + +    
Sbjct: 516 SKREALCIVNTDQPIPADVLQRIQQTSFITYARTVTL 552


>gi|314951399|ref|ZP_07854451.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX0133A]
 gi|314991328|ref|ZP_07856807.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX0133B]
 gi|313594101|gb|EFR72946.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX0133B]
 gi|313596457|gb|EFR75302.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX0133A]
          Length = 225

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 40/93 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G   + +V+ D+ G++  V +IL E   NI    + R    
Sbjct: 132 GGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKG 191

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E+AI  + +D   +   +++L     I  V  F
Sbjct: 192 ENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYF 224


>gi|317050372|ref|YP_004111488.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
 gi|316945456|gb|ADU64932.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
          Length = 520

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +D  PR +++ E   +      M+   N D  G++  +G +LGE  IN+A+  LG   
Sbjct: 424 LLADKFPRIVEVNEYKIEAVPQGTMLFFRNYDRPGVIGSLGRLLGEKNINVANMRLGFRG 483

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + AI+ + ID ++  + L++++    I    Q EF
Sbjct: 484 D-DEAIAMVNIDTAVDAATLQEITRLDNIIDCFQLEF 519


>gi|261209270|ref|ZP_05923662.1| L-serine dehydratase [Enterococcus faecium TC 6]
 gi|289566019|ref|ZP_06446457.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium D344SRF]
 gi|294616177|ref|ZP_06695974.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium E1636]
 gi|260076816|gb|EEW64551.1| L-serine dehydratase [Enterococcus faecium TC 6]
 gi|289162217|gb|EFD10079.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium D344SRF]
 gi|291590932|gb|EFF22644.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium E1636]
          Length = 222

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 40/93 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G   + +V+ D+ G++  V +IL E   NI    + R    
Sbjct: 129 GGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E+AI  + +D   +   +++L     I  V  F
Sbjct: 189 ENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYF 221


>gi|288919125|ref|ZP_06413464.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EUN1f]
 gi|288349469|gb|EFC83707.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EUN1f]
          Length = 529

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 40/93 (43%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           +   I     D+     +      D  GIV  VG +LGE  INIA+  + R  +   A+ 
Sbjct: 437 KITAIDGFEVDLRPENHLAFFRYEDRPGIVGAVGALLGEAHINIANAQVSRLSAGGEALM 496

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            L +D ++   +L +++  +   + +    + D
Sbjct: 497 SLSLDDAVAPDILTEIAKIIGASYARAVSISTD 529


>gi|323440732|gb|EGA98441.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus O11]
          Length = 534

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|188996207|ref|YP_001930458.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931274|gb|ACD65904.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 529

 Score = 97.4 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 47/92 (51%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           D  PR + +     D++   +++   N D+ G++  +G +L ++ +NIA F LGR +  +
Sbjct: 436 DKFPRIMMVDNYWIDIEPQGVILMFENKDVPGVIGKLGTLLAKHNVNIAGFRLGRLEKGK 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            A+  L +D  +   VLE++     I   KQ 
Sbjct: 496 IALGALQLDDRLNEEVLEEIHQIPEIIKAKQV 527


>gi|283470989|emb|CAQ50200.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 534

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|291519798|emb|CBK75019.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Butyrivibrio fibrisolvens 16/4]
          Length = 219

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 35/92 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    ++  ++         + + N D  G +  V  +LG  GINIA   L R    
Sbjct: 124 GGGRIEVCQLDGVDVSFSGESPTLIVHNVDQPGYITEVTRLLGTQGINIATMQLHRKNRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
             A+  +  D  +  +  ++LS    I  V  
Sbjct: 184 GEAVMVIECDDEVPVATRQELSTLEGILNVSY 215


>gi|320008407|gb|ADW03257.1| D-3-phosphoglycerate dehydrogenase [Streptomyces flavogriseus ATCC
           33331]
          Length = 530

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R  +   A+ 
Sbjct: 439 KIVAIGEHDVDLALADHMVVLRYEDRPGVVGAVGKILGEAGLNIAGMQVSRQDAGGEALV 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D +I  SVL +++  +     +    
Sbjct: 499 VLTVDDTIPQSVLTEIAEEIGAASARSVNL 528


>gi|257880341|ref|ZP_05659994.1| L-serine dehydratase [Enterococcus faecium 1,230,933]
 gi|257882195|ref|ZP_05661848.1| L-serine dehydratase [Enterococcus faecium 1,231,502]
 gi|257891000|ref|ZP_05670653.1| L-serine dehydratase [Enterococcus faecium 1,231,410]
 gi|257894254|ref|ZP_05673907.1| L-serine dehydratase [Enterococcus faecium 1,231,408]
 gi|258614708|ref|ZP_05712478.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium DO]
 gi|260562355|ref|ZP_05832869.1| L-serine dehydratase [Enterococcus faecium C68]
 gi|293559852|ref|ZP_06676366.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium E1162]
 gi|293568372|ref|ZP_06679693.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium E1071]
 gi|294618919|ref|ZP_06698426.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium E1679]
 gi|294623145|ref|ZP_06702031.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium U0317]
 gi|314937973|ref|ZP_07845284.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX0133a04]
 gi|314944023|ref|ZP_07850708.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX0133C]
 gi|314948413|ref|ZP_07851801.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX0082]
 gi|314995334|ref|ZP_07860440.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX0133a01]
 gi|257814569|gb|EEV43327.1| L-serine dehydratase [Enterococcus faecium 1,230,933]
 gi|257817853|gb|EEV45181.1| L-serine dehydratase [Enterococcus faecium 1,231,502]
 gi|257827360|gb|EEV53986.1| L-serine dehydratase [Enterococcus faecium 1,231,410]
 gi|257830633|gb|EEV57240.1| L-serine dehydratase [Enterococcus faecium 1,231,408]
 gi|260073279|gb|EEW61620.1| L-serine dehydratase [Enterococcus faecium C68]
 gi|291588893|gb|EFF20720.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium E1071]
 gi|291594835|gb|EFF26205.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium E1679]
 gi|291597514|gb|EFF28679.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium U0317]
 gi|291606188|gb|EFF35608.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium E1162]
 gi|313590427|gb|EFR69272.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX0133a01]
 gi|313597368|gb|EFR76213.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX0133C]
 gi|313642648|gb|EFS07228.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX0133a04]
 gi|313645138|gb|EFS09718.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX0082]
          Length = 222

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 40/93 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G   + +V+ D+ G++  V +IL E   NI    + R    
Sbjct: 129 GGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E+AI  + +D   +   +++L     I  V  F
Sbjct: 189 ENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYF 221


>gi|282911349|ref|ZP_06319151.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282325044|gb|EFB55354.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|312437820|gb|ADQ76891.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH60]
          Length = 534

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|219851104|ref|YP_002465536.1| D-3-phosphoglycerate dehydrogenase [Methanosphaerula palustris
           E1-9c]
 gi|219545363|gb|ACL15813.1| D-3-phosphoglycerate dehydrogenase [Methanosphaerula palustris
           E1-9c]
          Length = 532

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 43/97 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFS  + R + I     D+D    ++   + D  G++     ILG   +NIA   +GR +
Sbjct: 436 VFSKVRSRIVAIGGYTMDLDPTGFLVISRHLDKPGVIGRASTILGHCEVNIAGMQVGRIR 495

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             E AI  L +D  + +  ++++     I   K  + 
Sbjct: 496 PGEEAIMVLNVDSEVSDEAMDEIRSMPGIFSAKFAQI 532


>gi|257431137|ref|ZP_05607514.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257278085|gb|EEV08733.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 68-397]
          Length = 534

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|310642598|ref|YP_003947356.1| d-3-phosphoglycerate dehydrogenase [Paenibacillus polymyxa SC2]
 gi|309247548|gb|ADO57115.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus polymyxa SC2]
          Length = 530

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 44/98 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +    R +++ +   DV      + I + D  GI+  VG +LGE  +NIA   +GR  
Sbjct: 433 LLAGYGERIVRLNQFPVDVAPEAHFLLISHNDKPGIIGRVGTLLGENSVNIASMQVGRKI 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
               AI  L +D ++   VL +L     +   ++   +
Sbjct: 493 VGGEAIMILTVDKAVPKDVLIQLVGLPELNTAQEVVLD 530


>gi|82751311|ref|YP_417052.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus RF122]
 gi|82656842|emb|CAI81271.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus RF122]
          Length = 534

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|225165807|ref|ZP_03727591.1| D-3-phosphoglycerate dehydrogenase [Opitutaceae bacterium TAV2]
 gi|224799953|gb|EEG18398.1| D-3-phosphoglycerate dehydrogenase [Opitutaceae bacterium TAV2]
          Length = 529

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 41/94 (43%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + +PR + I     +V     ++ + N D  G+V  VG +LG  G+NIA   L R     
Sbjct: 436 NNEPRVVGINGREVEVAAEGQLLVLENTDKPGMVGMVGTLLGNDGVNIADMSLTRLILGG 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A   + +D     +  + L  N  ++F K  + 
Sbjct: 496 TAYMVVRVDHEPSPTARKALKDNPAVKFAKFVQL 529


>gi|300087849|ref|YP_003758371.1| D-3-phosphoglycerate dehydrogenase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527582|gb|ADJ26050.1| D-3-phosphoglycerate dehydrogenase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 526

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 43/96 (44%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F   +   ++I +   D+  G   +   + D  G++  VG I G+  +N+++ HL R + 
Sbjct: 431 FLRDQVHIVRINDYWIDITPGGFFLFADHRDRPGLIGAVGGITGKADVNVSYMHLSRLKP 490

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              A+  L +D S+ ++ L ++     +   K    
Sbjct: 491 RGQALMVLALDESLSDADLAEIRSLDGVNSAKMVSL 526


>gi|17229382|ref|NP_485930.1| D-3-phosphoglycerate dehydrogenase [Nostoc sp. PCC 7120]
 gi|17130980|dbj|BAB73589.1| phosphoglycerate dehydrogenase [Nostoc sp. PCC 7120]
          Length = 526

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGDKEIHLTDVDGFPINVPPSKYMVFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  + + +L +++    IR  
Sbjct: 490 VRGDAVMALSIDDPLPDGILAEITKVPGIRDA 521


>gi|298694992|gb|ADI98214.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED133]
          Length = 534

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|257885388|ref|ZP_05665041.1| L-serine dehydratase [Enterococcus faecium 1,231,501]
 gi|257821244|gb|EEV48374.1| L-serine dehydratase [Enterococcus faecium 1,231,501]
          Length = 222

 Score = 97.4 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 39/93 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G   + +V+ D+ G++  V +IL E   NI    + R    
Sbjct: 129 GGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E AI  + +D   +   +++L     I  V  F
Sbjct: 189 ESAIMIIEVDNPQVEETVKRLKQLPNIDSVNYF 221


>gi|15615060|ref|NP_243363.1| L-serine dehydratase beta subunit [Bacillus halodurans C-125]
 gi|10175117|dbj|BAB06216.1| L-serine dehydratase beta subunit [Bacillus halodurans C-125]
          Length = 220

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 45/94 (47%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      I +V+ D  G++  V N+L ++ INI H  + R +  
Sbjct: 126 GGGKIEIVELNGFHLKLSGNHPAILVVHTDRFGVIASVSNMLAKHEINIGHMEVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+  + +D ++ + +L++L     I  V +  
Sbjct: 186 KEALMVIEVDQNVDDLLLQELERLPNIVTVTKIH 219


>gi|152992147|ref|YP_001357868.1| D-3-phosphoglycerate dehydrogenase [Sulfurovum sp. NBC37-1]
 gi|151424008|dbj|BAF71511.1| D-3-phosphoglycerate dehydrogenase [Sulfurovum sp. NBC37-1]
          Length = 529

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D   R I+I +   DV+    MI   N D  G++  VG IL E G+NI+ F LGR +
Sbjct: 434 VFDDTVQRIIEIDDYILDVEPKGTMIFFRNTDTPGVIGDVGRILAENGLNISDFRLGRDK 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             + A++ + +DG +   VL+ LS       V
Sbjct: 494 K-QQALAVVRVDGQVSKEVLDALSALKACISV 524


>gi|49483964|ref|YP_041188.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|253734492|ref|ZP_04868657.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257425837|ref|ZP_05602261.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428503|ref|ZP_05604901.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257436736|ref|ZP_05612780.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282904293|ref|ZP_06312181.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C160]
 gi|282906118|ref|ZP_06313973.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282909033|ref|ZP_06316851.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282914518|ref|ZP_06322304.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282919486|ref|ZP_06327221.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282924864|ref|ZP_06332530.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C101]
 gi|283958473|ref|ZP_06375924.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293503596|ref|ZP_06667443.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510612|ref|ZP_06669317.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M809]
 gi|293537153|ref|ZP_06671833.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|295428293|ref|ZP_06820922.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297590744|ref|ZP_06949382.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|49242093|emb|CAG40792.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|253727546|gb|EES96275.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257271531|gb|EEV03677.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275344|gb|EEV06831.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257284087|gb|EEV14210.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282313230|gb|EFB43626.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317296|gb|EFB47670.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282321699|gb|EFB52024.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282327297|gb|EFB57592.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331410|gb|EFB60924.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282595911|gb|EFC00875.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C160]
 gi|283790622|gb|EFC29439.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290919998|gb|EFD97066.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095262|gb|EFE25527.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466503|gb|EFF09024.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M809]
 gi|295127693|gb|EFG57330.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297575630|gb|EFH94346.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|302333388|gb|ADL23581.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|315195627|gb|EFU26014.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS00]
 gi|323442972|gb|EGB00594.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus O46]
 gi|329733088|gb|EGG69425.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21193]
          Length = 534

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|21283395|ref|NP_646483.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49486548|ref|YP_043769.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|297207564|ref|ZP_06923999.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300911645|ref|ZP_07129089.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|21204835|dbj|BAB95531.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49244991|emb|CAG43452.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|296887581|gb|EFH26479.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300887066|gb|EFK82267.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH70]
          Length = 534

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|15924714|ref|NP_372248.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15927301|ref|NP_374834.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus N315]
 gi|148268202|ref|YP_001247145.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150394270|ref|YP_001316945.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156980041|ref|YP_001442300.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253315102|ref|ZP_04838315.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732373|ref|ZP_04866538.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|255006509|ref|ZP_05145110.2| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257794107|ref|ZP_05643086.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9781]
 gi|258415811|ref|ZP_05682082.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9763]
 gi|258420640|ref|ZP_05683579.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9719]
 gi|258438290|ref|ZP_05689574.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9299]
 gi|258443748|ref|ZP_05692087.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A8115]
 gi|258445959|ref|ZP_05694135.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6300]
 gi|258448361|ref|ZP_05696478.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6224]
 gi|258454159|ref|ZP_05702130.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5937]
 gi|269203362|ref|YP_003282631.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282893218|ref|ZP_06301452.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8117]
 gi|282927853|ref|ZP_06335464.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A10102]
 gi|295406034|ref|ZP_06815842.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8819]
 gi|296276628|ref|ZP_06859135.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297245040|ref|ZP_06928917.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8796]
 gi|13701519|dbj|BAB42813.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus N315]
 gi|14247496|dbj|BAB57886.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|147741271|gb|ABQ49569.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946722|gb|ABR52658.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156722176|dbj|BAF78593.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253723895|gb|EES92624.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|257788079|gb|EEV26419.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9781]
 gi|257839404|gb|EEV63877.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9763]
 gi|257843244|gb|EEV67654.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9719]
 gi|257848334|gb|EEV72325.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9299]
 gi|257851154|gb|EEV75097.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A8115]
 gi|257855201|gb|EEV78140.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6300]
 gi|257858329|gb|EEV81214.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6224]
 gi|257863611|gb|EEV86368.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5937]
 gi|262075652|gb|ACY11625.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282590363|gb|EFB95442.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A10102]
 gi|282764536|gb|EFC04662.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8117]
 gi|285817406|gb|ADC37893.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 04-02981]
 gi|294969031|gb|EFG45052.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8819]
 gi|297178120|gb|EFH37368.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8796]
 gi|315130640|gb|EFT86626.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329727559|gb|EGG64015.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21172]
          Length = 534

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|57652022|ref|YP_186607.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87160337|ref|YP_494364.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195533|ref|YP_500339.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|151221829|ref|YP_001332651.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|161509939|ref|YP_001575598.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221142358|ref|ZP_03566851.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|258450882|ref|ZP_05698935.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5948]
 gi|262049037|ref|ZP_06021915.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus D30]
 gi|262051787|ref|ZP_06024004.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 930918-3]
 gi|294849885|ref|ZP_06790624.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9754]
 gi|304380684|ref|ZP_07363355.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|57286208|gb|AAW38302.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87126311|gb|ABD20825.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87203091|gb|ABD30901.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|150374629|dbj|BAF67889.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|160368748|gb|ABX29719.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|257861418|gb|EEV84226.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5948]
 gi|259160281|gb|EEW45308.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 930918-3]
 gi|259162854|gb|EEW47418.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus D30]
 gi|269941202|emb|CBI49590.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TW20]
 gi|294823224|gb|EFG39654.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9754]
 gi|302751550|gb|ADL65727.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304340791|gb|EFM06720.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|315197191|gb|EFU27530.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320141667|gb|EFW33502.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143821|gb|EFW35594.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|329314397|gb|AEB88810.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329726965|gb|EGG63422.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21189]
          Length = 534

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|284024770|ref|ZP_06379168.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 132]
          Length = 534

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|282924414|ref|ZP_06332087.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9765]
 gi|282592915|gb|EFB97918.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9765]
          Length = 534

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|282916984|ref|ZP_06324742.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283770802|ref|ZP_06343694.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
 gi|282319471|gb|EFB49823.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283460949|gb|EFC08039.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
          Length = 534

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|301122067|ref|XP_002908760.1| phosphoserine aminotransferase, putative [Phytophthora infestans
           T30-4]
 gi|262099522|gb|EEY57574.1| phosphoserine aminotransferase, putative [Phytophthora infestans
           T30-4]
          Length = 3635

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 51/101 (50%), Gaps = 3/101 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   + RF+   ++  D      M+   N D  G++  V ++L ++ INI +F L R +
Sbjct: 461 VFGKSQLRFVSFDDLPMDAIPSGSMLLFNNTDQPGVLHKVTSVLAKHQINIGNFGLAREK 520

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNV---TIRFVKQFEFN 98
           +T  A+S L +D +I + V+++L        +R V   E N
Sbjct: 521 ATAAAVSVLNVDEAIPDVVMDELEALGMLTDLRRVNLLELN 561


>gi|86742318|ref|YP_482718.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. CcI3]
 gi|86569180|gb|ABD12989.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. CcI3]
          Length = 529

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 40/93 (43%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           +   I     D+     +      D  GIV  VG +LGE  INIA   + R Q+   A+ 
Sbjct: 437 KITAIDGFEVDIRPEAHLAFFRYEDRPGIVGAVGALLGEAHINIASAQVSRLQAGGEALM 496

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            L +D ++   +L +++  +   + +    + D
Sbjct: 497 SLSLDDAVAPDILAEIAKIIGASYARAVSISSD 529


>gi|293557110|ref|ZP_06675665.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium E1039]
 gi|291600731|gb|EFF31028.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium E1039]
          Length = 222

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 40/93 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G   + +V+ D+ G++  V +IL E   NI    + R    
Sbjct: 129 GGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E+AI  + +D   +   +++L     I  V  F
Sbjct: 189 ENAIMIIEVDNPQVEETVKRLKQLPNIDSVNYF 221


>gi|157165087|ref|YP_001466441.1| D-3-phosphoglycerate dehydrogenase [Campylobacter concisus 13826]
 gi|112801635|gb|EAT98979.1| phosphoglycerate dehydrogenase [Campylobacter concisus 13826]
          Length = 525

 Score = 97.0 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 1/94 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + +     D      MI   N D+ G++  +  IL +  INIA F LGR +
Sbjct: 430 VFGENQQRIVTVNGFKTDFKPKGKMIIFKNHDVPGVIAQISKILADEKINIADFRLGRDE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
               A++ + +D  I    LE+L+      + + 
Sbjct: 490 H-GMALAVILVDEHIKTETLERLNALEACVWAQY 522


>gi|182435790|ref|YP_001823509.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326776414|ref|ZP_08235679.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
 gi|178464306|dbj|BAG18826.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|326656747|gb|EGE41593.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 530

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 44/94 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
               + + I E + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R+    
Sbjct: 435 KNLQKIVAIGEHDVDLALADHMVVLRYQDRPGVVGAVGKILGEAGLNIAGMQVSRAAEGG 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++  SVL ++S  +     +    
Sbjct: 495 EALVVLTVDETVPQSVLTEISEEIGASSARSVNL 528


>gi|257461292|ref|ZP_05626389.1| phosphoglycerate dehydrogenase [Campylobacter gracilis RM3268]
 gi|257441320|gb|EEV16466.1| phosphoglycerate dehydrogenase [Campylobacter gracilis RM3268]
          Length = 535

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 1/94 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   + R + I     D      MI   N D+ G++  V  IL +  INIA F LGR +
Sbjct: 440 VFDGSEERIVNIGGFKTDFKPKGKMIIFKNTDVPGVIKSVSTILADENINIADFRLGRGE 499

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
             + A++ + +D  +  S L+KL+   T   V+ 
Sbjct: 500 EGD-ALAVILVDSEVQKSTLDKLAALQTCLMVRY 532


>gi|304317984|ref|YP_003853129.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779486|gb|ADL70045.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 533

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 47/93 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++      + +    M+ + N DI G++  +GN+LG++GINIA  H+  +++  
Sbjct: 438 GDEIRIVEYLGHRVNFEPTEYMLFVRNKDIPGVIGHIGNVLGDFGINIASMHVSPNKNDG 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  +  D  I N  +E L+   +I   K  +
Sbjct: 498 TALMIVNTDREIPNEAVESLNKLNSILRAKAVK 530


>gi|20089481|ref|NP_615556.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina acetivorans C2A]
 gi|19914387|gb|AAM04036.1| phosphoglycerate dehydrogenase [Methanosarcina acetivorans C2A]
          Length = 523

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 41/94 (43%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             +P+ + I E   D+     MI   + +   ++     +LG+  INI+   +GRS+   
Sbjct: 430 GDEPKIVSIDEDRVDIFPAGRMIFAKHINKPNVIGPCCMVLGKNNINISGMQVGRSEVGG 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             +  L +D  + +++L+++     I   K    
Sbjct: 490 VTMMVLNVDTDVSDAILDEVRQVPGILNAKLVTL 523


>gi|294815271|ref|ZP_06773914.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
 gi|294327870|gb|EFG09513.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 538

 Score = 97.0 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
               + + I + + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R +   
Sbjct: 443 KNVQKIVAIGDHDVDLALADHMLVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRHEEGG 502

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++   V+ ++S  +     +    
Sbjct: 503 EALVVLTVDDTVPVPVIAEISAEIGAASARSVNL 536


>gi|328885238|emb|CCA58477.1| D-3-phosphoglycerate dehydrogenase [Streptomyces venezuelae ATCC
           10712]
          Length = 529

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + + + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R++    A+ 
Sbjct: 439 KIVAVGDYDVDLALADHMVVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRAEEGGEALV 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++   VL +++  +     +    
Sbjct: 499 VLTVDDTLPAPVLAEIAAEIGATSARSVNL 528


>gi|258424138|ref|ZP_05687020.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9635]
 gi|257845759|gb|EEV69791.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9635]
          Length = 534

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTK 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|186685295|ref|YP_001868491.1| D-3-phosphoglycerate dehydrogenase [Nostoc punctiforme PCC 73102]
 gi|186467747|gb|ACC83548.1| D-3-phosphoglycerate dehydrogenase [Nostoc punctiforme PCC 73102]
          Length = 526

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 20/92 (21%), Positives = 43/92 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  + +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGEREIHLTDVDGFPINVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  +   +L+++     IR  
Sbjct: 490 VRGDAVMALSIDDPLPEGILDEIIKVPGIRDA 521


>gi|312898434|ref|ZP_07757824.1| phosphoglycerate dehydrogenase [Megasphaera micronuciformis F0359]
 gi|310620353|gb|EFQ03923.1| phosphoglycerate dehydrogenase [Megasphaera micronuciformis F0359]
          Length = 538

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 39/96 (40%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F+  + + ++I E   D      ++   + D   ++  +  +LGE  INI    +G   
Sbjct: 435 LFNQTEAKIVQIDEYRVDFKPENYLLLAPHIDQPNMIGQIATVLGEAKINITGMQVGNMT 494

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
                I  + ++  I N V+ KL     I  +K   
Sbjct: 495 QKGTNIMAVAVEDDIPNDVMVKLRSINGILDMKLIH 530


>gi|237756137|ref|ZP_04584709.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237691701|gb|EEP60737.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 529

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 47/92 (51%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           D  PR + +     D++   +++   N D+ G++  +G +L ++ +NIA F LGR +  +
Sbjct: 436 DKFPRIMMVDNYWIDIEPQGVILMFENKDVPGVIGKLGTLLAKHNVNIAGFRLGRLEKGK 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            A+  L +D  +   +LE++     I   KQ 
Sbjct: 496 IALGALQLDDRLNEEILEEIHQIPEIIKAKQV 527


>gi|254392671|ref|ZP_05007846.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
 gi|197706333|gb|EDY52145.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 532

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
               + + I + + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R +   
Sbjct: 437 KNVQKIVAIGDHDVDLALADHMLVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRHEEGG 496

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++   V+ ++S  +     +    
Sbjct: 497 EALVVLTVDDTVPVPVIAEISAEIGAASARSVNL 530


>gi|323489546|ref|ZP_08094773.1| L-serine dehydratase subunit beta [Planococcus donghaensis MPA1U2]
 gi|323396677|gb|EGA89496.1| L-serine dehydratase subunit beta [Planococcus donghaensis MPA1U2]
          Length = 220

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 38/93 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      I +V+ D  G +  V N L +Y INI H  + R +  
Sbjct: 126 GGGKIEITELNGFPLRLSGNHPAILVVHEDRSGCIANVANCLYKYNINIGHMEVSRKERG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  + +D ++   V+E L     I  V + 
Sbjct: 186 HMALMVIEVDQNVDKEVMEDLRKLPNITQVTRI 218


>gi|254518005|ref|ZP_05130061.1| L-serine dehydratase beta subunit [Clostridium sp. 7_2_43FAA]
 gi|226911754|gb|EEH96955.1| L-serine dehydratase beta subunit [Clostridium sp. 7_2_43FAA]
          Length = 226

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 39/94 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G    ++I             I   + DI G V  V NIL +  +NIA  +LGRSQ  
Sbjct: 127 GGGNIEIVEINGNKVKFTGAYATIITSHRDIPGTVAKVTNILYDNKVNIAFLNLGRSQRG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           ++A     +D  I N ++EK+     I  V    
Sbjct: 187 KNATMTFEVDSKISNELIEKIKKVEGIEKVILIN 220


>gi|239826577|ref|YP_002949201.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Geobacillus sp. WCH70]
 gi|239806870|gb|ACS23935.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Geobacillus sp. WCH70]
          Length = 220

 Score = 96.6 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 42/93 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++      +      + I++ D  G +  V N+L +Y INI H  + R +  
Sbjct: 126 GGGKIEIIELNGFELKLSGHHPALLIMHNDRYGAIASVANVLAKYAINIGHMEVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A+  + ID  I  +V+++L+    I  V   
Sbjct: 186 KEALMTIEIDQPIDQTVIDELTALPHIIQVTNI 218


>gi|313679957|ref|YP_004057696.1| d-3-phosphoglycerate dehydrogenase [Oceanithermus profundus DSM
           14977]
 gi|313152672|gb|ADR36523.1| D-3-phosphoglycerate dehydrogenase [Oceanithermus profundus DSM
           14977]
          Length = 520

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 40/73 (54%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G+PR ++I +   +++    ++  +N D  G+V  VG +LGE G+NIA   LGR Q    
Sbjct: 428 GRPRLVRIDDYALEIEPTGAVLVCINRDQPGVVGRVGTLLGEAGVNIAGLQLGRDQPGGR 487

Query: 65  AISFLCIDGSILN 77
           A+  L +D    +
Sbjct: 488 ALFVLAVDQPPPD 500


>gi|291548342|emb|CBL21450.1| L-serine ammonia-lyase [Ruminococcus sp. SR1/5]
          Length = 222

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 40/95 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R ++I  +  D       I +++ D  G+V ++   L E  INIA   L R    
Sbjct: 128 GGGKVRIVEINHVKVDFTGEYSAIIVIHQDTPGVVAYITRCLSERNINIAFMRLFRESKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A + +  DG +   ++E +  N  I  V   + 
Sbjct: 188 TTAYTIVESDGHLPEDIVESIHRNTNIHDVMVVQM 222


>gi|167040920|ref|YP_001663905.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X514]
 gi|300913871|ref|ZP_07131188.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307725445|ref|YP_003905196.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
 gi|166855160|gb|ABY93569.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X514]
 gi|300890556|gb|EFK85701.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307582506|gb|ADN55905.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
          Length = 531

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 45/93 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++      + +    M+ + N D+ G++  +GN+LG++GINI+   +  +++  
Sbjct: 438 GEEIRIVEYMGHKVNFEPTEYMLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDG 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  +  D  I +  +E L+   +I   +   
Sbjct: 498 TALMIVSTDREIPDEAVESLNKLNSIIKARAVR 530


>gi|256751636|ref|ZP_05492511.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256749445|gb|EEU62474.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 531

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 45/93 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++      + +    M+ + N D+ G++  +GN+LG++GINI+   +  +++  
Sbjct: 438 GEEIRIVEYMGHKVNFEPTEYMLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDG 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  +  D  I +  +E L+   +I   +   
Sbjct: 498 TALMIVSTDREIPDEAVESLNKLNSIIKARAVR 530


>gi|158312947|ref|YP_001505455.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EAN1pec]
 gi|158108352|gb|ABW10549.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EAN1pec]
          Length = 529

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 38/90 (42%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           +   I     D+     +      D  GIV  VG +LGE  INIA+  + R  +   A+ 
Sbjct: 437 KITAIDGFEVDLRPEDHLAFFRYEDRPGIVGAVGALLGEAHINIANAQVSRLSAGGEALM 496

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++   +L +++  +   + +    
Sbjct: 497 SLSLDDAVAPDILAEIAKIIGASYARAVSI 526


>gi|227499137|ref|ZP_03929272.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus sp. D21]
 gi|226904584|gb|EEH90502.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus sp. D21]
          Length = 529

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 41/97 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  D +P   +++   FD      MI   N D  G++  +G +LG   +NIA   + R +
Sbjct: 433 VTPDNQPHITEVEGYQFDTIPAPYMIFARNDDKPGMIGQIGTLLGAGHVNIATMQVSRKK 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D ++  + LE +     I   +    
Sbjct: 493 KEGTAMMVLTVDSAVDGATLEIVRNLDGISDAQLVRL 529


>gi|295102336|emb|CBK99881.1| L-serine ammonia-lyase [Faecalibacterium prausnitzii L2-6]
          Length = 222

 Score = 96.6 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 37/94 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R + I  +  D       + +V  D  G+V  +  IL E G+NIA   L R    
Sbjct: 128 GGGKVRIVGINGVAVDFSGEYNALIVVQRDKPGVVAHITKILSERGVNIAFMRLFREGKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A + +  D  +   V + L  N  I  V   +
Sbjct: 188 HKAYTIVESDQHLPEGVAQLLLENPNINDVMIVQ 221


>gi|326443626|ref|ZP_08218360.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 525

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
               + + I + + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R +   
Sbjct: 430 KNVQKIVAIGDHDVDLALADHMLVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRHEEGG 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D ++   V+ ++S  +     +    
Sbjct: 490 EALVVLTVDDTVPVPVIAEISAEIGAASARSVNL 523


>gi|116494693|ref|YP_806427.1| L-serine deaminase [Lactobacillus casei ATCC 334]
 gi|191638191|ref|YP_001987357.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Lactobacillus casei BL23]
 gi|227535323|ref|ZP_03965372.1| L-serine ammonia-lyase [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239631705|ref|ZP_04674736.1| L-serine ammonia-lyase [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|301066253|ref|YP_003788276.1| l-serine deaminase [Lactobacillus casei str. Zhang]
 gi|116104843|gb|ABJ69985.1| L-serine ammonia-lyase [Lactobacillus casei ATCC 334]
 gi|190712493|emb|CAQ66499.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Lactobacillus casei BL23]
 gi|227187057|gb|EEI67124.1| L-serine ammonia-lyase [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239526170|gb|EEQ65171.1| L-serine ammonia-lyase [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|300438660|gb|ADK18426.1| L-serine deaminase [Lactobacillus casei str. Zhang]
 gi|327382223|gb|AEA53699.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Lactobacillus casei LC2W]
 gi|327385420|gb|AEA56894.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Lactobacillus casei BD-II]
          Length = 221

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 38/94 (40%), Gaps = 1/94 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  +I      + +G+     ++ D+ G++  V  I  + GINI    + R    
Sbjct: 129 GGGNIQITEINGFKISLSMGQPTYITIHEDVPGMIAQVTKIFSDAGINIGTMTVTRESKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  +  D    + +L KL     +  V  FE
Sbjct: 189 EQAIMIIETD-DYQDDILAKLKQLPHMVNVTYFE 221


>gi|303232287|ref|ZP_07318985.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit
           [Atopobium vaginae PB189-T1-4]
 gi|302481610|gb|EFL44672.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit
           [Atopobium vaginae PB189-T1-4]
          Length = 529

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 21/95 (22%), Positives = 34/95 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R   I  I  ++      I + + D  G++  +   L    INIA     RS+  
Sbjct: 128 GGGRMRISSIDNIAIELSGDLPTIFVAHTDTPGVLASLTRELSCAHINIATLRTFRSKKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A S + ID  I   ++  L     +  V     
Sbjct: 188 GQAYSVIEIDNDIPEELVGALRHIHHVGLVNMVNI 222


>gi|167036576|ref|YP_001664154.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320115004|ref|YP_004185163.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166855410|gb|ABY93818.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319928095|gb|ADV78780.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 531

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 45/93 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++      + +    M+ + N D+ G++  +GN+LG++GINI+   +  +++  
Sbjct: 438 GEEVRIVEYMGHKVNFEPTEYMLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDG 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  +  D  I +  +E L+   +I   +   
Sbjct: 498 TALMIVSTDKEIPDEAVESLNKLNSIIKARAVR 530


>gi|119508833|ref|ZP_01627985.1| D-3-phosphoglycerate dehydrogenase [Nodularia spumigena CCY9414]
 gi|119466362|gb|EAW47247.1| D-3-phosphoglycerate dehydrogenase [Nodularia spumigena CCY9414]
          Length = 526

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 43/92 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +  D +     +     +V   + M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 430 LLGDKEIHLTDVDGFPINVPPSKYMLFTLHRDMPGIIGKLGSLLGSFNVNIASMQVGRKI 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  + + +L ++     IR  
Sbjct: 490 VRGDAVMALSIDDPLPDGILAEIVKVAGIRDA 521


>gi|160936062|ref|ZP_02083435.1| hypothetical protein CLOBOL_00958 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440872|gb|EDP18596.1| hypothetical protein CLOBOL_00958 [Clostridium bolteae ATCC
           BAA-613]
          Length = 271

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 43/93 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R  +I  I+ D       + I++ D LG++  +   L E  +NIA   L R    
Sbjct: 169 GGGKVRISRIDHIDVDFSGEYSTLIIIHRDRLGVLAHITRCLSEGYVNIAFMKLFRETKG 228

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A S +  DGS+ + ++ ++  N  ++ V   
Sbjct: 229 DRAYSIIEFDGSLPDHMVSRIYENPDVQDVMFI 261


>gi|239944498|ref|ZP_04696435.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|239990958|ref|ZP_04711622.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           11379]
 gi|291447964|ref|ZP_06587354.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|291350911|gb|EFE77815.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
          Length = 530

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 43/90 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG ILGE G+NIA   + R+     A+ 
Sbjct: 439 KIVAIGEHDVDLALADHMVVLRYQDRPGVVGAVGKILGEAGLNIAGMQVSRAAEGGEALV 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++   VL +++  +     +    
Sbjct: 499 VLTVDETVPQPVLTEIAEEIGASSARSVNL 528


>gi|291548832|emb|CBL25094.1| L-serine ammonia-lyase [Ruminococcus torques L2-14]
          Length = 222

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 38/95 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    +I  +  D       I +V  D+ G+V ++ + L +  +NIA   L R    
Sbjct: 128 GGGKVHITQINHVEVDFTGEYSAIIVVQKDVPGVVAWITSCLSDRRVNIAFMRLFRESKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A + +  DG +   + + +  N  +  V   + 
Sbjct: 188 HTAYTIVESDGKLPEEIADTIRQNEHVLDVMVVQM 222


>gi|302537104|ref|ZP_07289446.1| phosphoglycerate dehydrogenase [Streptomyces sp. C]
 gi|302445999|gb|EFL17815.1| phosphoglycerate dehydrogenase [Streptomyces sp. C]
          Length = 529

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   MI +   D  G+V  VG +LGE G+NIA   + R++    A+ 
Sbjct: 439 KIVGVGEYDVDLALADHMIVLRYTDRPGVVGKVGQLLGEAGLNIAGMQVARAEEGGEALV 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  +   VL  +S  +     +    
Sbjct: 499 VLTVDAEVPVDVLAAISEEIGAASARTVNL 528


>gi|110803391|ref|YP_698379.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens SM101]
 gi|110683892|gb|ABG87262.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens SM101]
          Length = 226

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 21/98 (21%), Positives = 39/98 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G    +++     +       +   + D  G V  V  +L E+ INIA  ++ R+Q  
Sbjct: 127 GGGSIEIVEVNGNEANFSGAYPTLITCHDDKFGTVNKVTKLLLEHEINIAFMNVSRTQKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
             A   L ID  +  SV++++     I+ V       +
Sbjct: 187 MDATMTLEIDNKVDESVIKRMEEIDGIKKVILINLEEE 224


>gi|318061963|ref|ZP_07980684.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. SA3_actG]
 gi|318077433|ref|ZP_07984765.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. SA3_actF]
          Length = 531

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E   D+ +   M+ +  AD  G+V  VG +LGE GINIA   + R++    A++
Sbjct: 441 KIVAIGEHTVDLALADHMVVLRYADRPGVVGTVGRVLGESGINIAGMQVSRAEEGGEALA 500

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D S+   VL +++        +  + 
Sbjct: 501 VLTVDDSVPADVLAEVAQETGATSARAVDL 530


>gi|284929797|ref|YP_003422319.1| D-3-phosphoglycerate dehydrogenase [cyanobacterium UCYN-A]
 gi|284810241|gb|ADB95938.1| D-3-phosphoglycerate dehydrogenase [cyanobacterium UCYN-A]
          Length = 525

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/97 (23%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + SDG+ R   +     +V     M+  ++ D+ GI+  +G++LG + +NIA   +GR  
Sbjct: 429 LLSDGEIRITNVDLFPINVPPSNHMLFTIHRDMPGIIGKIGSLLGSFNVNIASMQVGRKI 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  + +D  + +S+L ++     IR     + 
Sbjct: 489 VRGDAVMAVSLDDPLPDSLLLEIMKVTGIRDAYTIKL 525


>gi|110803155|ref|YP_699877.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens SM101]
 gi|110683656|gb|ABG87026.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens SM101]
          Length = 226

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 37/94 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++     +       + I + D+ G V  V  I+ E+ INIA   + R++  
Sbjct: 127 GGGSIKITEVNGSVVEFTGEYPTLIISHKDVPGAVSKVTAIVYEHNINIAFMKVFRTERG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A     +D  I   +++++     +  +    
Sbjct: 187 KAARMVFEMDSPITKDIIDEIKKVEAVEKLVVIN 220


>gi|328955672|ref|YP_004373005.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Coriobacterium glomerans PW2]
 gi|328455996|gb|AEB07190.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Coriobacterium glomerans PW2]
          Length = 536

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 19/99 (19%), Positives = 36/99 (36%), Gaps = 4/99 (4%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R  +I  ++ D+      + I + D  G++  +   L E GINIA     R+   
Sbjct: 128 GGGRVRISRIDGVSVDLSGEYDTLFIAHRDERGVLARLTVELSERGINIAFMRTYRTARG 187

Query: 63  EHAISFLCIDGSIL----NSVLEKLSVNVTIRFVKQFEF 97
             A +   +D          ++ +L  +  I        
Sbjct: 188 GSAYTVFELDELPEGDARAELVRRLRASPEIATATVISI 226


>gi|269127749|ref|YP_003301119.1| D-3-phosphoglycerate dehydrogenase [Thermomonospora curvata DSM
           43183]
 gi|268312707|gb|ACY99081.1| D-3-phosphoglycerate dehydrogenase [Thermomonospora curvata DSM
           43183]
          Length = 531

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 42/91 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   + ++     M      D  GIV  VG +LG+  INIA   +GRS     A+ 
Sbjct: 438 RIVEINGYDMELVPAEHMAFFSYTDRPGIVGVVGRLLGDAQINIASMQVGRSSKGGKALI 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D +I   +LE +   +     ++ + +
Sbjct: 498 ALTVDSAIGPDLLETIRTEIGADMGRRVDLD 528


>gi|296272027|ref|YP_003654658.1| D-3-phosphoglycerate dehydrogenase [Arcobacter nitrofigilis DSM
           7299]
 gi|296096202|gb|ADG92152.1| D-3-phosphoglycerate dehydrogenase [Arcobacter nitrofigilis DSM
           7299]
          Length = 527

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 2/97 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   R +++    FD+     MI + N+DI G++  VG  LG+  INIA F L R +
Sbjct: 433 VFDEDVQRIVEVNGFVFDIAPKGNMIFLRNSDIPGVIGTVGKTLGDNNINIADFRLSRGK 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  + + VL++L        V   E 
Sbjct: 493 --DSALAVILVDTFVSHDVLKQLENLEAAISVSYVEI 527


>gi|257433819|ref|ZP_05610177.1| LOW QUALITY PROTEIN: D-3-phosphoglycerate dehydrogenase
           [Staphylococcus aureus subsp. aureus E1410]
 gi|257281912|gb|EEV12049.1| LOW QUALITY PROTEIN: D-3-phosphoglycerate dehydrogenase
           [Staphylococcus aureus subsp. aureus E1410]
          Length = 294

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/86 (30%), Positives = 47/86 (54%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D  G+V   G +LG+Y INIA   LGR++
Sbjct: 194 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPGMVGKTGALLGKYNINIASMTLGRTE 253

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 254 AGGDALMILSVDQPVSNNIIDELKQV 279


>gi|302522080|ref|ZP_07274422.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB78]
 gi|302430975|gb|EFL02791.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB78]
          Length = 531

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E   D+ +   M+ +  AD  G+V  VG +LGE GINIA   + R++    A++
Sbjct: 441 KIVAIGEHTVDLALADHMVVLRYADRPGVVGTVGRVLGESGINIAGMQVSRAEEGGEALA 500

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D S+   VL +++        +  + 
Sbjct: 501 VLTVDDSVPADVLAEVAQETGATSARAVDL 530


>gi|239928756|ref|ZP_04685709.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
 gi|291437078|ref|ZP_06576468.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
 gi|291339973|gb|EFE66929.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
          Length = 529

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + + + D+ +   M+ +   D  G+V  VG ILGE GINIA   + R+     A++
Sbjct: 439 KIVAVGDYDVDLALADHMVVLRYEDRPGVVGTVGRILGEAGINIAGMQVARAAVGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++  +VL +L+  +     +    
Sbjct: 499 VLTVDDTVSAAVLGELAAEIGATSARSVNL 528


>gi|18311605|ref|NP_563539.1| L-serine dehydratase beta subunit [Clostridium perfringens str. 13]
 gi|110800656|ref|YP_697313.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens ATCC 13124]
 gi|168207896|ref|ZP_02633901.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens E str. JGS1987]
 gi|168211591|ref|ZP_02637216.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens B str. ATCC 3626]
 gi|168214809|ref|ZP_02640434.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens CPE str. F4969]
 gi|168218017|ref|ZP_02643642.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens NCTC 8239]
 gi|182626420|ref|ZP_02954173.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens D str. JGS1721]
 gi|18146289|dbj|BAB82329.1| probable L-serine dehydratase beta subunit [Clostridium perfringens
           str. 13]
 gi|110675303|gb|ABG84290.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens ATCC 13124]
 gi|170660789|gb|EDT13472.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens E str. JGS1987]
 gi|170710446|gb|EDT22628.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens B str. ATCC 3626]
 gi|170713717|gb|EDT25899.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens CPE str. F4969]
 gi|177908294|gb|EDT70847.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens D str. JGS1721]
 gi|182379947|gb|EDT77426.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens NCTC 8239]
          Length = 226

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 37/94 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++     +       + I + D+ G V  V  I+ E+ INIA   + R++  
Sbjct: 127 GGGSIKITEVNGSVVEFTGEYPTLIISHKDVPGAVSKVTAIVYEHNINIAFMKVFRTERG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A     +D  I   +++++     +  +    
Sbjct: 187 KAARMVFEMDSPITKDIIDEIKKVEAVEKLVVIN 220


>gi|313112501|ref|ZP_07798171.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310625165|gb|EFQ08450.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 222

 Score = 96.3 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 38/94 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R ++I  +  D       + +V  D  G+V  +  IL +  +NIA   L R +  
Sbjct: 128 GGGKVRIVRINGVEVDFTGEYNALIVVQKDKPGVVAHITKILSDRSVNIAFMRLFREEKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A + +  D  +   V + L  N  I  V   +
Sbjct: 188 HTAYTIVESDERLPEGVDQLLLANPNINDVMVVQ 221


>gi|268679255|ref|YP_003303686.1| D-3-phosphoglycerate dehydrogenase [Sulfurospirillum deleyianum DSM
           6946]
 gi|268617286|gb|ACZ11651.1| D-3-phosphoglycerate dehydrogenase [Sulfurospirillum deleyianum DSM
           6946]
          Length = 528

 Score = 95.9 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + I    FD      MI   N D+ G++  + +IL + GINIA F LGR  
Sbjct: 433 VFGEDEQRIVGINGFKFDFKPKGKMIIFKNNDVPGVIANITSILAKEGINIADFRLGRGA 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
             + A++ + +D  I   ++ +L+   T  +V+ 
Sbjct: 493 H-QFAMAVILVDTDIDKKIITELNKLETCVWVEY 525


>gi|220932470|ref|YP_002509378.1| L-serine ammonia-lyase, beta subunit [Halothermothrix orenii H 168]
 gi|219993780|gb|ACL70383.1| L-serine ammonia-lyase, beta subunit [Halothermothrix orenii H 168]
          Length = 218

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 36/93 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      I     ++      + +++ D  G V  + +ILG Y +NIA   + R +  
Sbjct: 123 GGGNIVVHNIDGYEVNIRGNYPTLWVLHRDKPGEVGIITSILGCYKLNIAFMRVFRKKRG 182

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
               S + +D  +   +++ L     I  V+  
Sbjct: 183 TIGSSIIELDQDVDEDIIDHLQGMKDILKVRYI 215


>gi|325181642|emb|CCA16093.1| phosphoserine aminotransferase putative [Albugo laibachii Nc14]
          Length = 964

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 45/97 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   +PR I + +++ D      M+   N D  G++  + ++L ++ INI  F L R  
Sbjct: 460 VFGKNQPRLIALNDLSVDCIPTGSMLMFQNQDQPGVLNSITSVLAKHDINIGCFGLARES 519

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              HA+  L +D  I N  +++L     +  ++    
Sbjct: 520 KEAHAVGILNLDDPIPNQAIQELDALDQLSNLRPVTL 556


>gi|20807488|ref|NP_622659.1| L-serine deaminase [Thermoanaerobacter tengcongensis MB4]
 gi|254479508|ref|ZP_05092829.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Carboxydibrachium pacificum DSM 12653]
 gi|20516016|gb|AAM24263.1| L-serine deaminase [Thermoanaerobacter tengcongensis MB4]
 gi|214034547|gb|EEB75300.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Carboxydibrachium pacificum DSM 12653]
          Length = 222

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 30/94 (31%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  I  +       +   + D  GIV  V  +L +  INIA   + R    
Sbjct: 127 GGGNVLLKEINGIEVEFTGEYETLITTHIDKPGIVAAVTKVLADCNINIAFMRVYRHAKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + AI  +  D  I     E +     I       
Sbjct: 187 DKAIMVIESDQEIPERAKEVIKNIDGILNAIILN 220


>gi|212639604|ref|YP_002316124.1| L-serine dehydratase subunit beta [Anoxybacillus flavithermus WK1]
 gi|212561084|gb|ACJ34139.1| L-serine dehydratase (beta chain) [Anoxybacillus flavithermus WK1]
          Length = 245

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 44/93 (47%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++      +      + I++ D  G +  V N+L +Y INI H  + R +  
Sbjct: 151 GGGKIEIIELNGFELKLSGHHPALLIMHNDRYGAIAGVANVLAKYAINIGHMEVSRKEKG 210

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A+  + +D +I ++++E+L     I  V + 
Sbjct: 211 KQALMTIEVDQNIDDAIVEQLKALPHIIDVTKI 243


>gi|169343447|ref|ZP_02864447.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens C str. JGS1495]
 gi|169298399|gb|EDS80488.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens C str. JGS1495]
          Length = 226

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 37/94 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++     +       + I + D+ G V  V  I+ E+ INIA   + R++  
Sbjct: 127 GGGSIKITEVNGSVVEFTGEYPTLIISHKDVPGAVSKVTAIVYEHNINIAFMKVFRTERG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A     +D  I   +++++     +  +    
Sbjct: 187 KAARMVFEMDSPITKDIIDEIKKVEAVEKLVVIN 220


>gi|111225204|ref|YP_715998.1| D-3-phosphoglycerate dehydrogenase [Frankia alni ACN14a]
 gi|111152736|emb|CAJ64480.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Frankia alni ACN14a]
          Length = 530

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 38/93 (40%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           +   I     D+     +      D  GIV  VG +LGE  INIA   + R Q+   A+ 
Sbjct: 438 KITAIDGFEVDIRPEAHLAFFRYEDRPGIVGAVGALLGEANINIASAQVSRIQAGGEALM 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            L +D ++   +L  ++  +   + +      +
Sbjct: 498 SLSLDDAVAPDILADIAKIIGASYARAVSIQAE 530


>gi|331004363|ref|ZP_08327836.1| L-serine dehydratase [Lachnospiraceae oral taxon 107 str. F0167]
 gi|330411093|gb|EGG90512.1| L-serine dehydratase [Lachnospiraceae oral taxon 107 str. F0167]
          Length = 221

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 40/94 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R +KI  ++ D       I +V+ D  G++ ++  IL E+ INIA   L R    
Sbjct: 128 GGGKVRIVKIDRVDIDFSGEYSAIILVHRDRPGVIAYITKILSEHNINIAFMKLYRESKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A + +  D  I   +   L  N  I  V   +
Sbjct: 188 NKAYTIIESDEMITPDIKSGLYKNEHISQVMIVQ 221


>gi|116873248|ref|YP_850029.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           welshimeri serovar 6b str. SLCC5334]
 gi|116742126|emb|CAK21250.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           welshimeri serovar 6b str. SLCC5334]
          Length = 220

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 39/90 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 126 GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  +   ++ K++    I  V
Sbjct: 186 DEALMVIEVDQQVEQDLITKIAELPGIYQV 215


>gi|290957185|ref|YP_003488367.1| D-3-phosphoglycerate dehydrogenase [Streptomyces scabiei 87.22]
 gi|260646711|emb|CBG69808.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces scabiei
           87.22]
          Length = 529

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 44/92 (47%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
             + + + E + D+ +   M+ +   D  G+V  VG + GE GINIA   + RS +   A
Sbjct: 437 HQKIVAVGEYDVDLALADHMVVLSYVDRPGVVGTVGRVFGEAGINIAGMQVARSTAGGEA 496

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           ++ L +D ++  +VL ++   +     +    
Sbjct: 497 LAVLTVDDTVPPAVLAEVEAEIGATSARSVNL 528


>gi|116751067|ref|YP_847754.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116700131|gb|ABK19319.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 526

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 42/96 (43%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F    PR ++I +   +  +   ++ I N D  G +  +G  LG++ INI+   +G+   
Sbjct: 431 FGKKDPRMVRINDFRLEAALEGHLLLIYNIDTPGTIGAIGTCLGKHHINISMMDVGQVLE 490

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               I FL  D  +   V E+L     +  V+  E 
Sbjct: 491 RGQNIIFLRTDTPVPGHVKEELLAMDNVNVVQAIEL 526


>gi|16800993|ref|NP_471261.1| hypothetical protein lin1927 [Listeria innocua Clip11262]
 gi|16414428|emb|CAC97157.1| lin1927 [Listeria innocua Clip11262]
          Length = 220

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 39/90 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 126 GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  +   ++ K++    I  V
Sbjct: 186 DEALMVIEVDQQVEQDLISKIAELPGIYQV 215


>gi|254478955|ref|ZP_05092315.1| ACT domain protein [Carboxydibrachium pacificum DSM 12653]
 gi|214035101|gb|EEB75815.1| ACT domain protein [Carboxydibrachium pacificum DSM 12653]
          Length = 256

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 45/93 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++      + +    M+ + N D+ G++  +GN+LG++GINI+   +  +++  
Sbjct: 161 GEELRIVEYMGHKVNFEPTEYMLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDG 220

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  +  D  I    +E L+   +I   K  +
Sbjct: 221 TALMLVSTDKEIPEEAVESLNKLNSIIKAKAVK 253


>gi|154147887|ref|YP_001406068.1| D-3-phosphoglycerate dehydrogenase [Campylobacter hominis ATCC
           BAA-381]
 gi|153803896|gb|ABS50903.1| phosphoglycerate dehydrogenase [Campylobacter hominis ATCC BAA-381]
          Length = 525

 Score = 95.9 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D + R + I     D      MI   N D+ G++  V  IL +  INIA F LGR +
Sbjct: 430 VFNDDEERILNIDGFKTDFKPKGKMIIFKNTDVPGVIASVSAILAKDKINIADFRLGRGE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
               A++ + +D  I  SVL++LS   T    +  
Sbjct: 490 DGN-ALAVILVDEDISKSVLDELSALSTCLLARYV 523


>gi|294496187|ref|YP_003542680.1| D-3-phosphoglycerate dehydrogenase [Methanohalophilus mahii DSM
           5219]
 gi|292667186|gb|ADE37035.1| D-3-phosphoglycerate dehydrogenase [Methanohalophilus mahii DSM
           5219]
          Length = 523

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 37/94 (39%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +   R I I     D+     MI   + +   ++     ILG++ INI+   +GR Q   
Sbjct: 430 EDDLRIIMIDGQRVDLAPSGYMIVSNHINRPNVIGPCCMILGDHEINISGMQVGRVQICG 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             I  L +D  +   +LE++     I   K    
Sbjct: 490 KTIMALNVDSEVSEDILEQIRHVDGIIDAKLVSL 523


>gi|289579412|ref|YP_003478039.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter italicus
           Ab9]
 gi|289529125|gb|ADD03477.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter italicus
           Ab9]
          Length = 533

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 47/93 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++  +   + +    M+ + N D+ G++  +GN+LG++GINI+   +  +++  
Sbjct: 438 GEEIRIVEYMDHKVNFEPTENMLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDG 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  +  D  I +  +E L+   +I   +  +
Sbjct: 498 TALMIVSTDKEIPDEAVESLNKLNSIIKARAVK 530


>gi|320449971|ref|YP_004202067.1| L-serine dehydratase, iron-sulfur-dependent subunit beta [Thermus
           scotoductus SA-01]
 gi|320150140|gb|ADW21518.1| L-serine dehydratase, iron-sulfur-dependent, subunit beta [Thermus
           scotoductus SA-01]
          Length = 220

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 36/93 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  R   +      +      + I N D  G+V  V  IL +  +NIA+  + R +  
Sbjct: 123 GGGLVRIFDLDGFEVRITGAAPTLVIRNVDTPGVVARVARILADDEVNIAYLTVSRKKRG 182

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  L +D  +    L  L     I +V+Q 
Sbjct: 183 GEAMMSLEVDRPLPEVPLRYLEHLSYILWVRQI 215


>gi|317497232|ref|ZP_07955556.1| L-serine dehydratase [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316895477|gb|EFV17635.1| L-serine dehydratase [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 222

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 40/95 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R  +I ++  D       + ++  D  G+V ++   L +  +NIA   L R    
Sbjct: 128 GGGKARICRINDVEVDFTGEYSTLIVIQKDKPGVVTYITKCLSDQDVNIAFMRLFRESKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A S +  DG +  ++ E++  +  +  V   + 
Sbjct: 188 NTAYSIVESDGLLPENIAEEIRKSPNVSDVMIIQL 222


>gi|167765968|ref|ZP_02438021.1| hypothetical protein CLOSS21_00459 [Clostridium sp. SS2/1]
 gi|167712325|gb|EDS22904.1| hypothetical protein CLOSS21_00459 [Clostridium sp. SS2/1]
 gi|291558762|emb|CBL37562.1| L-serine ammonia-lyase [butyrate-producing bacterium SSC/2]
          Length = 222

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 40/95 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R  +I ++  D       + ++  D  G+V ++   L +  +NIA   L R    
Sbjct: 128 GGGKARICRINDVEVDFTGEYSTLIVIQKDKPGVVTYITKCLSDQDVNIAFMRLFRESKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A S +  DG +  ++ E++  +  +  V   + 
Sbjct: 188 NTAYSIVESDGLLPENIAEEIRKSPNVSDVMIIQL 222


>gi|307265859|ref|ZP_07547409.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326389803|ref|ZP_08211367.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter ethanolicus JW 200]
 gi|306919134|gb|EFN49358.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325994071|gb|EGD52499.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 222

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 32/94 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  I  +       +   + D  GIV  V  I  +Y INIA   + R    
Sbjct: 127 GGGNVLLKEINGIEVEFTGEYETLITNHIDRPGIVANVTKIFADYKINIAFMRVYRHSKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + AI  +  D  I ++  E +     I       
Sbjct: 187 DKAIMVIESDQKIPDAAKETIKNIDGILNAIIIN 220


>gi|116620780|ref|YP_822936.1| D-3-phosphoglycerate dehydrogenase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223942|gb|ABJ82651.1| D-3-phosphoglycerate dehydrogenase [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 525

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 55/94 (58%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            KPR +++  I  +  +   +I + N D+ G++  VG +LG+  INIA+F LGR + T  
Sbjct: 430 DKPRLLQVDGIYCEAALCGFLIVMKNQDVPGVIGHVGTVLGKNCINIANFSLGRREGTPE 489

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
           A++ +  DG +  SVL +L  +  ++F +  EF+
Sbjct: 490 AVALVSTDGLVPESVLLQLKEHAAVKFARSVEFH 523


>gi|312830102|emb|CBX34944.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ECT-R 2]
          Length = 534

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 46/86 (53%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   PR ++I   + D+   +  I   + D   +V   G +LG+Y INIA   LGR++
Sbjct: 434 VFTGFGPRIVRINNFSVDLKPNQYQIVSYHNDTPDMVGKTGALLGKYNINIASMTLGRTE 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVN 86
           +   A+  L +D  + N+++++L   
Sbjct: 494 AGGDALMILSVDQPVSNNIIDELKQV 519


>gi|220913021|ref|YP_002488330.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter chlorophenolicus
           A6]
 gi|219859899|gb|ACL40241.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter chlorophenolicus
           A6]
          Length = 529

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 42/91 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I     ++ I   ++ +  AD  G++  +G+ILG   INIA   + R       ++
Sbjct: 438 KLVGINGFEVEIPISEHLVVVAYADRPGVIGTIGHILGMNNINIAGMQVARHDEGGQVLA 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L ID S+   VL+ +   +    V++ +  
Sbjct: 498 LLTIDSSVPQQVLDAIKAGIGAEMVREVDLE 528


>gi|168208058|ref|ZP_02634063.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens E str. JGS1987]
 gi|168215909|ref|ZP_02641534.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens NCTC 8239]
 gi|169341138|ref|ZP_02627517.2| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens C str. JGS1495]
 gi|182625326|ref|ZP_02953100.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens D str. JGS1721]
 gi|169299745|gb|EDS81797.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens C str. JGS1495]
 gi|170660641|gb|EDT13324.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens E str. JGS1987]
 gi|177909484|gb|EDT71931.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens D str. JGS1721]
 gi|182381961|gb|EDT79440.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens NCTC 8239]
          Length = 226

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 39/98 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G    +++     +       +   + D  G V  V  +L E+ INIA  ++ R+Q  
Sbjct: 127 GGGSIEIVEVNGNEANFSGAYPTLITCHDDKFGTVNKVTKLLLEHEINIAFMNVSRTQKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
             A   L ID  I  SV++++     I+ V       +
Sbjct: 187 MDATMTLEIDNKIDESVIKRMEEIDGIKKVILINLEEE 224


>gi|297545554|ref|YP_003677856.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296843329|gb|ADH61845.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 533

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 47/93 (50%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++  +   + +    M+ + N D+ G++  +GN+LG++GINI+   +  +++  
Sbjct: 438 GEEIRIVEYMDHKVNFEPTENMLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDG 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  +  D  I +  +E L+   +I   +  +
Sbjct: 498 TALMIVSTDKEIPDEAVESLNKLNSIIKARAVK 530


>gi|167040060|ref|YP_001663045.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter sp. X514]
 gi|256752699|ref|ZP_05493549.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914144|ref|ZP_07131460.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter sp. X561]
 gi|307724620|ref|YP_003904371.1| L-serine dehydratase, iron-sulfur-dependent subunit beta
           [Thermoanaerobacter sp. X513]
 gi|166854300|gb|ABY92709.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter sp. X514]
 gi|256748418|gb|EEU61472.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889079|gb|EFK84225.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter sp. X561]
 gi|307581681|gb|ADN55080.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter sp. X513]
          Length = 222

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 32/94 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  I  +       +   + D  GIV  V  I  +Y INIA   + R    
Sbjct: 127 GGGNVLLKEINGIEVEFTGEYETLITNHIDRPGIVANVTKIFADYKINIAFMRVYRHSKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + AI  +  D  I ++  E +     I       
Sbjct: 187 DKAIMVIESDQKIPDAAKETIKNIDGILNAIIIN 220


>gi|116671082|ref|YP_832015.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter sp. FB24]
 gi|116611191|gb|ABK03915.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter sp. FB24]
          Length = 529

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 42/91 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + +     ++ I   ++ +  AD  G++  +G+ILG   INIA   + R       ++
Sbjct: 438 KLVGVNGYEVEIPISEHLVVVAYADRPGVIGTIGHILGMNNINIAGMQVARQAEGGQVLA 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L ID S+   VL+ +   +    V++ +  
Sbjct: 498 LLTIDSSVPQQVLDAIKAGIGAEMVREVDLE 528


>gi|325963764|ref|YP_004241670.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469851|gb|ADX73536.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 529

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 42/91 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I     ++ I   ++ +   D  G++  +G+ILG   INIA   + RS      ++
Sbjct: 438 KLVGINGFEVEIPISEHLVVVGYTDRPGVIGTIGHILGMNNINIAGMQVARSDEGGQVLA 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L ID ++   VL+ +   +    V++ +  
Sbjct: 498 LLTIDSAVPQQVLDAIKAGIGADMVREVDLE 528


>gi|328950639|ref|YP_004367974.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Marinithermus hydrothermalis DSM 14884]
 gi|328450963|gb|AEB11864.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Marinithermus hydrothermalis DSM 14884]
          Length = 215

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 36/93 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  R   I      V      + I N D  G++  V  ++ +  +NIA+    R +  
Sbjct: 118 GGGIVRIFSIDGFEVRVTGQAPTLLIKNVDTPGVIARVARVIADDEVNIAYLTCARQKRG 177

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  + +D  +    L+ L+    I +V+  
Sbjct: 178 GEAMMSIEVDRDLSQPALDYLNHLSYILWVRML 210


>gi|315282814|ref|ZP_07871137.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           marthii FSL S4-120]
 gi|313613543|gb|EFR87364.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           marthii FSL S4-120]
          Length = 220

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 126 GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  +  +++ K++    I  V
Sbjct: 186 DEALMVIEVDQQVEQALISKIAELPGIYQV 215


>gi|46908045|ref|YP_014434.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes str. 4b F2365]
 gi|226224416|ref|YP_002758523.1| L-serine dehydratase (beta chain) [Listeria monocytogenes
           Clip81459]
 gi|254826145|ref|ZP_05231146.1| L-serine dehydratase [Listeria monocytogenes FSL J1-194]
 gi|254852720|ref|ZP_05242068.1| L-serine dehydratase [Listeria monocytogenes FSL R2-503]
 gi|254899490|ref|ZP_05259414.1| L-serine dehydratase (beta chain) [Listeria monocytogenes J0161]
 gi|254933285|ref|ZP_05266644.1| L-serine dehydratase [Listeria monocytogenes HPB2262]
 gi|254936698|ref|ZP_05268395.1| L-serine dehydratase [Listeria monocytogenes F6900]
 gi|254994429|ref|ZP_05276619.1| L-serine dehydratase (beta chain) [Listeria monocytogenes FSL
           J2-064]
 gi|255521928|ref|ZP_05389165.1| L-serine dehydratase (beta chain) [Listeria monocytogenes FSL
           J1-175]
 gi|284802259|ref|YP_003414124.1| hypothetical protein LM5578_2015 [Listeria monocytogenes 08-5578]
 gi|284995401|ref|YP_003417169.1| hypothetical protein LM5923_1966 [Listeria monocytogenes 08-5923]
 gi|300763874|ref|ZP_07073871.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes FSL N1-017]
 gi|46881315|gb|AAT04611.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|225876878|emb|CAS05587.1| Putative L-serine dehydratase (beta chain) [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258606043|gb|EEW18651.1| L-serine dehydratase [Listeria monocytogenes FSL R2-503]
 gi|258609295|gb|EEW21903.1| L-serine dehydratase [Listeria monocytogenes F6900]
 gi|284057821|gb|ADB68762.1| hypothetical protein LM5578_2015 [Listeria monocytogenes 08-5578]
 gi|284060868|gb|ADB71807.1| hypothetical protein LM5923_1966 [Listeria monocytogenes 08-5923]
 gi|293584845|gb|EFF96877.1| L-serine dehydratase [Listeria monocytogenes HPB2262]
 gi|293595385|gb|EFG03146.1| L-serine dehydratase [Listeria monocytogenes FSL J1-194]
 gi|300515610|gb|EFK42660.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes FSL N1-017]
 gi|328466167|gb|EGF37324.1| hypothetical protein LM1816_11237 [Listeria monocytogenes 1816]
 gi|328473540|gb|EGF44377.1| hypothetical protein LM220_09060 [Listeria monocytogenes 220]
          Length = 220

 Score = 95.5 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 126 GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  +  +++ K++    I  V
Sbjct: 186 DEALMVIEVDQQVEQALISKIAELPGIYQV 215


>gi|226324270|ref|ZP_03799788.1| hypothetical protein COPCOM_02049 [Coprococcus comes ATCC 27758]
 gi|225206718|gb|EEG89072.1| hypothetical protein COPCOM_02049 [Coprococcus comes ATCC 27758]
          Length = 222

 Score = 95.1 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 37/95 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R  +I  +  D       I +V  D  G+V ++   L E GINIA   L R    
Sbjct: 128 GGGKARLCRINGVEVDFTGEYSSIVVVQKDAPGVVAYITKCLSELGINIAFMRLFRESKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A + +  D  +   + + +  N  +  V   + 
Sbjct: 188 NTAYTIVESDDLVPEDIADTIRRNKNVYNVMVVQM 222


>gi|315303715|ref|ZP_07874228.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           ivanovii FSL F6-596]
 gi|313627913|gb|EFR96533.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           ivanovii FSL F6-596]
          Length = 220

 Score = 95.1 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 126 GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKIKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  +  +++ KL+    I  V
Sbjct: 186 DEALMVIEVDQQVEQALITKLAELPGIYQV 215


>gi|289435156|ref|YP_003465028.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           seeligeri serovar 1/2b str. SLCC3954]
 gi|289171400|emb|CBH27944.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           seeligeri serovar 1/2b str. SLCC3954]
 gi|313632775|gb|EFR99741.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           seeligeri FSL N1-067]
 gi|313637343|gb|EFS02827.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           seeligeri FSL S4-171]
          Length = 220

 Score = 95.1 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 126 GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  +  +++ K++    I  V
Sbjct: 186 DEALMVIEVDQQVEQALITKIAELPGIYQV 215


>gi|18309970|ref|NP_561904.1| L-serine dehydratase beta subunit [Clostridium perfringens str. 13]
 gi|168211802|ref|ZP_02637427.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens B str. ATCC 3626]
 gi|168213916|ref|ZP_02639541.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens CPE str. F4969]
 gi|18144648|dbj|BAB80694.1| L-serine dehydratase beta subunit [Clostridium perfringens str. 13]
 gi|170710249|gb|EDT22431.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens B str. ATCC 3626]
 gi|170714565|gb|EDT26747.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens CPE str. F4969]
          Length = 226

 Score = 95.1 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 39/98 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G    +++     +       +   + D  G V  V  +L E+ INIA  ++ R+Q  
Sbjct: 127 GGGSIEIVEVNGNEANFSGAYPTLITCHDDKFGTVNKVTKLLLEHEINIAFMNVSRTQKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
             A   L ID  I  SV++++     I+ V       +
Sbjct: 187 MDATMTLEIDNKIDESVIKRMEEIDGIKKVILINLEEE 224


>gi|224137644|ref|XP_002327177.1| predicted protein [Populus trichocarpa]
 gi|222835492|gb|EEE73927.1| predicted protein [Populus trichocarpa]
          Length = 597

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 41/94 (43%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DGKP    +     DV +   +I     D  G+V  VG+ILGE  +N++   +GR    +
Sbjct: 504 DGKPHLTMVGSFGVDVSMEGSLILCRQVDQPGMVGSVGSILGEENVNVSFMSVGRIAPRK 563

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  + +D       L+++     +  +   + 
Sbjct: 564 QAVMTIGVDEEPSKEALKRIREIPAVEEIVFLKL 597


>gi|56964072|ref|YP_175803.1| L-serine dehydratase beta subunit [Bacillus clausii KSM-K16]
 gi|56910315|dbj|BAD64842.1| L-serine dehydratase beta subunit [Bacillus clausii KSM-K16]
          Length = 220

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 43/94 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      I + + D  G++  V N+L ++ +NI H  + R +  
Sbjct: 126 GGGKIEIVELNGFDLRLSGNHPAILVAHLDRYGVIAAVSNLLAKHQLNIGHMEVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E A+  + +D ++  ++L +L     I  V +  
Sbjct: 186 ETALMVIEVDQNVDKALLLELERLPHITHVSKIH 219


>gi|237749847|ref|ZP_04580327.1| d-3-phosphoglycerate dehydrogenase [Helicobacter bilis ATCC 43879]
 gi|229374597|gb|EEO24988.1| d-3-phosphoglycerate dehydrogenase [Helicobacter bilis ATCC 43879]
          Length = 535

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 22/97 (22%), Positives = 46/97 (47%), Gaps = 2/97 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           ++     RF  I     D++    MI + N D+ G++  +G+ + ++ +NIA F LGR  
Sbjct: 437 IYDGHIVRFNNINGFGMDLEPNGNMILVRNTDVPGVIGSIGHTIAKHKVNIADFRLGRKT 496

Query: 61  STEH--AISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            +    A++ + +D ++   +L+ L        V+  
Sbjct: 497 DSSERNALALILVDSAVSTQLLDDLKAIPECLSVRNV 533


>gi|311030775|ref|ZP_07708865.1| D-3-phosphoglycerate dehydrogenase [Bacillus sp. m3-13]
          Length = 524

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 39/91 (42%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
            R + +   + D      ++ + + D  G++  +G I G++  NIA  H+GR      AI
Sbjct: 434 ARIVHMNGFDIDFAPSGHLLYVQHTDRPGVIGQLGLIFGKHETNIATMHVGRMLQGGKAI 493

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             L  D  +   +++++ +   I      E 
Sbjct: 494 MMLSFDQPLEKVLVDEILLIPDISSAITLEL 524


>gi|110799908|ref|YP_695691.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens ATCC 13124]
 gi|110674555|gb|ABG83542.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium perfringens ATCC 13124]
          Length = 226

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 22/98 (22%), Positives = 39/98 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G    +++     +       +   + D  G V  V  +L E+ INIA  ++ R+Q  
Sbjct: 127 GGGSIEIVEVNGNEANFSGAYPTLITCHDDKFGTVNKVTKLLLEHEINIAFMNVSRTQKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
             A   L ID  I  SV++++     I+ V       +
Sbjct: 187 MDATMTLEIDNKIDESVIKRMEEIDGIKKVILINLEEE 224


>gi|326390875|ref|ZP_08212427.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325993134|gb|EGD51574.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 533

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 46/93 (49%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++      + +    M+ + N DI G++  +GN+LG++GINI+   +  +++  
Sbjct: 438 GEEVRIVEYMGHKVNFEPTEYMLFVKNKDIPGVIGHIGNVLGDFGINISTMQVSPNKNDG 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  +  D  I +  +E L+   +I   +  +
Sbjct: 498 TALMIVSTDKEIPDEAVESLNKLNSIIKARAVK 530


>gi|251796380|ref|YP_003011111.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. JDR-2]
 gi|247544006|gb|ACT01025.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. JDR-2]
          Length = 530

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I +   DV     +I I + D  GI+  VG +LG   +NIA   +GR      AI 
Sbjct: 440 RVVQIDKFPVDVTPEGNLILISHNDKPGIIGRVGTLLGNNDVNIATMQVGRQLVGGSAIM 499

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D +    +LE+L+    +   K+   
Sbjct: 500 VLTVDKNAGKDILEQLTSLSDLNTAKEITL 529


>gi|51891147|ref|YP_073838.1| D-3-phosphoglycerate dehydrogenase [Symbiobacterium thermophilum
           IAM 14863]
 gi|51854836|dbj|BAD38994.1| phosphoglycerate dehydrogenase [Symbiobacterium thermophilum IAM
           14863]
          Length = 540

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 42/94 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG  RF+ +  ++ D+   R M+   + D  G+V   G  L    INIA  HLGR Q   
Sbjct: 441 DGGMRFVAVDGLHIDMAPSRHMLVSQHRDQPGMVGRFGMALAARDINIAGLHLGRHQPRG 500

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L ID      ++ +L   + +  V+    
Sbjct: 501 MALMLLQIDEPAPPDLVAELREAMAVDTVQAVTL 534


>gi|315658015|ref|ZP_07910888.1| phosphoglycerate dehydrogenase [Staphylococcus lugdunensis M23590]
 gi|315496905|gb|EFU85227.1| phosphoglycerate dehydrogenase [Staphylococcus lugdunensis M23590]
          Length = 539

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 39/86 (45%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR I+I + + D       +   + D+ GIV   G +LG   INIA   LGR+     A+
Sbjct: 440 PRIIRINDFSVDFQPNAYQLITYHNDVPGIVGRTGALLGREQINIASMSLGRNTEGGQAM 499

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFV 92
             + +D  I + V++ L        +
Sbjct: 500 MIIAVDQPITDKVIQHLKQTQQFTKI 525


>gi|313618305|gb|EFR90356.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           innocua FSL S4-378]
 gi|313623268|gb|EFR93512.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           innocua FSL J1-023]
          Length = 223

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 39/90 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 129 GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  +   ++ K++    I  V
Sbjct: 189 DEALMVIEVDQQVEQDLISKIAELPGIYQV 218


>gi|289550521|ref|YP_003471425.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus lugdunensis
           HKU09-01]
 gi|289180053|gb|ADC87298.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus lugdunensis
           HKU09-01]
          Length = 539

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 39/86 (45%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR I+I + + D       +   + D+ GIV   G +LG   INIA   LGR+     A+
Sbjct: 440 PRIIRINDFSVDFQPNAYQLITYHNDVPGIVGRTGALLGREQINIASMSLGRNTEGGQAM 499

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFV 92
             + +D  I + V++ L        +
Sbjct: 500 MIIAVDQPITDKVIQHLKQTQQFTKI 525


>gi|290893057|ref|ZP_06556046.1| L-serine dehydratase [Listeria monocytogenes FSL J2-071]
 gi|290557417|gb|EFD90942.1| L-serine dehydratase [Listeria monocytogenes FSL J2-071]
 gi|307571395|emb|CAR84574.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes L99]
          Length = 220

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 126 GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  +  +++ K++    I  V
Sbjct: 186 DEALMVIEVDQHVEQALISKIAELPGIYQV 215


>gi|329936828|ref|ZP_08286507.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoaurantiacus
           M045]
 gi|329303753|gb|EGG47637.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoaurantiacus
           M045]
          Length = 529

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 46/92 (50%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
             + + + E + D+ +   M+ +  AD  G+V  +G +LGE GINIA   + R+ +   A
Sbjct: 437 HQKIVAVGEYDVDLALADHMVVLRYADRPGVVGTLGRVLGEAGINIAGMQVSRAVAGGEA 496

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           ++ L +D ++   V+ +L+  +     +    
Sbjct: 497 LAVLTVDDTVPPHVVAELAEEIGATSARSINL 528


>gi|284049355|ref|YP_003399694.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus fermentans DSM
           20731]
 gi|283953576|gb|ADB48379.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus fermentans DSM
           20731]
          Length = 529

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           D  P   ++Q  ++D+     MI   N D  G++  +G +LG   +NIA+  + R   T 
Sbjct: 436 DETPHITEVQGYHYDLVPEHYMILAKNDDKPGMIGQMGTLLGAAHVNIANMQVARKPKTG 495

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +A+  + +D  +  + L+ ++    I+       
Sbjct: 496 NAMMIMTVDSPVEKATLQMIAGLDGIQSADFVTL 529


>gi|298674284|ref|YP_003726034.1| D-3-phosphoglycerate dehydrogenase [Methanohalobium evestigatum
           Z-7303]
 gi|298287272|gb|ADI73238.1| D-3-phosphoglycerate dehydrogenase [Methanohalobium evestigatum
           Z-7303]
          Length = 525

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 23/98 (23%), Positives = 43/98 (43%), Gaps = 1/98 (1%)

Query: 1   VFSDGKP-RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           V  +GK  R I+I   +FD+     M+ + + +   ++     +LG+  INI+   +G+ 
Sbjct: 428 VSGNGKIGRIIQIDGYHFDIVPTENMLVVDHMNRPNVIGPCAIMLGKNDINISGMQVGQV 487

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              E  I  L +D  +  S+L ++     I   K    
Sbjct: 488 GLGEKTIMVLNVDSEVPESILNEMKSIEGILDAKPVTL 525


>gi|166031293|ref|ZP_02234122.1| hypothetical protein DORFOR_00980 [Dorea formicigenerans ATCC
           27755]
 gi|166028698|gb|EDR47455.1| hypothetical protein DORFOR_00980 [Dorea formicigenerans ATCC
           27755]
          Length = 223

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 33/96 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R   +  I  D       + + N D  G +  V   L    IN+A   + R +  
Sbjct: 125 GGGRIRVSVLDGIEVDFSGESNTLIVRNMDRPGCITEVSAALSYEKINVATMQVFRHKRG 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
             A+  +  D  I  +V+ +L     I  V      
Sbjct: 185 GSAVMVVETDQFIPENVVNELKKKEDILEVISLNLE 220


>gi|315651163|ref|ZP_07904194.1| L-serine dehydratase [Eubacterium saburreum DSM 3986]
 gi|315486561|gb|EFU76912.1| L-serine dehydratase [Eubacterium saburreum DSM 3986]
          Length = 221

 Score = 95.1 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 44/94 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R +KI E++ D       + +V+ D  G++ ++  IL E+ INIA   L R    
Sbjct: 128 GGGKVRIVKIGEVDIDFSGEYSALILVHKDRPGMIAYITKILCEHSINIAFMKLYRESKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A + +  D  I N+V + L  N  I  V   +
Sbjct: 188 NKAYTIIESDEPIQNTVKDDLYKNEYISQVMIVQ 221


>gi|302558214|ref|ZP_07310556.1| phosphoglycerate dehydrogenase [Streptomyces griseoflavus Tu4000]
 gi|302475832|gb|EFL38925.1| phosphoglycerate dehydrogenase [Streptomyces griseoflavus Tu4000]
          Length = 529

 Score = 94.7 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG +LGE GINIA   + R+     A++
Sbjct: 439 KIVAIGEYDVDLALADHMVVLRYEDRPGVVGTVGRVLGEAGINIAGMQVARATVGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++   V+ +L+  +     +    
Sbjct: 499 VLTVDDTVSAGVIGELAEEIGATSARSVNL 528


>gi|297191887|ref|ZP_06909285.1| D-3-phosphoglycerate dehydrogenase [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197721137|gb|EDY65045.1| D-3-phosphoglycerate dehydrogenase [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 530

 Score = 94.7 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M  +   D  G+V  VG ILGE G+NIA   + R++    A+ 
Sbjct: 439 KIVAIGEHDVDLALADHMAVLRYEDRPGVVGTVGRILGEAGLNIAGMQVSRAEEGGEALV 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++  +VL ++S  +     +    
Sbjct: 499 VLTVDDTVPPAVLAEISDEIGAASARSVNL 528


>gi|288553103|ref|YP_003425038.1| L-serine dehydratase subunit beta [Bacillus pseudofirmus OF4]
 gi|288544263|gb|ADC48146.1| L-serine dehydratase beta subunit [Bacillus pseudofirmus OF4]
          Length = 220

 Score = 94.7 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 45/94 (47%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++      +      I +V+ D  G++  V N+L ++ INI H  + R +  
Sbjct: 126 GGGKIEIIELNGFQLKLSGNHPAILVVHNDRYGVIAGVSNVLAKHEINIGHMEVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+  + +D ++ N++L++L     I  V +  
Sbjct: 186 KEALMVIEVDQNVPNTILKELESLPNIVKVTKIH 219


>gi|238922103|ref|YP_002935617.1| L-serine dehydratase [Eubacterium eligens ATCC 27750]
 gi|238873775|gb|ACR73483.1| L-serine dehydratase [Eubacterium eligens ATCC 27750]
          Length = 219

 Score = 94.7 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 33/96 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
              +    +I  I+ +       + + N D  G V  V ++L    +NIA   L R+   
Sbjct: 124 GGSRINIAQIDGISTNFSGDYPTLVVHNMDQPGHVAEVTSMLAHKSVNIAAMQLYRAGRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            +++  L  D  +    +  L     +  V      
Sbjct: 184 GNSVMVLECDQEVPEEGINWLRHAEGVVKVTYLGLE 219


>gi|329727877|gb|EGG64327.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU144]
          Length = 531

 Score = 94.7 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 44/92 (47%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+   P  ++I + + D    +  +   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VFAGFGPSIVRINDYSLDFKPNQYQLVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRND 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           +   A+  L ID      V++ L+       +
Sbjct: 493 AGGDALMILSIDQQASEEVIKILNETSGFNKI 524


>gi|242374013|ref|ZP_04819587.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W1]
 gi|242348264|gb|EES39866.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W1]
          Length = 531

 Score = 94.7 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 43/92 (46%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +   PR ++I   + D    +  I   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VLAGFGPRIVRINNFSLDFKPNQYQIVTCHKDKPGIVGHTGNLLGNHGINIASMTLGRND 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID    + V++ L  +     +
Sbjct: 493 EGGEALMILSIDQQATDEVIKILEESGGFNKI 524


>gi|325107117|ref|YP_004268185.1| D-3-phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
 gi|324967385|gb|ADY58163.1| D-3-phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
          Length = 546

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 22/99 (22%), Positives = 46/99 (46%), Gaps = 2/99 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR-- 58
           +F     R + + +   D  +   M+   + D+ G++  VG  LG++ INI H  LGR  
Sbjct: 436 LFGREYLRLVLLDDYQLDGYLDGTMMVYRHKDVPGLIGAVGTTLGKHKINIGHMALGRET 495

Query: 59  SQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            Q    +I+   +D    + ++E++  +  +  V+  + 
Sbjct: 496 EQPGGDSIAVFNLDTRPSDEIIEEIRQHPDVTDVEIVQL 534


>gi|297616224|ref|YP_003701383.1| D-3-phosphoglycerate dehydrogenase [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297144061|gb|ADI00818.1| D-3-phosphoglycerate dehydrogenase [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 528

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 43/97 (44%), Gaps = 2/97 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +   G+P  ++I   + D+    +++   N D  G++      LGE GINI+   +    
Sbjct: 433 LTGGGRPYIVEINGFDTDLYPRGIVVLAENDDRPGVIGPFTTALGEAGINISMMRVS--S 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                +  + +D ++ ++ L +L     +R V+   F
Sbjct: 491 KDGVNMMAVSVDSNVDDATLARLRSVSGVRKVRVLRF 527


>gi|258645980|ref|ZP_05733449.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Dialister invisus DSM 15470]
 gi|260403351|gb|EEW96898.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Dialister invisus DSM 15470]
          Length = 220

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 39/96 (40%), Gaps = 1/96 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    +I     ++      +   + D+ GIV  VG IL E  +NI++  + R    
Sbjct: 124 GGGRVMITEIDGFPVEITGEEYTLLTNHNDVPGIVADVGKILAEEHVNISNMRVFRKGKG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSV-NVTIRFVKQFEF 97
             A+  +  D  +  SV+ ++   N  I  V   + 
Sbjct: 184 TEAVMIIHSDQKVPESVICRIKEGNKNINSVMTLDI 219


>gi|32474150|ref|NP_867144.1| D-3-phosphoglycerate dehydrogenase [Rhodopirellula baltica SH 1]
 gi|32444687|emb|CAD74689.1| phosphoglycerate dehydrogenase [Rhodopirellula baltica SH 1]
 gi|327541027|gb|EGF27580.1| D-3-phosphoglycerate dehydrogenase [Rhodopirellula baltica WH47]
          Length = 540

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 42/99 (42%), Gaps = 2/99 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR-- 58
           +     PR I +     +  +   ++  V+ D+ GI+  VG   G +G+NIA   +GR  
Sbjct: 431 ILGHEMPRLILVNGYRLESFLDGKLLVFVHKDVPGIIGRVGTTFGSHGVNIAQMAVGREG 490

Query: 59  SQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                 AI  L +DG +  + L+ L     I   +  + 
Sbjct: 491 DAPGGAAIGVLSLDGEVPTAALDDLLAIDAITECQVIDM 529


>gi|47093050|ref|ZP_00230828.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes str. 4b H7858]
 gi|47096534|ref|ZP_00234124.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes str. 1/2a F6854]
 gi|224500044|ref|ZP_03668393.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes Finland 1988]
 gi|293596571|ref|ZP_05262383.2| L-serine dehydratase [Listeria monocytogenes J2818]
 gi|47015066|gb|EAL06009.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes str. 1/2a F6854]
 gi|47018551|gb|EAL09306.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes str. 4b H7858]
 gi|293590353|gb|EFF98687.1| L-serine dehydratase [Listeria monocytogenes J2818]
          Length = 223

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 129 GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  +  +++ K++    I  V
Sbjct: 189 DEALMVIEVDQQVEQALISKIAELPGIYQV 218


>gi|254294765|ref|YP_003060788.1| D-3-phosphoglycerate dehydrogenase [Hirschia baltica ATCC 49814]
 gi|254043296|gb|ACT60091.1| D-3-phosphoglycerate dehydrogenase [Hirschia baltica ATCC 49814]
          Length = 525

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 50/94 (53%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G+ R + ++++  +      ++ I N D  G +  +G+ILGE G+NIA F+LGR +   
Sbjct: 432 NGQSRIVAVKDMALEAKFRPFILFINNNDEAGFIGSLGSILGEAGVNIATFNLGREEQGG 491

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            AI+ + ID  +    + K+     +R+ K   F
Sbjct: 492 DAIAMVGIDQDVPAEAMAKIEALTQVRYAKVLRF 525


>gi|15806309|ref|NP_295015.1| D-3-phosphoglycerate dehydrogenase [Deinococcus radiodurans R1]
 gi|6459038|gb|AAF10861.1|AE001976_4 D-3-phosphoglycerate dehydrogenase [Deinococcus radiodurans R1]
          Length = 544

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF    PR  ++++   +++    ++   N D  G V  + N+LG +GINIA   LGRS+
Sbjct: 449 VFGK-SPRLTRLRDYRVELEPEGFILIASNLDKPGAVAKLSNLLGTWGINIAGMALGRSE 507

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               A+  L +D S+    L+ +     I       
Sbjct: 508 KGGQALFTLTLDDSLTPEQLQAIRDLDVIESAFLVR 543


>gi|153813132|ref|ZP_01965800.1| hypothetical protein RUMOBE_03541 [Ruminococcus obeum ATCC 29174]
 gi|149830787|gb|EDM85877.1| hypothetical protein RUMOBE_03541 [Ruminococcus obeum ATCC 29174]
          Length = 222

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 38/95 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R +KI  +  D       I +++ D  G+  ++   L +  +NIA   L R    
Sbjct: 128 GGGKVRIVKINSVQVDFSGEYSAIIVIHQDKPGVAAYITKCLSDRNVNIAFMRLFRESKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           E A + +  DG +   +   +  N  I  V   + 
Sbjct: 188 EIAYTIVESDGRLPEDIGNTIRKNQHIHEVMIVQM 222


>gi|325265482|ref|ZP_08132204.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium sp. D5]
 gi|324029261|gb|EGB90554.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium sp. D5]
          Length = 241

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 34/93 (36%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    K+  I  +       + + N D  G V  V ++L E  INIA   L R +  
Sbjct: 144 GGGRIMVNKLDGIMVNCTGECPTLIVQNHDRPGHVAAVTSMLAEDSINIATLQLYRGKKG 203

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  + ID  +  + +        I  V   
Sbjct: 204 GDAVMVIEIDQPVPEASIRWFEQQDGIIKVTYI 236


>gi|226355874|ref|YP_002785614.1| D-3-phosphoglycerate dehydrogenase [Deinococcus deserti VCD115]
 gi|226317864|gb|ACO45860.1| putative Phosphoglycerate dehydrogenase [Deinococcus deserti
           VCD115]
          Length = 544

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF    PR  ++++   +++    ++   N D  G V  + N+LG +G+NIA   LGR+ 
Sbjct: 449 VFGR-SPRLTRLRDYRVELEPEGYILIASNEDKPGAVAKLSNLLGTWGVNIAGMALGRAA 507

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               A+  L +D  +    L+ +     I       
Sbjct: 508 KGGQALFTLTLDDGLSAEQLQAIRNLDVIDSAYLVR 543


>gi|154174389|ref|YP_001407860.1| D-3-phosphoglycerate dehydrogenase [Campylobacter curvus 525.92]
 gi|112803368|gb|EAU00712.1| phosphoglycerate dehydrogenase [Campylobacter curvus 525.92]
          Length = 525

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 1/94 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + I     D      MI   N D+ G++  +  IL +  INIA F LGR  
Sbjct: 430 VFGETEQRIVGINGFKTDFKPKGKMIIFKNHDVPGVIAQISKILADEKINIADFRLGR-G 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
               A++ + +D +I    L KL+   T  + + 
Sbjct: 489 DNGMALAVILVDENISKETLTKLNALDTCVWAQY 522


>gi|225569474|ref|ZP_03778499.1| hypothetical protein CLOHYLEM_05559 [Clostridium hylemonae DSM
           15053]
 gi|225161682|gb|EEG74301.1| hypothetical protein CLOHYLEM_05559 [Clostridium hylemonae DSM
           15053]
          Length = 226

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 21/96 (21%), Positives = 35/96 (36%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R  K+  I+         + + N D  G +  V   L E  I+IA   + R +  
Sbjct: 125 GGGRIRVSKLDGIDVSFSGESNTLIVRNIDQPGCITEVAASLSEEDIDIATMQVFRDKKG 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
             A+  +  D  +    L++L     I  V     N
Sbjct: 185 GCAVMVVETDQVVSRDALDRLEGKEGIVNVTFLNVN 220


>gi|294631551|ref|ZP_06710111.1| phosphoglycerate dehydrogenase [Streptomyces sp. e14]
 gi|292834884|gb|EFF93233.1| phosphoglycerate dehydrogenase [Streptomyces sp. e14]
          Length = 529

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +   D  G+V  VG I+GE G+NIA   + R+     A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLRYEDRPGVVGTVGRIIGEAGVNIAGMQVARAAVGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++  +VL ++S  +     +    
Sbjct: 499 VLTVDDTVPPAVLSEVSAEIGATSARSVNL 528


>gi|91774294|ref|YP_566986.1| D-3-phosphoglycerate dehydrogenase [Methanococcoides burtonii DSM
           6242]
 gi|91713309|gb|ABE53236.1| D-3-phosphoglycerate dehydrogenase [Methanococcoides burtonii DSM
           6242]
          Length = 523

 Score = 94.7 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 38/94 (40%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             +P+ + I     D+     MI   + +   ++     +LGE  INI+   +GR +   
Sbjct: 430 GREPKIVMIDGQYVDLVPNGFMIVSNHVNRPNVIGPCCIVLGENNINISGMQVGRVEVGG 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + I  L +D  +   +L+++     I   K    
Sbjct: 490 NTIMALNVDNEVSEGILDEIRAINGILDAKLVTL 523


>gi|224372944|ref|YP_002607316.1| D-3-phosphoglycerate dehydrogenase [Nautilia profundicola AmH]
 gi|223588899|gb|ACM92635.1| D-3-phosphoglycerate dehydrogenase [Nautilia profundicola AmH]
          Length = 522

 Score = 94.3 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
            PR ++ ++ + + +    MI   N D+ G++  VG  L +  INIA F LGR++    A
Sbjct: 432 HPRIVEFKDFDLEFEPKGKMIFFKNTDVPGVIGEVGMTLAKNNINIADFRLGRNKE-GQA 490

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFV 92
           ++ + +D  +   VL +L        V
Sbjct: 491 MAVIIVDNEVNEDVLNELRNLKAALSV 517


>gi|217964034|ref|YP_002349712.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes HCC23]
 gi|217333304|gb|ACK39098.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes HCC23]
          Length = 223

 Score = 94.3 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 129 GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  +  +++ K++    I  V
Sbjct: 189 DEALMVIEVDQHVEQALISKIAELPGIYQV 218


>gi|323140346|ref|ZP_08075277.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Phascolarctobacterium sp. YIT 12067]
 gi|322415150|gb|EFY05938.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Phascolarctobacterium sp. YIT 12067]
          Length = 221

 Score = 94.3 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 37/93 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ +  +I     ++      I  V+ D  G++  V + L   G+NIA   L RS   
Sbjct: 125 GGGQVQVTEIDGFPVELTGRLPAILTVHIDTRGVIALVTSTLANAGVNIATMRLFRSDKG 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A   +  D ++   ++  +S    I  V+  
Sbjct: 185 GMASMVIECDEAVPQEIINLISALQQIESVRFI 217


>gi|313673092|ref|YP_004051203.1| d-3-phosphoglycerate dehydrogenase [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939848|gb|ADR19040.1| D-3-phosphoglycerate dehydrogenase [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 540

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   R I I    FDV    + +   N D  G++  VG ILG + INIA F L R +
Sbjct: 445 VFNDNIGRVIFIDNFYFDVVPKGIFLYFNNYDRPGVIGKVGTILGNHNINIAGFELSRQK 504

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               AI+F+ +D  I N VL+++     +   K  E 
Sbjct: 505 Q-GQAIAFVSVDNPIGNEVLKEILKIDGMIDAKVLEL 540


>gi|283796130|ref|ZP_06345283.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium sp. M62/1]
 gi|291076346|gb|EFE13710.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium sp. M62/1]
 gi|295092230|emb|CBK78337.1| L-serine ammonia-lyase [Clostridium cf. saccharolyticum K10]
 gi|295115517|emb|CBL36364.1| L-serine ammonia-lyase [butyrate-producing bacterium SM4/1]
          Length = 223

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 39/95 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R  +I ++  D       + ++  D  G++  + + L    INIA   L R    
Sbjct: 129 GGGKVRITRINQVEVDFSGEYNTLIVIQRDRQGVIAHITDCLNRANINIAFLKLFRESKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A S +  DG +   + +++  N  ++ V   + 
Sbjct: 189 STAYSIVEFDGILPEGIPDRIKENPDVKDVMLIQL 223


>gi|126649438|ref|ZP_01721679.1| phosphoglycerate dehydrogenase [Bacillus sp. B14905]
 gi|126593763|gb|EAZ87686.1| phosphoglycerate dehydrogenase [Bacillus sp. B14905]
          Length = 535

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +    R +K+++   DV     ++ I N D  G +  V   L E  INIA   +GR+Q
Sbjct: 439 LLNGLGARIVKVEDYVVDVIPQGHLLYIKNTDKPGAIGRVATKLAEKEINIATMQVGRAQ 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  + +  L  ++    I  VK    
Sbjct: 499 VGGTAVMMLTIDNVVTDEDLAFVAQLENIDEVKAINL 535


>gi|224437370|ref|ZP_03658342.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
 gi|313143835|ref|ZP_07806028.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
 gi|313128866|gb|EFR46483.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
          Length = 526

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D   R   I +  FD++    MI   N D+ G+V  VG+ILG Y +NIA F L R  
Sbjct: 432 VFEDRHLRITSINQFQFDIEPKGKMIFFKNTDVPGVVGLVGSILGNYKVNIADFRLARQN 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               A++ + +D  + N  + +L        VK   
Sbjct: 492 K--EAMAVILVDSDVPNEAINELEAIPACLGVKIVN 525


>gi|187780165|ref|ZP_02996638.1| hypothetical protein CLOSPO_03761 [Clostridium sporogenes ATCC
           15579]
 gi|187773790|gb|EDU37592.1| hypothetical protein CLOSPO_03761 [Clostridium sporogenes ATCC
           15579]
          Length = 223

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 33/94 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      I   + +   G   I   + D+ GI+  +  ++   GINI    + R    
Sbjct: 127 GGGNIVITSIDGQSMEFTGGNPTIVTHHKDVPGIISRISTMMYSEGINIGAMKVFRESKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A      DG I   V++++     I  VK   
Sbjct: 187 TTATMTFETDGEIPKKVIDEIKAIKDIENVKIIN 220


>gi|257899613|ref|ZP_05679266.1| L-serine dehydratase [Enterococcus faecium Com15]
 gi|257837525|gb|EEV62599.1| L-serine dehydratase [Enterococcus faecium Com15]
          Length = 222

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 37/93 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G   + +V+ D+ G++  V  IL E   NI    + R    
Sbjct: 129 GGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTGILSETNTNIGTMTVTRESKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E AI  + +D   +   + +L     I  V  F
Sbjct: 189 ESAIMIIEVDNPQVEETVRRLKHLPNIDSVNYF 221


>gi|20093737|ref|NP_613584.1| D-3-phosphoglycerate dehydrogenase [Methanopyrus kandleri AV19]
 gi|19886634|gb|AAM01514.1| Predicted dehydrogenase related to phosphoglycerate dehydrogenase
           [Methanopyrus kandleri AV19]
          Length = 522

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 37/93 (39%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + +     +        +    + + + D  G++  VG ILGE+ +N+A   +GR +   
Sbjct: 429 EDRVYLTSVNGYEVRFKLSGPTLFVWHVDRPGVIGEVGIILGEHRVNVAAMEVGRRERGG 488

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            AI  + +D       L  +     +R V+   
Sbjct: 489 EAIMVIRMDEEPPEECLRAIDEVEPVRRVELVR 521


>gi|73662854|ref|YP_301635.1| putative L-serine dehydratase beta subunit [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
 gi|72495369|dbj|BAE18690.1| putative L-serine dehydratase beta subunit [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
          Length = 221

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 38/90 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   + I   N  +      + + + D  G +  V NILG+  IN+    + R +  
Sbjct: 126 GGGKIEVVAINGFNIAISGNYPALLVFHKDTFGTIGRVANILGDSSINVGSMQVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+    +D ++ +  +EK+     +  V
Sbjct: 186 DQALMTCELDDAVNDETIEKIKNVDGVVTV 215


>gi|20808958|ref|NP_624129.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           tengcongensis MB4]
 gi|20517622|gb|AAM25733.1| Phosphoglycerate dehydrogenase and related dehydrogenases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 533

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 45/93 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++      + +    M+ + N D+ G++  +GN+LG++GINI+   +  +++  
Sbjct: 438 GEELRIVEYMGHKVNFEPTEYMLFVKNKDVPGVIGHIGNVLGDFGINISTMQVSPNKNDG 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  +  D  I    +E L+   +I   K  +
Sbjct: 498 TALMLVSTDKEIPEEAVESLNKLNSIIKAKAVK 530


>gi|55980708|ref|YP_144005.1| L-serine dehydratase subunit beta [Thermus thermophilus HB8]
 gi|55772121|dbj|BAD70562.1| L-serine dehydratase, beta subunit [Thermus thermophilus HB8]
          Length = 220

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 36/93 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  R   +      +      + I N D  G+V  V  IL +  +NIA+  + R +  
Sbjct: 123 GGGLVRVFDVDGFEVRITGSAPTLVIKNVDTPGVVARVARILADDEVNIAYLTVSRKKRG 182

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  + +D  +    L  L     I +V+Q 
Sbjct: 183 GEAMMSIEVDRPLSEVPLRYLEHLSYILWVRQI 215


>gi|189219266|ref|YP_001939907.1| D-3-phosphoglycerate dehydrogenase [Methylacidiphilum infernorum
           V4]
 gi|189186124|gb|ACD83309.1| Phosphoglycerate dehydrogenase and ACT domains [Methylacidiphilum
           infernorum V4]
          Length = 531

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 46/96 (47%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F     R +++     +  +  +++ + N D  GIV  VG ILGE+ INIA   L R+++
Sbjct: 436 FYGRSHRLVQLNFNPIEASMEGILLLLENKDRPGIVGKVGTILGEHSINIAAMSLARAKA 495

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            E AIS L +D      +L K+     I  V+    
Sbjct: 496 GEKAISILNLDNIPSPDILVKIRNIEDIYNVQLISL 531


>gi|46198695|ref|YP_004362.1| L-serine dehydratase [Thermus thermophilus HB27]
 gi|46196318|gb|AAS80735.1| L-serine dehydratase [Thermus thermophilus HB27]
          Length = 220

 Score = 94.3 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 36/93 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  R   +      +      + I N D  G+V  V  IL +  +NIA+  + R +  
Sbjct: 123 GGGLVRVFDVDGFEVRITGSAPTLVIKNVDTPGVVARVARILADDEVNIAYLTVSRKKRG 182

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  + +D  +    L  L     I +V+Q 
Sbjct: 183 GEAMMSIEVDRPLSEVPLRYLEHLSYILWVRQI 215


>gi|73668955|ref|YP_304970.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina barkeri str.
           Fusaro]
 gi|72396117|gb|AAZ70390.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina barkeri str.
           Fusaro]
          Length = 523

 Score = 94.0 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 39/94 (41%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
              P+ + + +   D+     MI   + +   ++     +LG+  INI+   +GRS+   
Sbjct: 430 GDDPKIVAVDDDRVDIFPAGRMIFAKHINRPNVIGPCCMVLGKNNINISGMQVGRSEIGG 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             +  L ID  + + +LE++     I   K    
Sbjct: 490 VTMMVLNIDSEVSDPILEEVRKVDGILDAKLVTL 523


>gi|167037392|ref|YP_001664970.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|320115806|ref|YP_004185965.1| L-serine dehydratase, iron-sulfur-dependent subunit beta
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166856226|gb|ABY94634.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319928897|gb|ADV79582.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 222

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 31/94 (32%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  I  +       +   + D  GIV  V  I  +Y INIA   + R    
Sbjct: 127 GGGNVLLKEINGIEVEFTGEYETLITNHIDRPGIVANVTKIFADYKINIAFMRVYRHSKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + AI  +  D  I +   E +     I       
Sbjct: 187 DKAIMVIESDQKIPDVAKETIKNIDGILNAIIIN 220


>gi|322386439|ref|ZP_08060068.1| L-serine ammonia-lyase beta subunit [Streptococcus cristatus ATCC
           51100]
 gi|321269525|gb|EFX52456.1| L-serine ammonia-lyase beta subunit [Streptococcus cristatus ATCC
           51100]
          Length = 247

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ D+ G++  V   L  Y INIA   + R ++ 
Sbjct: 154 GGGNIQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMTVTREKAG 213

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       +E++     +  V  F+
Sbjct: 214 EKAIMIIEVDSRSCEEAIEEIRKIPHLHNVNFFK 247


>gi|194704786|gb|ACF86477.1| unknown [Zea mays]
          Length = 624

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 38/93 (40%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P    +     DV +   +I     D  G++  VGNILG+  +NI    +GR+   + 
Sbjct: 532 GVPHLTLVGPYEVDVSLEGNLILCRQIDQPGMIGKVGNILGDTNVNINFMSVGRTFRGKQ 591

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI  + +D       LEK+     I      E 
Sbjct: 592 AIMAIGVDEEPDKDTLEKIGAIPAIEEFVFLEL 624


>gi|323486915|ref|ZP_08092231.1| hypothetical protein HMPREF9474_03982 [Clostridium symbiosum
           WAL-14163]
 gi|323691963|ref|ZP_08106212.1| L-serine dehydratase [Clostridium symbiosum WAL-14673]
 gi|323399778|gb|EGA92160.1| hypothetical protein HMPREF9474_03982 [Clostridium symbiosum
           WAL-14163]
 gi|323503972|gb|EGB19785.1| L-serine dehydratase [Clostridium symbiosum WAL-14673]
          Length = 218

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 37/95 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    K+  +  +V   R ++ I N D  G V  V +++    +NIA   L RS+  
Sbjct: 124 GGGRIMINKLDGVEINVTGERPVLIIHNIDKPGYVSEVTSLMASGSVNIATMTLHRSKRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A+  +  D +I    +  L     I  V     
Sbjct: 184 GDAVMVIETDQNIPVEAVRHLEAVKGIFKVTCLNL 218


>gi|313682014|ref|YP_004059752.1| d-3-phosphoglycerate dehydrogenase [Sulfuricurvum kujiense DSM
           16994]
 gi|313154874|gb|ADR33552.1| D-3-phosphoglycerate dehydrogenase [Sulfuricurvum kujiense DSM
           16994]
          Length = 529

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%), Gaps = 1/96 (1%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F+D   R + I     DV+    MI   N D+ G++  VG +L  + +NIA F LGR+  
Sbjct: 435 FNDDVQRIVDINGFGVDVEPKGNMILFKNTDVPGVIGQVGTLLAAHEVNIADFRLGRN-K 493

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +  A++ + +D ++ +  L++LS       V     
Sbjct: 494 SSEALAVIIVDSAVNDKTLKELSNLNACISVSYARI 529


>gi|323704756|ref|ZP_08116333.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535682|gb|EGB25456.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 533

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 45/93 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R ++      + +    M+ + N D+ G++  +GN+LG++GINI+  H+  +++  
Sbjct: 438 GDEIRIVEYLGHRVNFEPTEYMLFVKNKDVPGVIGHIGNVLGDFGINISSMHVSPNKNDG 497

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A+  +  D  I    +E L+   +I   K   
Sbjct: 498 TALMIVNTDREIPIEAVESLNKLNSILRAKAVR 530


>gi|95928509|ref|ZP_01311256.1| D-3-phosphoglycerate dehydrogenase [Desulfuromonas acetoxidans DSM
           684]
 gi|95135299|gb|EAT16951.1| D-3-phosphoglycerate dehydrogenase [Desulfuromonas acetoxidans DSM
           684]
          Length = 528

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 50/97 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F++ + R I + +   +      ++ + N D  G++  +G +L E  IN+A  +L R +
Sbjct: 431 IFNNRECRIIGVDDYAIETIPSGHLLVVRNLDRPGVIALLGRLLAEAEINVAMMNLSRQK 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           ST  A+S + +D  I   V+E+L  + +I    Q + 
Sbjct: 491 STGDAMSLVTVDHKIPEQVMEELRRHDSILSAVQIDL 527


>gi|160940410|ref|ZP_02087755.1| hypothetical protein CLOBOL_05300 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436990|gb|EDP14757.1| hypothetical protein CLOBOL_05300 [Clostridium bolteae ATCC
           BAA-613]
          Length = 222

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 39/94 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R +KI +++ D       + +++ D  G+V  +   L +  +NIA   L R +  
Sbjct: 128 GGGKVRIVKINQVDVDFTGEYSSLIVIHQDKPGVVAHISKCLSDCNVNIAFMKLFREEKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A   +  D  +   + + ++ N  +      +
Sbjct: 188 AQAYCIVESDERLPLEITDWINSNPHVYHTMLVQ 221


>gi|227552588|ref|ZP_03982637.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX1330]
 gi|257888183|ref|ZP_05667836.1| L-serine dehydratase [Enterococcus faecium 1,141,733]
 gi|257896926|ref|ZP_05676579.1| L-serine dehydratase [Enterococcus faecium Com12]
 gi|293379131|ref|ZP_06625282.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium PC4.1]
 gi|227178214|gb|EEI59186.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium TX1330]
 gi|257824237|gb|EEV51169.1| L-serine dehydratase [Enterococcus faecium 1,141,733]
 gi|257833491|gb|EEV59912.1| L-serine dehydratase [Enterococcus faecium Com12]
 gi|292642272|gb|EFF60431.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium PC4.1]
          Length = 222

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 37/93 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G   + +V+ D+ G++  V  IL E   NI    + R    
Sbjct: 129 GGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTGILSETNTNIGTMTVTRESKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E AI  + +D   +   + +L     I  V  F
Sbjct: 189 ESAIMIIEVDNPQVEETVRRLKHLPNIDSVNYF 221


>gi|119963300|ref|YP_948230.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter aurescens TC1]
 gi|119950159|gb|ABM09070.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter aurescens TC1]
          Length = 539

 Score = 94.0 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 42/91 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + +   + ++ I   ++ +  AD  G++  +G+ILG   INI    + R       ++
Sbjct: 448 KLVGVNGYDVEIPISEHLVVVAYADRPGVIGTIGHILGMNNINIGGMQVARQTEGGQVLA 507

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L ID S+   VLE +   +    V++ +  
Sbjct: 508 LLTIDSSVPQQVLEAIKAGIGAEMVREVDLE 538


>gi|163839793|ref|YP_001624198.1| D-3-phosphoglycerate dehydrogenase [Renibacterium salmoninarum ATCC
           33209]
 gi|162953269|gb|ABY22784.1| D-3-phosphoglycerate dehydrogenase [Renibacterium salmoninarum ATCC
           33209]
          Length = 530

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 44/91 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + +   + ++ +   +I +V  D  G+V  VG ILGE GINIA   + R+      + 
Sbjct: 439 KLVGVNGYDVEIPMSEHLIVLVYQDRPGVVGTVGGILGEKGINIAGMQVSRADDGNQVLC 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D ++   VL+ +  ++     ++ +  
Sbjct: 499 LLTVDSAVPQDVLDSVRDSIDASTAREVDLE 529


>gi|220931993|ref|YP_002508901.1| D-3-phosphoglycerate dehydrogenase [Halothermothrix orenii H 168]
 gi|219993303|gb|ACL69906.1| D-3-phosphoglycerate dehydrogenase [Halothermothrix orenii H 168]
          Length = 527

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I+I +   D+++    + I   D  G++  VG+ILG+  +NIA   +GR      AI 
Sbjct: 438 RIIEINDFRIDLNLEGKFLVISYQDKPGVIGKVGSILGQDNVNIASMQVGRKSYGGQAIM 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            +  D     + +EK++ N+ +  +   E 
Sbjct: 498 IIQTDNKPSKATMEKINKNIELTDLTYLEI 527


>gi|262281664|ref|ZP_06059433.1| L-serine dehydratase [Streptococcus sp. 2_1_36FAA]
 gi|262262118|gb|EEY80815.1| L-serine dehydratase [Streptococcus sp. 2_1_36FAA]
          Length = 223

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 43/94 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ D+ G++  V + L  Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTDALSRYNINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEEAVEEIRNIPHLHNVNFFK 223


>gi|284032768|ref|YP_003382699.1| D-3-phosphoglycerate dehydrogenase [Kribbella flavida DSM 17836]
 gi|283812061|gb|ADB33900.1| D-3-phosphoglycerate dehydrogenase [Kribbella flavida DSM 17836]
          Length = 536

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/91 (27%), Positives = 44/91 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R ++I   + +V++   +  +   D  GIV  VG ILGE  INIA   + R +    A+ 
Sbjct: 445 RLVEIDGFDLEVELAEHLAFLSYEDRPGIVGQVGRILGESDINIAGMQVSRDRKGGKALV 504

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D SI  ++L+ ++  V     +  +  
Sbjct: 505 ALSVDSSITPALLDDIATAVQADTARTVDLE 535


>gi|168183067|ref|ZP_02617731.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum Bf]
 gi|237794499|ref|YP_002862051.1| L-serine dehydratase, iron-sulfur-dependent subunit beta
           [Clostridium botulinum Ba4 str. 657]
 gi|182673870|gb|EDT85831.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum Bf]
 gi|229262226|gb|ACQ53259.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum Ba4 str. 657]
          Length = 224

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 32/94 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      I   + +       I   + D+ GI+  +  I+   GINI    + R    
Sbjct: 128 GGGNIVITSIDGQSMEFTGSNPTIVTHHKDVPGIISQISTIMYSEGINIGAMKVFREGKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A      DG I   +++++     I  VK   
Sbjct: 188 TTATMTFETDGEIPKKIIDEIKAIKDIENVKIIN 221


>gi|269121298|ref|YP_003309475.1| D-3-phosphoglycerate dehydrogenase [Sebaldella termitidis ATCC
           33386]
 gi|268615176|gb|ACZ09544.1| D-3-phosphoglycerate dehydrogenase [Sebaldella termitidis ATCC
           33386]
          Length = 528

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
            + + R ++I +   DV I   M+ + N D+ G++  VG ILGE  +NIA  H+GR ++ 
Sbjct: 436 GNNEERIVEINDYPIDVVISENMLLVENNDVPGVIGNVGRILGEEQVNIATMHVGRKEN- 494

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             AI  L +D  +    ++KL     IR VK    
Sbjct: 495 -SAIMLLTVDDVVEEKSIKKLEEFEQIRKVKYLNL 528


>gi|269926541|ref|YP_003323164.1| D-3-phosphoglycerate dehydrogenase [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269790201|gb|ACZ42342.1| D-3-phosphoglycerate dehydrogenase [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 524

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 36/87 (41%), Gaps = 1/87 (1%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + R I++ +   D       +   + D  G++  +G ILG + INI+    GR     
Sbjct: 430 GEEQRVIRLDKFPVDFIPSGYFLFCPHIDRPGVIGAIGTILGNHNINISAAMSGRLAPRG 489

Query: 64  HAISFLCIDGSILNSVLEKLS-VNVTI 89
             +  L +D  + + V E++      I
Sbjct: 490 ETMLVLTLDEPVPDEVCEEIRQKVPGI 516


>gi|297202558|ref|ZP_06919955.1| phosphoglycerate dehydrogenase [Streptomyces sviceus ATCC 29083]
 gi|197709915|gb|EDY53949.1| phosphoglycerate dehydrogenase [Streptomyces sviceus ATCC 29083]
          Length = 529

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +   D  G+V  VG I GE GINIA   + R+ +   A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLKYEDRPGVVGTVGRIFGEAGINIAGMQVSRAIAGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++   VL +++  +     +    
Sbjct: 499 VLTVDDTVPAGVLTEVAEEIGATSARAVNL 528


>gi|169825985|ref|YP_001696143.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus sphaericus
           C3-41]
 gi|168990473|gb|ACA38013.1| Phosphoglycerate dehydrogenase [Lysinibacillus sphaericus C3-41]
          Length = 535

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +    R +K+++   DV     ++ I N D  G +  V   L E  INIA   +GR+Q
Sbjct: 439 LLNGLGARIVKVEDYVVDVIPQGHLLYIKNTDKPGAIGRVATKLAEKDINIATMQVGRAQ 498

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L ID  + N  L  ++    I  VK    
Sbjct: 499 VGGTAVMMLTIDNVVTNEDLAFVAQLENIDEVKAINL 535


>gi|311898491|dbj|BAJ30899.1| putative D-3-phosphoglycerate dehydrogenase [Kitasatospora setae
           KM-6054]
          Length = 528

 Score = 94.0 bits (233), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 2/90 (2%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + +   + DV +   M      D  G+V  +G ILG+ GINIA   + R    + A++
Sbjct: 440 KIVGVDGFDVDVALTDHMAFFHYEDRPGVVGTLGRILGDAGINIAGMQVARD--GDSALA 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            + +D  +   VL +++  +  RF +    
Sbjct: 498 SITVDSEVSQEVLAEIAAAIGARFARSVNL 527


>gi|293335763|ref|NP_001170081.1| hypothetical protein LOC100383999 [Zea mays]
 gi|224033345|gb|ACN35748.1| unknown [Zea mays]
          Length = 519

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 38/93 (40%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P    +     DV +   +I     D  G++  VGNILG+  +NI    +GR+   + 
Sbjct: 427 GVPHLTLVGPYEVDVSLEGNLILCRQIDQPGMIGKVGNILGDTNVNINFMSVGRTFRGKQ 486

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI  + +D       LEK+     I      E 
Sbjct: 487 AIMAIGVDEEPDKDTLEKIGAIPAIEEFVFLEL 519


>gi|199597545|ref|ZP_03210974.1| L-serine deaminase [Lactobacillus rhamnosus HN001]
 gi|199591568|gb|EDY99645.1| L-serine deaminase [Lactobacillus rhamnosus HN001]
          Length = 221

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 1/94 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  +I      + +G+     ++ D+ G++  V  I  + GINI    + R+   
Sbjct: 129 GGGNIQITEINGFKISLSMGQPTYITIHDDVPGMIAQVTKIFSDAGINIGTMTVTRTAKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  +  D    + +L KL +   +R V  FE
Sbjct: 189 EQAIMIIETD-DYHDDILAKLKLLPHMRNVTYFE 221


>gi|312194898|ref|YP_004014959.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EuI1c]
 gi|311226234|gb|ADP79089.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EuI1c]
          Length = 527

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 38/89 (42%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           +   I     D+     +      D  GIV  VG +LG+  INIA+  + R      A+ 
Sbjct: 437 KITAIDGFEVDLRPEAHLAFFRYEDRPGIVGAVGELLGDAHINIANAQVSRLAVGGPALM 496

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            L +D ++   +L++++  +   + +   
Sbjct: 497 SLSLDDAVPADILQEIAKIIGAPYARAVS 525


>gi|229552010|ref|ZP_04440735.1| L-serine ammonia-lyase [Lactobacillus rhamnosus LMS2-1]
 gi|258539425|ref|YP_003173924.1| L-serine dehydratase, iron-sulfur-dependent, subunit beta
           [Lactobacillus rhamnosus Lc 705]
 gi|229314587|gb|EEN80560.1| L-serine ammonia-lyase [Lactobacillus rhamnosus LMS2-1]
 gi|257151101|emb|CAR90073.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Lactobacillus rhamnosus Lc 705]
          Length = 221

 Score = 93.6 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 1/94 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  +I      + +G+     ++ D+ G++  V  I  + GINI    + R+   
Sbjct: 129 GGGNIQITEINGFKISLSMGQPTYITIHDDVPGMIAQVTKIFSDAGINIGTMTVTRTAKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  +  D    + +L KL +   +R V  FE
Sbjct: 189 EQAIMIIETD-DYHDDILAKLKLLPHMRNVTYFE 221


>gi|242081631|ref|XP_002445584.1| hypothetical protein SORBIDRAFT_07g021980 [Sorghum bicolor]
 gi|241941934|gb|EES15079.1| hypothetical protein SORBIDRAFT_07g021980 [Sorghum bicolor]
          Length = 619

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 38/93 (40%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P    +     DV +   +I     D  G++  VGNILG+  +NI+   +GR+   + 
Sbjct: 527 GVPHLTLVGPYEVDVSLEGNLILCRQIDQPGMIGKVGNILGQRNVNISFMSVGRTFRGKQ 586

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI  + +D       LE +     I      E 
Sbjct: 587 AIMAIGVDEEPDKETLENIGAIPAIEEFVFLEL 619


>gi|15893961|ref|NP_347310.1| L-serine dehydratase, beta chain [Clostridium acetobutylicum ATCC
           824]
 gi|15023549|gb|AAK78650.1|AE007582_12 L-serine dehydratase, beta chain [Clostridium acetobutylicum ATCC
           824]
 gi|325508088|gb|ADZ19724.1| L-serine dehydratase, beta chain [Clostridium acetobutylicum EA
           2018]
          Length = 227

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 38/94 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  + I+I   + +       + + + D+ G++  +  ++ E  INIA   + RS   
Sbjct: 128 GGGNIKIIEINGSSVEFTGAYPTLIVSHKDVPGMISKITTMIYENNINIAFLKVYRSSRG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A   +  D  I   +++K+     ++ V    
Sbjct: 188 FAAKMIVETDTVIDKQIIDKMKQIENLKSVIVIN 221


>gi|188587443|ref|YP_001918988.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179352130|gb|ACB86400.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 221

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 39/94 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++ + N  +      +   + D  G+V  +   L +  INIA+  + R++  
Sbjct: 126 GGGLIQISQVDDFNVKLSGQYHALITKHLDRPGLVFRITRYLSDQEINIAYMQVSRTRKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A   L  D  I  S+ + L+ +  I   +  +
Sbjct: 186 DTASLILETDDPISESIKDNLTQDDDIEQARIIQ 219


>gi|289578174|ref|YP_003476801.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter italicus Ab9]
 gi|297544454|ref|YP_003676756.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|289527887|gb|ADD02239.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter italicus Ab9]
 gi|296842229|gb|ADH60745.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 222

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 33/94 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  I  ++      +   + D  GI+  V  I  +Y INIA   + R    
Sbjct: 127 GGGNVLLKEINGIEVEITGEYQTLITNHIDRPGIIANVTKIFADYKINIAFMRVYRHSKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  +  D  I ++  E +     I       
Sbjct: 187 EKAIMVVESDQKIPDAAKETIKNIDGILNAIIIN 220


>gi|299537582|ref|ZP_07050875.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus fusiformis ZC1]
 gi|298726951|gb|EFI67533.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus fusiformis ZC1]
          Length = 537

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 41/97 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +    R +K+++   DV     ++ I N D  G +  V   L E  INIA   +GR+Q
Sbjct: 441 LLNGLGARIVKVEDYVVDVIPQGHLLYIKNTDKPGAIGRVATKLAEKEINIATMQVGRAQ 500

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  +    L  ++    I  VK    
Sbjct: 501 VGGTAVMMLTVDNVVTEEDLVFVAQLENIDEVKAINL 537


>gi|324989556|gb|EGC21502.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK353]
 gi|325686454|gb|EGD28483.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK72]
          Length = 223

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       ++++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEEAIDEIRNIPHLHNVNFFK 223


>gi|218461199|ref|ZP_03501290.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli Kim 5]
          Length = 463

 Score = 93.6 bits (232), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 49/71 (69%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 393 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGGAGVNIANFQLGRDK 452

Query: 61  STEHAISFLCI 71
               AI+ L +
Sbjct: 453 QGGDAIALLYV 463


>gi|21223871|ref|NP_629650.1| D-3-phosphoglycerate dehydrogenase [Streptomyces coelicolor A3(2)]
 gi|256785031|ref|ZP_05523462.1| D-3-phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
 gi|289768924|ref|ZP_06528302.1| phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
 gi|4467266|emb|CAB37591.1| probable D-3-phosphoglycerate dehydrogenase [Streptomyces
           coelicolor A3(2)]
 gi|289699123|gb|EFD66552.1| phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
          Length = 529

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG I+GE G+NIA   + R+     A++
Sbjct: 439 KIVAIGEYDVDLALADHMVVLRYEDRPGVVGTVGRIIGEAGLNIAGMQVARATVGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++ + VL +++  +     +    
Sbjct: 499 VLTVDDTVPSGVLAEVAAEIGATSARSVNL 528


>gi|328945152|gb|EGG39307.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis
           SK1087]
          Length = 223

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       ++++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEEAIDEIRNIPHLHNVNFFK 223


>gi|323350806|ref|ZP_08086465.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis VMC66]
 gi|322122980|gb|EFX94683.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis VMC66]
          Length = 234

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 141 GGGNIQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAG 200

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       ++++     +  V  F+
Sbjct: 201 EKAIMIIEVDSRSCEEAIDEIRNIPHLHNVNFFK 234


>gi|293571548|ref|ZP_06682570.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium E980]
 gi|291608354|gb|EFF37654.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecium E980]
          Length = 222

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 37/93 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G   + +V+ D+ G++  V  IL E   NI    + R    
Sbjct: 129 GGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTGILSETNTNIGTMTVTRESKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E AI  + +D   +   + +L     I  V  F
Sbjct: 189 ESAIMIIEVDNPQIEETVRRLKHLPNIDSVNYF 221


>gi|153852678|ref|ZP_01994115.1| hypothetical protein DORLON_00097 [Dorea longicatena DSM 13814]
 gi|149754320|gb|EDM64251.1| hypothetical protein DORLON_00097 [Dorea longicatena DSM 13814]
          Length = 223

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 37/93 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    K+  I+ +       + I N D  G ++ V   L +  IN+A   + R +  
Sbjct: 125 GGGRICVCKLDGIDVNFSGESCTLIIRNVDEPGRIMEVAAALSKAEINVATMQVFRDKRG 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  +  D  I  S +++L     I  VK  
Sbjct: 185 GTAVMVVETDQVIPQSAIDELESKPGIIRVKFL 217


>gi|28211606|ref|NP_782550.1| L-serine dehydratase beta subunit [Clostridium tetani E88]
 gi|28204048|gb|AAO36487.1| L-serine dehydratase beta subunit [Clostridium tetani E88]
          Length = 228

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 31/94 (32%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      I     +       +   + D  G++  +  I+ +  +NI    L R+   
Sbjct: 128 GGGNIIIFDIDGQEVEFKGDYPTLMTKHKDTPGVISKISTIMYKDNLNIGTMKLYRNSKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A   L  D  I  + +EKL     I  +K   
Sbjct: 188 SMATMALETDNVIPQATIEKLKKIPEIHSIKIIN 221


>gi|225458719|ref|XP_002283022.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 605

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DGKP   K+     DV +   +I + + D  GI+  VG+ILGE  +N++   +GR+   +
Sbjct: 512 DGKPHLTKVGSFGVDVSLEGSLILLRHVDQPGIIGKVGSILGEENVNVSFMSVGRTAPRK 571

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  + +D       L ++     I      E 
Sbjct: 572 QAVMTIGVDEEPSREALTRIGNLPAIEEFVFLEL 605


>gi|299821765|ref|ZP_07053653.1| L-serine ammonia-lyase [Listeria grayi DSM 20601]
 gi|299817430|gb|EFI84666.1| L-serine ammonia-lyase [Listeria grayi DSM 20601]
          Length = 220

 Score = 93.6 bits (232), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 38/95 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++ E   +       I I++ D  G +  V  I+ +  INI    + R    
Sbjct: 126 GGGKVEIVRLNEFELEFTGTAPAIVILHQDKYGAIAAVSRIIADNQINIGQMKVSRKVKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + A+  + +D +    VL++++    I  V     
Sbjct: 186 DEALMVIEVDQTASKEVLDQIAALAGIYQVASIII 220


>gi|314933875|ref|ZP_07841240.1| phosphoglycerate dehydrogenase [Staphylococcus caprae C87]
 gi|313654025|gb|EFS17782.1| phosphoglycerate dehydrogenase [Staphylococcus caprae C87]
          Length = 531

 Score = 93.2 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 40/92 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +   PR ++I + + D       I   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VLAGFGPRIVRINDFSLDFKPNEYQIVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRNN 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID      V+  L        +
Sbjct: 493 EGGDALMILSIDQQASLDVINILRETGGFNRI 524


>gi|114565585|ref|YP_752739.1| D-3-phosphoglycerate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114336520|gb|ABI67368.1| D-3-phosphoglycerate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 530

 Score = 93.2 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 38/84 (45%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           P  ++I     + ++   ++ + N D   ++      LG+ GINIA   + R    E AI
Sbjct: 439 PLLVEINGYETESNLEGYLLVVENEDRPRVIGPFATALGDEGINIAGMKVARKTKGEKAI 498

Query: 67  SFLCIDGSILNSVLEKLSVNVTIR 90
             + +D  +   VLEKLS    I 
Sbjct: 499 MIINVDNKVEEPVLEKLSQLDGIV 522


>gi|226313296|ref|YP_002773190.1| L-serine dehydratase beta chain [Brevibacillus brevis NBRC 100599]
 gi|226096244|dbj|BAH44686.1| probable L-serine dehydratase beta chain [Brevibacillus brevis NBRC
           100599]
          Length = 221

 Score = 93.2 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 40/96 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +F +      + +++ D  G++  V  +L ++ IN+    + R    
Sbjct: 126 GGGKIEVLEVNGFSFQLGFDTPTLLVLHEDRFGMIAAVAKVLTQHNINVGFMEVSRHTRG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
             A+  +  D +I   VLE++     I  V     N
Sbjct: 186 SRALMAIETDSTISPEVLEEIRQIPHIFDVSLLALN 221


>gi|310778370|ref|YP_003966703.1| D-3-phosphoglycerate dehydrogenase [Ilyobacter polytropus DSM 2926]
 gi|309747693|gb|ADO82355.1| D-3-phosphoglycerate dehydrogenase [Ilyobacter polytropus DSM 2926]
          Length = 530

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 45/88 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++++  +F+V     M+ + N D+ G++  VG + GE GINIA   +GR    + AI 
Sbjct: 441 KLVELEGYDFEVKPTEYMLFVKNKDVPGVIGHVGTLAGEKGINIATMQVGRKTKGDTAIM 500

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            L ID  + ++ LE+      +   K  
Sbjct: 501 ILTIDEEVSSTTLEEFKKMDNVVTAKSV 528


>gi|157151322|ref|YP_001449342.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus gordonii str. Challis substr. CH1]
 gi|157076116|gb|ABV10799.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus gordonii str. Challis substr. CH1]
          Length = 223

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       ++++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEEAVKEIRNIPHLHNVNFFK 223


>gi|125719135|ref|YP_001036268.1| L-serine dehydratase beta subunit [Streptococcus sanguinis SK36]
 gi|125499052|gb|ABN45718.1| L-serine dehydratase beta subunit [Streptococcus sanguinis SK36]
 gi|325695738|gb|EGD37637.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK150]
 gi|325698054|gb|EGD39935.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK160]
          Length = 223

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       ++++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEEAIDEIRNIPHLHNVNFFK 223


>gi|322412888|gb|EFY03796.1| putative L-serine dehydratase beta subunit [Streptococcus
           dysgalactiae subsp. dysgalactiae ATCC 27957]
          Length = 223

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I  V+ DI G++  V +IL  + INIA  ++ R  + 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIITVHQDIPGMIAKVTDILSSHNINIATMNVTRESAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D       ++ ++    I  V
Sbjct: 190 EKAIMIIEVDCRECQETIKSIAKIPNIHNV 219


>gi|16803853|ref|NP_465338.1| hypothetical protein lmo1813 [Listeria monocytogenes EGD-e]
 gi|254829192|ref|ZP_05233879.1| L-serine dehydratase [Listeria monocytogenes FSL N3-165]
 gi|254831585|ref|ZP_05236240.1| hypothetical protein Lmon1_09538 [Listeria monocytogenes 10403S]
 gi|16411267|emb|CAC99891.1| lmo1813 [Listeria monocytogenes EGD-e]
 gi|258601602|gb|EEW14927.1| L-serine dehydratase [Listeria monocytogenes FSL N3-165]
          Length = 220

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 126 GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  +  +++ K++    I  V
Sbjct: 186 DEALMVIEVDQQVEQALISKIAELSGIYQV 215


>gi|153937912|ref|YP_001390563.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum F str. Langeland]
 gi|170754410|ref|YP_001780838.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum B1 str. Okra]
 gi|152933808|gb|ABS39306.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum F str. Langeland]
 gi|169119622|gb|ACA43458.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum B1 str. Okra]
 gi|295318644|gb|ADF99021.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum F str. 230613]
          Length = 224

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 32/94 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      I   + +       I   + D+ GI+  +  ++   GINI    + R    
Sbjct: 128 GGGNIVITSIDGQSMEFTGSNPTIVTHHKDVPGIISRISTMMYSEGINIGAMKVFREGKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A      DG I   V++++     I  VK   
Sbjct: 188 TTATMTFETDGEIPKKVIDEIKAIKDIENVKIIN 221


>gi|324991888|gb|EGC23811.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK405]
 gi|324996222|gb|EGC28132.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK678]
 gi|327458512|gb|EGF04862.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK1]
 gi|327471586|gb|EGF17029.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK408]
 gi|327490316|gb|EGF22103.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis
           SK1058]
          Length = 223

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       ++++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEEAIDEIRNIPHLHNVNFFK 223


>gi|189346493|ref|YP_001943022.1| D-3-phosphoglycerate dehydrogenase [Chlorobium limicola DSM 245]
 gi|189340640|gb|ACD90043.1| D-3-phosphoglycerate dehydrogenase [Chlorobium limicola DSM 245]
          Length = 526

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D   R + I +   +      +I   N D  G++  V   L ++ +N+A+  L R +
Sbjct: 430 VFGDKAIRIVMIDQFLVEFKPEGNIIIYNNIDKPGVIANVTQHLLQHNLNVAYVALSRDE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++ + +D  +  S+L+++ +   +        
Sbjct: 490 DKLLAMTAIVVDSKVDPSLLDEIKLVDGVSEAAVVSI 526


>gi|29829272|ref|NP_823906.1| D-3-phosphoglycerate dehydrogenase [Streptomyces avermitilis
           MA-4680]
 gi|29606379|dbj|BAC70441.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces
           avermitilis MA-4680]
          Length = 529

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 45/92 (48%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
             + + + E + D+ +   M+ +   D  G+V  +G ILG  GINIA   + R+ +   A
Sbjct: 437 HQKIVAVGEYDVDLALADHMVVLKYTDRPGVVGTLGRILGGAGINIAGMQVSRAVAGGEA 496

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           ++ L +D ++  +VL +L+  +     +    
Sbjct: 497 LAVLTVDDTVSQNVLTELAEEIGATSARSVNL 528


>gi|271969249|ref|YP_003343445.1| D-3-phosphoglycerate dehydrogenase [Streptosporangium roseum DSM
           43021]
 gi|270512424|gb|ACZ90702.1| D-3-phosphoglycerate dehydrogenase [Streptosporangium roseum DSM
           43021]
          Length = 529

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 40/90 (44%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + +++     +++    +      D  GIV  VG ILG++GINIA   + R      A+ 
Sbjct: 438 KIVEVNGYQMEIEPTDHLSFFTYTDRPGIVGVVGRILGDHGINIASMQVARDVKGGKALI 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  I   V++++   +     +  + 
Sbjct: 498 ALTVDTGIPADVIDQIGAEIGADSGRSVDL 527


>gi|296270774|ref|YP_003653406.1| D-3-phosphoglycerate dehydrogenase [Thermobispora bispora DSM
           43833]
 gi|296093561|gb|ADG89513.1| D-3-phosphoglycerate dehydrogenase [Thermobispora bispora DSM
           43833]
          Length = 529

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 43/90 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + +++     +++    +      D  GIV  VG ILGE+GINIA   + R+     A+ 
Sbjct: 438 KIVEVNGFAMEIEPTDHLAFFTYIDRPGIVGVVGRILGEHGINIASMQVSRNVKGGKALI 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D +I + ++E++   +     +  + 
Sbjct: 498 ALTVDSAIPSELVEEIVGEIGAESGRSVDL 527


>gi|170761438|ref|YP_001786605.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum A3 str. Loch Maree]
 gi|169408427|gb|ACA56838.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum A3 str. Loch Maree]
          Length = 224

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 32/94 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      I   + +       I   + D+ GI+  +  ++   GINI    + R    
Sbjct: 128 GGGNIVITSIDGQSMEFTGSNPTIVTHHKDVPGIISQISTMMYSEGINIGAMKVFREGKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A      DG I   +++++     I  VK   
Sbjct: 188 TTATMTFETDGEIPKKIIDEIKAIKDIENVKIIN 221


>gi|223043512|ref|ZP_03613557.1| phosphoglycerate dehydrogenase [Staphylococcus capitis SK14]
 gi|222443000|gb|EEE49100.1| phosphoglycerate dehydrogenase [Staphylococcus capitis SK14]
          Length = 531

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 40/92 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +   PR ++I + + D       I   + D  GIV   GN+LG +GINIA   LGR+ 
Sbjct: 433 VLAGFGPRIVRINDFSLDFKPNEYQIVTCHKDKPGIVGQTGNLLGSHGINIASMTLGRNN 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID      V+  L        +
Sbjct: 493 EGGDALMILSIDQQASLDVINILRETGGFNRI 524


>gi|78777073|ref|YP_393388.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas denitrificans DSM
           1251]
 gi|78497613|gb|ABB44153.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas denitrificans DSM
           1251]
          Length = 529

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F D   R + I   + +V +   MI + N D+ G++  +G+ L ++ +NIA F L R+ 
Sbjct: 434 IFDDNVFRIVSIDGFDIEVALKGDMIILKNQDVPGVIGNIGSTLAKHNVNIADFSLARND 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
             + A++ + +D  I +  LE+L        V+ 
Sbjct: 494 K-KQALAVILVDNVISDDTLEELLRIDACSSVQY 526


>gi|94984817|ref|YP_604181.1| D-3-phosphoglycerate dehydrogenase [Deinococcus geothermalis DSM
           11300]
 gi|94555098|gb|ABF45012.1| D-3-phosphoglycerate dehydrogenase [Deinococcus geothermalis DSM
           11300]
          Length = 542

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF    PR  ++++   ++     ++   N D  G V  + N+LG +GINIA   LGR+Q
Sbjct: 447 VFGR-SPRLTRLRDYRVELAPEGFILIASNQDRPGAVAKLSNLLGTWGINIAGMALGRAQ 505

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               A+  L +D  +    L+ +     I       
Sbjct: 506 KGGQALFTLTLDDGLTPEQLQAIRDLDVIDSAFLVR 541


>gi|302554336|ref|ZP_07306678.1| phosphoglycerate dehydrogenase [Streptomyces viridochromogenes DSM
           40736]
 gi|302471954|gb|EFL35047.1| phosphoglycerate dehydrogenase [Streptomyces viridochromogenes DSM
           40736]
          Length = 529

 Score = 93.2 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + + E + D+ +   M+ +   D  G+V  VG ILGE GINIA   + R+ +   A++
Sbjct: 439 KIVAVGEYDVDLALADHMVVLRYEDRPGVVGTVGRILGEAGINIAGMQVSRAVAGGEALA 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++   VL +++  +     +    
Sbjct: 499 VLTVDDTVTPGVLAEVAAEIGATSSRSVNL 528


>gi|167998190|ref|XP_001751801.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162696899|gb|EDQ83236.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 630

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 42/86 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+   N DV +   +I     D  G++  VG+ILGE  +NIA   +GR+    
Sbjct: 537 DGVPHLSKVGNFNVDVSLEGSIIFYRQVDQPGMIGKVGSILGEENVNIAFMSVGRTLRGL 596

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  +  D  +  + ++KL+    I
Sbjct: 597 DAIVAIGTDEDLSKATIQKLADIPAI 622


>gi|34558837|gb|AAQ75181.1| D-3-phosphoglycerate dehydrogenase [Alvinella pompejana epibiont
           7G3]
          Length = 529

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +   R I+I     D++    MI   N D+ G++  VG I+  Y +NI+ F LGR  
Sbjct: 434 IFGENTQRIIEINGYKLDLEPKGKMILFRNTDVPGVIGDVGRIIASYNVNISDFRLGRDS 493

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           ++  A++ + +D ++  S+L++LS   T   V     
Sbjct: 494 NS-QALAVVKVDDNVNKSLLQELSSLETCISVAYVVI 529


>gi|148379196|ref|YP_001253737.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum A str. ATCC 3502]
 gi|153930867|ref|YP_001383573.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum A str. ATCC 19397]
 gi|153936988|ref|YP_001387122.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum A str. Hall]
 gi|168178634|ref|ZP_02613298.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum NCTC 2916]
 gi|226948481|ref|YP_002803572.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum A2 str. Kyoto]
 gi|148288680|emb|CAL82761.1| putative L-serine dehydratase, beta chain [Clostridium botulinum A
           str. ATCC 3502]
 gi|152926911|gb|ABS32411.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum A str. ATCC 19397]
 gi|152932902|gb|ABS38401.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum A str. Hall]
 gi|182671043|gb|EDT83017.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum NCTC 2916]
 gi|226842598|gb|ACO85264.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum A2 str. Kyoto]
 gi|322805534|emb|CBZ03099.1| L-serine dehydratase, beta subunit [Clostridium botulinum H04402
           065]
          Length = 224

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 32/94 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      I   + +       I   + D+ GI+  +  ++   GINI    + R    
Sbjct: 128 GGGNIVITSIDGQSMEFTGSNPTIVTHHKDVPGIISQISTMMYSEGINIGAMKVFREGKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A      DG I   +++++     I  VK   
Sbjct: 188 TTATMTFETDGEIPKKIIDEIKAIKDIENVKIIN 221


>gi|326501108|dbj|BAJ98785.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326504920|dbj|BAK06751.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 616

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 38/85 (44%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P    +     DV +   +I     D  G++  VGNILG+  +N++   +GR+   + 
Sbjct: 524 GVPHLTVVGPYEVDVSLEGNLILCRQIDQPGMIGKVGNILGQRNVNVSFMSVGRTSRGKQ 583

Query: 65  AISFLCIDGSILNSVLEKLSVNVTI 89
           AI  + +D       LEK+     I
Sbjct: 584 AIMAIGVDEEPDKKTLEKIGAIPAI 608


>gi|228474509|ref|ZP_04059242.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus hominis SK119]
 gi|228271538|gb|EEK12900.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus hominis SK119]
          Length = 869

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 40/92 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V      R ++I + + D           + D+ G+V   G +LG++ INIA   LGRS 
Sbjct: 771 VIDGFGARIVRINDYSVDFKPNTYQFISYHKDLPGMVGLTGQLLGKHDINIASMSLGRSS 830

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  I   V+++L        +
Sbjct: 831 EGGQAMMILSIDQPITQQVIKELYEIGDFDNI 862


>gi|167768990|ref|ZP_02441043.1| hypothetical protein ANACOL_00311 [Anaerotruncus colihominis DSM
           17241]
 gi|167668630|gb|EDS12760.1| hypothetical protein ANACOL_00311 [Anaerotruncus colihominis DSM
           17241]
          Length = 219

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 39/88 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     K+  +  ++      + +++ D  G +  V   LG YG+NI +F L R Q  
Sbjct: 124 GGGSILITKVNGMAVEITGQYATLIVLHRDAPGTIAAVTECLGSYGVNICNFRLAREQKG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIR 90
             A+  +  DGSI  ++ EK+     I 
Sbjct: 184 GTAVMTIETDGSIDRTLNEKIRALPNII 211


>gi|317129247|ref|YP_004095529.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cellulosilyticus DSM 2522]
 gi|315474195|gb|ADU30798.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cellulosilyticus DSM 2522]
          Length = 220

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 40/94 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      I +V+ D  G +  V  +L ++ INI H  + R +  
Sbjct: 126 GGGKVEIKELNGFKLRLSGNHPAILVVHNDRFGAIASVSTLLAKHEINIGHMEVSRKEVG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+  + ID ++   +L+++     +  V +  
Sbjct: 186 KEALMVIEIDQNVSEVILKEVETLDHVSKVTKIH 219


>gi|295110453|emb|CBL24406.1| L-serine ammonia-lyase [Ruminococcus obeum A2-162]
          Length = 222

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 40/95 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R +KI  +  D       + + + D  G+V ++   L +  +NIA   L R    
Sbjct: 128 GGGKVRIVKINSVQVDFTGEYSAVIVTHQDKPGVVAYITKCLSDRNVNIAFMRLFRESKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           E A + +  DG +   + + + +N  I  V   + 
Sbjct: 188 EIAYTIVESDGHLPEDIDDTIRLNQNIHEVMIVQM 222


>gi|327463812|gb|EGF10128.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis
           SK1057]
          Length = 234

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 141 GGGNIQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAG 200

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       +E++     +  V  F+
Sbjct: 201 EKAIMIIEVDSRSCEEAIEEIRNIPHLHNVNFFK 234


>gi|254383224|ref|ZP_04998577.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. Mg1]
 gi|194342122|gb|EDX23088.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. Mg1]
          Length = 529

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 42/90 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   MI +  AD  G+V  VG  LGE G+NIA   + R++    A+ 
Sbjct: 439 KIVGIGEYDLDLALAEQMIVLRYADRPGVVGTVGRFLGEAGLNIAGMQVARAEEGGEALG 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  +   VL  ++  +     +    
Sbjct: 499 VLTVDAEVPAGVLADIAAEIGAVSARSVSL 528


>gi|22538279|ref|NP_689130.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae 2603V/R]
 gi|25012139|ref|NP_736534.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae NEM316]
 gi|76787626|ref|YP_330693.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae A909]
 gi|76798864|ref|ZP_00781073.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae 18RS21]
 gi|77406512|ref|ZP_00783565.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae H36B]
 gi|77408907|ref|ZP_00785632.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae COH1]
 gi|77412488|ref|ZP_00788789.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae CJB111]
 gi|77413218|ref|ZP_00789416.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae 515]
 gi|22535194|gb|AAN01003.1|AE014289_3 L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae 2603V/R]
 gi|24413683|emb|CAD47763.1| Unknown [Streptococcus agalactiae NEM316]
 gi|76562683|gb|ABA45267.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae A909]
 gi|76585787|gb|EAO62336.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae 18RS21]
 gi|77160758|gb|EAO71871.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae 515]
 gi|77161464|gb|EAO72474.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae CJB111]
 gi|77172498|gb|EAO75642.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae COH1]
 gi|77174884|gb|EAO77700.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus agalactiae H36B]
 gi|319746157|gb|EFV98429.1| L-serine dehydratase [Streptococcus agalactiae ATCC 13813]
          Length = 222

 Score = 92.8 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 42/90 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    + IV+ DI G++  V +IL ++ INIA  ++ R  + 
Sbjct: 129 GGGNIQVTELNGFSVSLTMNTPTLIIVHQDIPGMIAKVTDILSDFNINIAQMNVTRESAG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D       ++K+     +  V
Sbjct: 189 EKAIMIIEVDSRDCQQAVKKIEAIPHLHNV 218


>gi|154502479|ref|ZP_02039539.1| hypothetical protein RUMGNA_00292 [Ruminococcus gnavus ATCC 29149]
 gi|153796875|gb|EDN79295.1| hypothetical protein RUMGNA_00292 [Ruminococcus gnavus ATCC 29149]
          Length = 221

 Score = 92.8 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 35/94 (37%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    ++ EI  +       + I N D  G V  V ++L    +NIA   L R +  
Sbjct: 124 GGGRIMLNELDEITVNCTGACPTLIIRNEDSPGQVAEVTSVLYGKKVNIATLQLHRDKRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            +A+  +  D  +    +  L     I  V   E
Sbjct: 184 GYAVMVIETDQPVEPDTIRDLERLNGISKVTYIE 217


>gi|154484276|ref|ZP_02026724.1| hypothetical protein EUBVEN_01988 [Eubacterium ventriosum ATCC
           27560]
 gi|149734753|gb|EDM50670.1| hypothetical protein EUBVEN_01988 [Eubacterium ventriosum ATCC
           27560]
          Length = 219

 Score = 92.8 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 35/93 (37%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
              +    +I  I+ +       + + N D  G V  V ++L    +NIA   L RS   
Sbjct: 124 GGSRINIAQIDGIDTNFSGECPTLIVHNMDQPGHVSEVTSMLAYKSVNIATMQLYRSAKG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            +A+  +  D  I    +E L     I  V  F
Sbjct: 184 GNAVMVVECDQQIPKEGIEWLKHVEGILKVTYF 216


>gi|283795274|ref|ZP_06344427.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium sp. M62/1]
 gi|291076920|gb|EFE14284.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium sp. M62/1]
 gi|295090162|emb|CBK76269.1| L-serine ammonia-lyase [Clostridium cf. saccharolyticum K10]
          Length = 221

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 32/94 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    K+ +           + I N D  G+V  V  IL    +NIA   L R +  
Sbjct: 124 GGGRIMIDKLDDTEVHCTGSCPTLIIHNQDSPGMVSEVTGILSRKNVNIATLQLYRDKRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D ++    +  L     I  +    
Sbjct: 184 GLAVMVIETDQTVPRETVSMLEKLEGIERIMYIR 217


>gi|224501385|ref|ZP_03669692.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes FSL R2-561]
          Length = 223

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 129 GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  +  +++ K++    I  V
Sbjct: 189 DEALMVIEVDQQVEQALISKIAELSGIYQV 218


>gi|32265634|ref|NP_859666.1| D-3-phosphoglycerate dehydrogenase [Helicobacter hepaticus ATCC
           51449]
 gi|32261682|gb|AAP76732.1| D-3-phosphoglycerate dehydrogenase [Helicobacter hepaticus ATCC
           51449]
          Length = 526

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D   R   I    FD++    MI   N D+ G++  VG+ILG + +NI+ F L R  
Sbjct: 432 VFEDRHLRLTSINHFQFDIEPKGKMIFFKNTDVPGVIGLVGSILGNHQVNISDFRLARQN 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               A++ + +D  + N V+ +L        +K   
Sbjct: 492 K--EAMAVILVDSEVSNEVIGQLENIPACLSIKIVN 525


>gi|325689332|gb|EGD31338.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK115]
          Length = 223

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       + ++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEEAINEIRNIPHLHNVNFFK 223


>gi|170781815|ref|YP_001710147.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169156383|emb|CAQ01531.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 529

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 43/90 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   + +V   R +I +   D  GIV   G   G+  +NIA   + R ++   A+S
Sbjct: 438 KLVEIDGYDVEVPFSRHLIVMKYEDRPGIVAVYGKEFGDAEVNIAGMQIARQEAGGRALS 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  + + VLE +   +    +++ + 
Sbjct: 498 VLSVDSPVPDGVLENVRRAIQTTSLREIDI 527


>gi|322373174|ref|ZP_08047710.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus sp. C150]
 gi|321278216|gb|EFX55285.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus sp. C150]
          Length = 223

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 43/94 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++     ++ +    + IV+ D+ G++  V +IL  YGINIA   + R  + 
Sbjct: 130 GGGNIQVTELNGFAVNLKMNTPTLIIVHQDVPGMIALVTDILSRYGINIAQMTVTRENAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + ID    +  + +++    +  V  F 
Sbjct: 190 EKAIMIIEIDSHQCDEAVTEIAKIPHLHNVNFFS 223


>gi|322383141|ref|ZP_08056963.1| L-serine dehydratase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321152684|gb|EFX45315.1| L-serine dehydratase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 263

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 45/93 (48%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++      +      I +V+ D  G +  V N+L ++ INI H  + R +  
Sbjct: 169 GGGKIEIIELNGFELKLSGEHPAILVVHNDRYGAIASVTNVLTKHYINIGHMEVSRKEKG 228

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           ++A+  + +D ++ + ++E++S    I  V + 
Sbjct: 229 KNALMIIEMDQNLDDYIIEEISKLPNILQVTKI 261


>gi|258508211|ref|YP_003170962.1| L-serine dehydratase subunit beta [Lactobacillus rhamnosus GG]
 gi|257148138|emb|CAR87111.1| L-serine dehydratase, iron-sulfur-dependent,beta subunit
           [Lactobacillus rhamnosus GG]
 gi|259649527|dbj|BAI41689.1| L-serine dehydratase beta subunit [Lactobacillus rhamnosus GG]
          Length = 221

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 1/94 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  +I      + +G+     ++ D+ G++  V  I  + GINI    + R+   
Sbjct: 129 GGGNIQITEINGFKISLSMGQPTYITIHDDVPGMIAQVTKIFSDPGINIGTMTVTRTAKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  +  D    + +L KL +   +R V  FE
Sbjct: 189 EQAIMIIETD-DYHDDILAKLKLLPHMRNVTYFE 221


>gi|237748547|ref|ZP_04579027.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229379909|gb|EEO30000.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 221

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 32/95 (33%), Gaps = 1/95 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIV-NADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
             G+    +I  I          + +    D  G V  V   L  + INIA   L R   
Sbjct: 124 GGGRIIVSRIDGITSHFSGDENTLIVHAQHDRPGHVARVTTELAIHQINIATMQLHRHIK 183

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              A+  +  D +I   ++EKL     I  V    
Sbjct: 184 GGQAVMVIECDSTIPTELVEKLKQMEGIMKVTFLN 218


>gi|194336592|ref|YP_002018386.1| D-3-phosphoglycerate dehydrogenase [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194309069|gb|ACF43769.1| D-3-phosphoglycerate dehydrogenase [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 526

 Score = 92.4 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 43/97 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F + + R + I +   +      +I   N D  G++  V  +L ++ +N+A+  L R +
Sbjct: 430 IFGEKEIRIVMIDQFLVEFKPEGNIIIYNNTDKPGVIANVTQLLLQHNLNVAYVALSRDE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++ + +DG +   +L+++     +        
Sbjct: 490 EKNMAMTAIVVDGEVTPVLLDEVRNVNGVDVANLVSL 526


>gi|221194378|ref|ZP_03567435.1| L-serine dehydratase TdcG [Atopobium rimae ATCC 49626]
 gi|221185282|gb|EEE17672.1| L-serine dehydratase TdcG [Atopobium rimae ATCC 49626]
          Length = 533

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 32/95 (33%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R   +   +  +      I + + D  G++  +  +L +  IN+A     R+   
Sbjct: 128 GGGRIRISGVNGAHVRMAGDMPTIFVSHHDTPGVLAALTAVLAQQHINVATMRTFRAARG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A +   ID  I    L        + +  Q   
Sbjct: 188 GVAYTIFEIDEEISERTLTLFRQAPHVIYATQVYI 222


>gi|294779902|ref|ZP_06745284.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis PC1.1]
 gi|294453014|gb|EFG21434.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis PC1.1]
          Length = 233

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 40/93 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G     +V+ D+ G++  V NIL    INI+   + R    
Sbjct: 140 GGGNIQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKG 199

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E AI  + +D +    ++ +L+    I  V  F
Sbjct: 200 EKAIMIIEVDQAEGGDIVMQLAEIPHIYSVNYF 232


>gi|315639705|ref|ZP_07894844.1| L-serine ammonia-lyase beta subunit [Enterococcus italicus DSM
           15952]
 gi|315484482|gb|EFU74939.1| L-serine ammonia-lyase beta subunit [Enterococcus italicus DSM
           15952]
          Length = 235

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 37/90 (41%), Gaps = 1/90 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G     IV+ D+ G++  V  +L E  +NI    + R    
Sbjct: 143 GGGNIQISEVNGFKLSLSLGTPTFIIVHQDVPGMIAKVSQLLSEATLNIGTMTVTRESKG 202

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D    + VLEK+     I   
Sbjct: 203 EKAIMIIEVDERNSD-VLEKIRKLEHIYSA 231


>gi|94989482|ref|YP_597583.1| L-serinedehydratase beta subunit [Streptococcus pyogenes MGAS9429]
 gi|94993369|ref|YP_601468.1| L-serine dehydratase beta subunit [Streptococcus pyogenes MGAS2096]
 gi|94542990|gb|ABF33039.1| L-serinedehydratase beta subunit [Streptococcus pyogenes MGAS9429]
 gi|94546877|gb|ABF36924.1| L-serine dehydratase beta subunit [Streptococcus pyogenes MGAS2096]
          Length = 225

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 37/90 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I  V+ DI G++  V +IL    INIA  ++ R  + 
Sbjct: 132 GGGNIQVTELNGFSVSLSMNTPTIVTVHKDIPGMIAKVTDILSSNNINIATMNVTRESAG 191

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E A   + +D         +++    I  V
Sbjct: 192 EKATMIIEVDSRECQEAANQIAKIPHIYNV 221


>gi|148272280|ref|YP_001221841.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|147830210|emb|CAN01143.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
          Length = 529

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 43/90 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   + +V   R +I +   D  GIV   G   G+  +NIA   + R ++   A+S
Sbjct: 438 KLVEIDGYDVEVPFSRHLIVMKYEDRPGIVAVYGKEFGDAEVNIAGMQIARQEAGGRALS 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  + + VLE +   +    +++ + 
Sbjct: 498 VLSVDSPVPDGVLENVRQAIQATSLREIDI 527


>gi|312144313|ref|YP_003995759.1| D-3-phosphoglycerate dehydrogenase [Halanaerobium sp.
           'sapolanicus']
 gi|311904964|gb|ADQ15405.1| D-3-phosphoglycerate dehydrogenase [Halanaerobium sp.
           'sapolanicus']
          Length = 534

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 39/79 (49%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           R I+I  +  D+D+    I +   D  G++  +G  LGE  INIA+  +GR  +   A+ 
Sbjct: 440 RVIEINGLRIDLDLSGEFIIVTYQDKPGVIGKIGTSLGEENINIANMQVGRQTAGGEAVM 499

Query: 68  FLCIDGSILNSVLEKLSVN 86
            + ID       ++K+  +
Sbjct: 500 LMQIDSKPSPETMKKIKNH 518


>gi|288573665|ref|ZP_06392022.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288569406|gb|EFC90963.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 224

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 36/82 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  R  +I     D+D     + I + D  G++  + + L    +NIA   L R    
Sbjct: 123 GGGSVRIQEIDGFPVDIDGELPTLVIFHRDKPGVMASITSELFRMKLNIAQMTLKRKARG 182

Query: 63  EHAISFLCIDGSILNSVLEKLS 84
           + A+ F+ +DG++    L+ L 
Sbjct: 183 KDAMVFIEMDGALDEESLKSLE 204


>gi|320334822|ref|YP_004171533.1| D-3-phosphoglycerate dehydrogenase [Deinococcus maricopensis DSM
           21211]
 gi|319756111|gb|ADV67868.1| D-3-phosphoglycerate dehydrogenase [Deinococcus maricopensis DSM
           21211]
          Length = 538

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 1/96 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF     R  ++++   ++     ++ + N D  G V  + N+LG +GINIA   LGRS+
Sbjct: 443 VFGR-MARLTRLRDYRVELAPEGFILIVSNQDKPGAVAKLSNLLGTWGINIAGMSLGRSE 501

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               A+  L +D  +    L  +     +      +
Sbjct: 502 RGGQALFTLTLDDGLTPEQLRAIRDLDVVENAYLVQ 537


>gi|294500972|ref|YP_003564672.1| L-serine dehydratase, iron-sulfur-dependent subunit beta [Bacillus
           megaterium QM B1551]
 gi|294350909|gb|ADE71238.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           megaterium QM B1551]
          Length = 220

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 43/90 (47%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK +  ++     ++      I +V+ D  G +  V NIL ++ INI H  + R +  
Sbjct: 126 GGGKIQITELNGFELNLSGMNPAILVVHNDRFGAIATVTNILMKHSINIGHMEVSRKERG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E A+  + +D +I + V+E+L     I  V
Sbjct: 186 EVALMAIEMDTNIEDDVIEELKTLPHIIQV 215


>gi|311029987|ref|ZP_07708077.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           sp. m3-13]
          Length = 220

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 43/93 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      + +V+ D  G +  V N+L ++ INI H  + R +  
Sbjct: 126 GGGKIEITELNGFALKLSGNHPALLVVHDDRYGAIAGVANVLAKFAINIGHMEVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A+  + +D +I  +V+++LS    I  V + 
Sbjct: 186 QKALMTIEVDQNIDEAVIQELSALPNITQVTKI 218


>gi|251783540|ref|YP_002997845.1| L-serine dehydratase subunit beta [Streptococcus dysgalactiae
           subsp. equisimilis GGS_124]
 gi|242392172|dbj|BAH82631.1| L-serinedehydratase beta subunit [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 225

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 39/90 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I  V+ DI G++  V +IL    INIA  ++ R  + 
Sbjct: 132 GGGNIQVTELNGFSVSLSMNTPTIITVHQDIPGMIAKVTDILSSSNINIATMNVTRESAG 191

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D       ++ ++    I  V
Sbjct: 192 EKAIMIIEVDSRECQDAVKSIAKIPNIHNV 221


>gi|327467647|gb|EGF13144.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis SK330]
          Length = 234

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 141 GGGNIQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAG 200

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       + ++     +  V  F+
Sbjct: 201 EKAIMIIEVDSRSCEEAINEIRNIPHLHNVNFFK 234


>gi|295706319|ref|YP_003599394.1| L-serine dehydratase, iron-sulfur-dependent subunit beta [Bacillus
           megaterium DSM 319]
 gi|294803978|gb|ADF41044.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           megaterium DSM 319]
          Length = 220

 Score = 92.0 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 43/90 (47%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK +  ++     ++      I +V+ D  G +  V NIL ++ INI H  + R +  
Sbjct: 126 GGGKIQITELNGFELNLSGMNPAILVVHNDRFGAIATVTNILMKHSINIGHMEVSRKERG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E A+  + +D +I + V+E+L     I  V
Sbjct: 186 EVALMAIEMDTNIEDDVIEELKTLPHILQV 215


>gi|218296553|ref|ZP_03497281.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Thermus
           aquaticus Y51MC23]
 gi|218243095|gb|EED09627.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Thermus
           aquaticus Y51MC23]
          Length = 220

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 37/93 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  R   +      +      + + N D  G+V  V  IL +  +NIA+  + R +  
Sbjct: 123 GGGLVRVFDLDGFEVRLTGQAPTLVVKNVDTPGVVARVARILADDEVNIAYLTVSRKKKG 182

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  L +D  +    L+ L     I +V+Q 
Sbjct: 183 GEAMMSLEVDRPLSEVPLKYLEYLSYILWVRQI 215


>gi|50915204|ref|YP_061176.1| L-serine dehydratase beta subunit [Streptococcus pyogenes
           MGAS10394]
 gi|94991469|ref|YP_599569.1| L-serinedehydratase beta subunit [Streptococcus pyogenes MGAS10270]
 gi|94995353|ref|YP_603451.1| L-serinedehydratase beta subunit [Streptococcus pyogenes MGAS10750]
 gi|50904278|gb|AAT87993.1| L-serine dehydratase beta subunit [Streptococcus pyogenes
           MGAS10394]
 gi|94544977|gb|ABF35025.1| L-serinedehydratase beta subunit [Streptococcus pyogenes MGAS10270]
 gi|94548861|gb|ABF38907.1| L-serinedehydratase beta subunit [Streptococcus pyogenes MGAS10750]
          Length = 225

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 37/90 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I  V+ DI G++  V +IL    INIA  ++ R  + 
Sbjct: 132 GGGNIQVTELNGFSVSLSMNTPTIVTVHKDIPGMIAKVTDILSSNNINIATMNVTRESAG 191

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E A   + +D         +++    I  V
Sbjct: 192 EKATMIIEVDSRECQEAANQIAKIPHIYNV 221


>gi|72161018|ref|YP_288675.1| D-3-phosphoglycerate dehydrogenase [Thermobifida fusca YX]
 gi|71914750|gb|AAZ54652.1| D-3-phosphoglycerate dehydrogenase [Thermobifida fusca YX]
          Length = 528

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 2/90 (2%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + +++     ++     M      D  G+V  VG +LG+  +NIA   + R +    A+ 
Sbjct: 438 KLVEVNGYTMEIAPSEHMAFFSYHDRPGVVGVVGQLLGQAQVNIAGMQVSRDKEGGAALI 497

Query: 68  FLCIDGSILNSVLEKLSVNVT--IRFVKQF 95
            L +D +I +  LE +S  +   I  V   
Sbjct: 498 ALTVDSAIPDETLETISKEIGAEISRVDLV 527


>gi|307826385|ref|ZP_07656587.1| D-3-phosphoglycerate dehydrogenase [Methylobacter tundripaludum
           SV96]
 gi|307732562|gb|EFO03437.1| D-3-phosphoglycerate dehydrogenase [Methylobacter tundripaludum
           SV96]
          Length = 527

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 16/97 (16%), Positives = 42/97 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +     PR + I + + +V     ++   + D  G++  + ++LG   INI+   +G + 
Sbjct: 431 LLGGCHPRLVCIDQFDIEVVPVGTLLVTQHDDKPGVISAISSVLGNANINISRMQVGTAD 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +   +   +L++L     +    Q   
Sbjct: 491 EQQRAMAVISVSEPLTEDLLQQLCHIPAVHKAIQINL 527


>gi|327401404|ref|YP_004342243.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus veneficus SNP6]
 gi|327316912|gb|AEA47528.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus veneficus SNP6]
          Length = 523

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 17/95 (17%), Positives = 34/95 (35%), Gaps = 1/95 (1%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHF-HLGRSQST 62
             + R ++I     D       +  ++ D  G++  VG + G++ INIA           
Sbjct: 429 GSEYRIVRIDRYKVDFVPEGHYVISLHEDKPGVIGRVGTLFGKHNINIAGMLVGRYGGRG 488

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +  L +D    + VL+++     I        
Sbjct: 489 GVQLMLLLVDDPPSDEVLDEMVKLDGIIDAVYVHL 523


>gi|224063477|ref|XP_002301163.1| predicted protein [Populus trichocarpa]
 gi|222842889|gb|EEE80436.1| predicted protein [Populus trichocarpa]
          Length = 598

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 39/86 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DGKP   K+     DV +   ++     D  G++  VGNILGE  +N+    +GR    +
Sbjct: 505 DGKPHLTKVGSFGVDVSMEGSLVLCRQVDQPGMIGSVGNILGEENVNVNFMSVGRIAPRK 564

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            A+  + +D       L+++     +
Sbjct: 565 QAVMIIGVDEEPSKEALKRIGEIPAV 590


>gi|255593056|ref|XP_002535782.1| L-serine dehydratase, beta chain, putative [Ricinus communis]
 gi|223521981|gb|EEF26601.1| L-serine dehydratase, beta chain, putative [Ricinus communis]
          Length = 207

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 37/90 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I  V+ DI G++  V +IL    INIA  ++ R  + 
Sbjct: 114 GGGNIQVTELNGFSVSLSMNTPTIVTVHKDIPGMIAKVTDILSSNNINIATMNVTRESAG 173

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E A   + +D         +++    I  V
Sbjct: 174 EKATMIIEVDSRECQEAANQIAKIPHIYNV 203


>gi|56808668|ref|ZP_00366392.1| COG1760: L-serine deaminase [Streptococcus pyogenes M49 591]
          Length = 223

 Score = 92.0 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 37/90 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I  V+ DI G++  V +IL    INIA  ++ R  + 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIVTVHKDIPGMIAKVTDILSSNNINIATMNVTRESAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E A   + +D         +++    I  V
Sbjct: 190 EKATMIIEVDSRECQEAANQIAKIPHIYNV 219


>gi|254721740|ref|ZP_05183529.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A1055]
          Length = 219

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 126 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  + + V+E++     I  V   E
Sbjct: 186 RRALMVIETDEILADEVIEEIKAQQNICQVTIME 219


>gi|228477732|ref|ZP_04062361.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus salivarius SK126]
 gi|228250621|gb|EEK09832.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus salivarius SK126]
          Length = 223

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 43/94 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++     ++ +    + IV+ D+ G++  V +IL  YGINIA   + R  + 
Sbjct: 130 GGGNIQVTELNGFAVNLKMNTPTLIIVHQDVPGMIALVTDILSRYGINIAQMTVTRENAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + ID    +  + +++    +  V  F 
Sbjct: 190 EKAIMIIEIDSHQCDEAVTEIARIPHLHNVNFFS 223


>gi|301103195|ref|XP_002900684.1| D-3-phosphoglycerate dehydrogenase, putative [Phytophthora
           infestans T30-4]
 gi|262101947|gb|EEY59999.1| D-3-phosphoglycerate dehydrogenase, putative [Phytophthora
           infestans T30-4]
          Length = 603

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 5/96 (5%)

Query: 1   VFSDGKPRFIKIQEINFDVD---IGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLG 57
           VF +  PR +++ E + D         ++   N D+ G +  + + L +  INIA+F L 
Sbjct: 506 VFGED-PRVVRVNEYS-DFPAFRPKGNILVFNNEDVPGAIAGILSELSDAKINIANFGLA 563

Query: 58  RSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVK 93
           R  + EH +  L +D    +  L  L    ++R V+
Sbjct: 564 RQNNVEHPLGILALDSVPSDETLNALKDLPSVRSVR 599


>gi|206976230|ref|ZP_03237138.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus H3081.97]
 gi|217961632|ref|YP_002340202.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus AH187]
 gi|229140875|ref|ZP_04269420.1| L-serine dehydratase, beta chain [Bacillus cereus BDRD-ST26]
 gi|229198269|ref|ZP_04324976.1| L-serine dehydratase, beta chain [Bacillus cereus m1293]
 gi|206745426|gb|EDZ56825.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus H3081.97]
 gi|217063021|gb|ACJ77271.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus AH187]
 gi|228585148|gb|EEK43259.1| L-serine dehydratase, beta chain [Bacillus cereus m1293]
 gi|228642665|gb|EEK98951.1| L-serine dehydratase, beta chain [Bacillus cereus BDRD-ST26]
          Length = 220

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  + + V+E++     I  V   E
Sbjct: 187 RRALMVIETDEILADEVIEEIKAQQNICQVTIME 220


>gi|42783255|ref|NP_980502.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus ATCC 10987]
 gi|49478556|ref|YP_038204.1| L-serine dehydratase subunit beta [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|52141356|ref|YP_085473.1| L-serine dehydratase, beta subunit [Bacillus cereus E33L]
 gi|118479337|ref|YP_896488.1| L-serine ammonia-lyase [Bacillus thuringiensis str. Al Hakam]
 gi|196038789|ref|ZP_03106097.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus NVH0597-99]
 gi|196047201|ref|ZP_03114417.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus 03BB108]
 gi|218905278|ref|YP_002453112.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus AH820]
 gi|222097588|ref|YP_002531645.1| l-serine dehydratase, beta subunit [Bacillus cereus Q1]
 gi|225866124|ref|YP_002751502.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus 03BB102]
 gi|228916779|ref|ZP_04080344.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228935461|ref|ZP_04098279.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228947859|ref|ZP_04110146.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229093202|ref|ZP_04224320.1| L-serine dehydratase, beta chain [Bacillus cereus Rock3-42]
 gi|229186386|ref|ZP_04313550.1| L-serine dehydratase, beta chain [Bacillus cereus BGSC 6E1]
 gi|301055635|ref|YP_003793846.1| L-serine dehydratase subunit beta [Bacillus anthracis CI]
 gi|42739183|gb|AAS43110.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus ATCC 10987]
 gi|49330112|gb|AAT60758.1| L-serine dehydratase, beta subunit [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|51974825|gb|AAU16375.1| L-serine dehydratase, beta subunit [Bacillus cereus E33L]
 gi|118418562|gb|ABK86981.1| L-serine ammonia-lyase [Bacillus thuringiensis str. Al Hakam]
 gi|196021950|gb|EDX60641.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus 03BB108]
 gi|196030512|gb|EDX69111.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus NVH0597-99]
 gi|218535694|gb|ACK88092.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus AH820]
 gi|221241646|gb|ACM14356.1| L-serine dehydratase, beta subunit [Bacillus cereus Q1]
 gi|225790694|gb|ACO30911.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus 03BB102]
 gi|228597013|gb|EEK54669.1| L-serine dehydratase, beta chain [Bacillus cereus BGSC 6E1]
 gi|228690176|gb|EEL43970.1| L-serine dehydratase, beta chain [Bacillus cereus Rock3-42]
 gi|228811846|gb|EEM58180.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228824213|gb|EEM70027.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228842966|gb|EEM88049.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|300377804|gb|ADK06708.1| L-serine dehydratase subunit beta [Bacillus cereus biovar anthracis
           str. CI]
 gi|324328045|gb|ADY23305.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 219

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 126 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  + + V+E++     I  V   E
Sbjct: 186 RRALMVIETDEILADEVIEEIKAQQNICQVTIME 219


>gi|15675923|ref|NP_270097.1| putative L-serine dehydratase subunit beta [Streptococcus pyogenes
           M1 GAS]
 gi|71911654|ref|YP_283204.1| L-serine dehydratase [Streptococcus pyogenes MGAS5005]
 gi|13623162|gb|AAK34818.1| putative L-serine dehydratase beta subunit [Streptococcus pyogenes
           M1 GAS]
 gi|71854436|gb|AAZ52459.1| L-serine dehydratase [Streptococcus pyogenes MGAS5005]
          Length = 223

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 37/90 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I  V+ DI G++  V +IL    INIA  ++ R  + 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIVTVHKDIPGMIAKVTDILSSNNINIATMNVTRESAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E A   + +D         +++    I  V
Sbjct: 190 EKATMIIEVDSRECQEAANQIAKIPHIYNV 219


>gi|261404380|ref|YP_003240621.1| L-serine dehydratase, iron-sulfur-dependent subunit beta
           [Paenibacillus sp. Y412MC10]
 gi|261280843|gb|ACX62814.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Paenibacillus sp. Y412MC10]
          Length = 227

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 13/90 (14%), Positives = 39/90 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G    +++   +    +   ++ + + D  G+V  +  +L   G+NIA+  + R    
Sbjct: 126 GGGSVEMLRVNGFDVKFTMNYPVLLVFHDDTPGMVAHITRLLEAGGVNIAYMDVDRKGRG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A++ +  D ++   +++ +    ++  V
Sbjct: 186 GDAMTVVESDEAVPAELMKHIEGLPSVHRV 215


>gi|229152340|ref|ZP_04280533.1| L-serine dehydratase, beta chain [Bacillus cereus m1550]
 gi|228631302|gb|EEK87938.1| L-serine dehydratase, beta chain [Bacillus cereus m1550]
          Length = 220

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  + + V+E++     I  V   E
Sbjct: 187 RRALMVIETDELLADEVIEEIKAQQNICQVTIME 220


>gi|30022220|ref|NP_833851.1| L-serine dehydratase [Bacillus cereus ATCC 14579]
 gi|206970981|ref|ZP_03231932.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus AH1134]
 gi|218235415|ref|YP_002368942.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus B4264]
 gi|228922889|ref|ZP_04086187.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228954424|ref|ZP_04116450.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228960407|ref|ZP_04122059.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|229047832|ref|ZP_04193412.1| L-serine dehydratase, beta chain [Bacillus cereus AH676]
 gi|229071645|ref|ZP_04204863.1| L-serine dehydratase, beta chain [Bacillus cereus F65185]
 gi|229081397|ref|ZP_04213900.1| L-serine dehydratase, beta chain [Bacillus cereus Rock4-2]
 gi|229111613|ref|ZP_04241164.1| L-serine dehydratase, beta chain [Bacillus cereus Rock1-15]
 gi|229129419|ref|ZP_04258390.1| L-serine dehydratase, beta chain [Bacillus cereus BDRD-Cer4]
 gi|229146715|ref|ZP_04275081.1| L-serine dehydratase, beta chain [Bacillus cereus BDRD-ST24]
 gi|229180420|ref|ZP_04307763.1| L-serine dehydratase, beta chain [Bacillus cereus 172560W]
 gi|229192352|ref|ZP_04319316.1| L-serine dehydratase, beta chain [Bacillus cereus ATCC 10876]
 gi|29897777|gb|AAP11052.1| L-serine dehydratase [Bacillus cereus ATCC 14579]
 gi|206733753|gb|EDZ50924.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus AH1134]
 gi|218163372|gb|ACK63364.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus B4264]
 gi|228591132|gb|EEK48987.1| L-serine dehydratase, beta chain [Bacillus cereus ATCC 10876]
 gi|228603167|gb|EEK60645.1| L-serine dehydratase, beta chain [Bacillus cereus 172560W]
 gi|228636735|gb|EEK93199.1| L-serine dehydratase, beta chain [Bacillus cereus BDRD-ST24]
 gi|228654024|gb|EEL09891.1| L-serine dehydratase, beta chain [Bacillus cereus BDRD-Cer4]
 gi|228671995|gb|EEL27288.1| L-serine dehydratase, beta chain [Bacillus cereus Rock1-15]
 gi|228702019|gb|EEL54502.1| L-serine dehydratase, beta chain [Bacillus cereus Rock4-2]
 gi|228711581|gb|EEL63538.1| L-serine dehydratase, beta chain [Bacillus cereus F65185]
 gi|228723624|gb|EEL74989.1| L-serine dehydratase, beta chain [Bacillus cereus AH676]
 gi|228799268|gb|EEM46233.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228805356|gb|EEM51949.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228836944|gb|EEM82287.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 220

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  + + V+E++     I  V   E
Sbjct: 187 RRALMVIETDELLADEVIEEIKAQQNICQVTIME 220


>gi|168014318|ref|XP_001759699.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162689238|gb|EDQ75611.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 575

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 44/94 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+   + DV +   +I     D  G++  VG+ILGE  +NI+   +GR+   +
Sbjct: 482 DGVPHLSKVGNFSVDVSLDGNVILYRQVDQPGMIGKVGSILGEDNVNISFMSVGRTLRGQ 541

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            AI  +  D  + ++ ++KL     I  +     
Sbjct: 542 AAIVAIGTDEDVSDATIQKLKELPAIEELVFLRL 575


>gi|71904535|ref|YP_281338.1| L-serine dehydratase [Streptococcus pyogenes MGAS6180]
 gi|71803630|gb|AAX72983.1| L-serine dehydratase [Streptococcus pyogenes MGAS6180]
          Length = 225

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 37/90 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I  V+ DI G++  V +IL    INIA  ++ R  + 
Sbjct: 132 GGGNIQVTELNGFSVSLSMNTPTIVTVHKDIPGMIAKVTDILSSNNINIATMNVTRESAG 191

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E A   + +D         +++    I  V
Sbjct: 192 EKATMIIEVDSRECQEAANQIAKIPHIYNV 221


>gi|302142267|emb|CBI19470.3| unnamed protein product [Vitis vinifera]
          Length = 532

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DGKP   K+     DV +   +I + + D  GI+  VG+ILGE  +N++   +GR+   +
Sbjct: 439 DGKPHLTKVGSFGVDVSLEGSLILLRHVDQPGIIGKVGSILGEENVNVSFMSVGRTAPRK 498

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  + +D       L ++     I      E 
Sbjct: 499 QAVMTIGVDEEPSREALTRIGNLPAIEEFVFLEL 532


>gi|323128292|gb|ADX25589.1| putative L-serine dehydratase beta subunit [Streptococcus
           dysgalactiae subsp. equisimilis ATCC 12394]
          Length = 223

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 39/90 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I  V+ DI G++  V +IL    INIA  ++ R  + 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIITVHQDIPGMIAKVTDILSSSNINIATMNVTRESAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D       ++ ++    I  V
Sbjct: 190 EKAIMIIEVDSRECQDAVKSIAKIPNIHNV 219


>gi|19747022|ref|NP_608158.1| putative L-serine dehydratase beta subunit [Streptococcus pyogenes
           MGAS8232]
 gi|21911377|ref|NP_665645.1| putative L-serine dehydratase beta subunit [Streptococcus pyogenes
           MGAS315]
 gi|28896749|ref|NP_803099.1| L-serine dehydratase beta subunit [Streptococcus pyogenes SSI-1]
 gi|139474610|ref|YP_001129326.1| putative L-serine dehydratase, beta chain [Streptococcus pyogenes
           str. Manfredo]
 gi|306826438|ref|ZP_07459750.1| L-serine ammonia-lyase beta subunit [Streptococcus pyogenes ATCC
           10782]
 gi|19749280|gb|AAL98657.1| putative L-serine dehydratase beta subunit [Streptococcus pyogenes
           MGAS8232]
 gi|21905593|gb|AAM80448.1| putative L-serine dehydratase beta subunit [Streptococcus pyogenes
           MGAS315]
 gi|28812003|dbj|BAC64932.1| putative L-serine dehydratase beta subunit [Streptococcus pyogenes
           SSI-1]
 gi|134272857|emb|CAM31138.1| putative L-serine dehydratase, beta chain [Streptococcus pyogenes
           str. Manfredo]
 gi|304431368|gb|EFM34365.1| L-serine ammonia-lyase beta subunit [Streptococcus pyogenes ATCC
           10782]
          Length = 223

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 37/90 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I  V+ DI G++  V +IL    INIA  ++ R  + 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIVTVHKDIPGMIAKVTDILSSNNINIATMNVTRESAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E A   + +D         +++    I  V
Sbjct: 190 EKATMIIEVDSRECQEAANQIAKIPHIYNV 219


>gi|224100535|ref|XP_002311914.1| predicted protein [Populus trichocarpa]
 gi|222851734|gb|EEE89281.1| predicted protein [Populus trichocarpa]
          Length = 637

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 40/85 (47%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           GKP   ++   + DV +   +I     D  G++  VGNILGE  +N++   +GR+     
Sbjct: 545 GKPHLTRVGSFSVDVSLEGNLILCRQVDQPGMIGQVGNILGEQNVNVSFMSVGRTVQRRK 604

Query: 65  AISFLCIDGSILNSVLEKLSVNVTI 89
           AI  + +D       L+K+     I
Sbjct: 605 AIMAIGVDEEPNQETLKKIGEVPAI 629


>gi|327438749|dbj|BAK15114.1| phosphoglycerate dehydrogenase [Solibacillus silvestris StLB046]
          Length = 541

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 39/97 (40%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           + +    R +K++    DV     ++ I N D  G +  V   L E  INIA   +GR Q
Sbjct: 445 LLNGLGARIVKVEGFVVDVIPNGNLLYIKNQDKPGSIGRVATKLAEKDINIATMQVGRDQ 504

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  +    L  ++    I  VK    
Sbjct: 505 IGGSAVMMLVVDNEVTTEDLIFVAQLENIDEVKAITL 541


>gi|167462040|ref|ZP_02327129.1| L-serine dehydratase beta subunit [Paenibacillus larvae subsp.
           larvae BRL-230010]
          Length = 220

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 45/93 (48%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++      +      I +V+ D  G +  V N+L ++ INI H  + R +  
Sbjct: 126 GGGKIEIIELNGFELKLSGEHPAILVVHNDRYGAIASVTNVLTKHYINIGHMEVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           ++A+  + +D ++ + ++E++S    I  V + 
Sbjct: 186 KNALMIIEMDQNLDDYIIEEISKLPNILQVTKI 218


>gi|296504631|ref|YP_003666331.1| L-serine dehydratase [Bacillus thuringiensis BMB171]
 gi|296325683|gb|ADH08611.1| L-serine dehydratase [Bacillus thuringiensis BMB171]
          Length = 220

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  + + V+E++     I  V   E
Sbjct: 187 RRALMVIETDELLADEVIEEIKAQQNICQVTIME 220


>gi|307705811|ref|ZP_07642654.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis SK597]
 gi|307620643|gb|EFN99736.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis SK597]
          Length = 223

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 44/94 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D    +  +EK+     +  V  F+
Sbjct: 190 EKAIMIIEVDSRNCDEAIEKIRKIPHLHNVNFFK 223


>gi|255029164|ref|ZP_05301115.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Listeria
           monocytogenes LO28]
          Length = 243

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 38/86 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 129 GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVT 88
           + A+  + +D  +  +++ K++    
Sbjct: 189 DEALMVIEVDQQVEQALISKIAELSG 214


>gi|196034904|ref|ZP_03102311.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus W]
 gi|228929189|ref|ZP_04092216.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229123662|ref|ZP_04252857.1| L-serine dehydratase, beta chain [Bacillus cereus 95/8201]
 gi|195992443|gb|EDX56404.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus W]
 gi|228659797|gb|EEL15442.1| L-serine dehydratase, beta chain [Bacillus cereus 95/8201]
 gi|228830479|gb|EEM76089.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 219

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 126 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  + + V+E++     I  V   E
Sbjct: 186 RRALMVIETDEILADEVIEEIKAQQNICQVTIME 219


>gi|227554207|ref|ZP_03984254.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis HH22]
 gi|227176654|gb|EEI57626.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis HH22]
 gi|315170480|gb|EFU14497.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1342]
 gi|315573760|gb|EFU85951.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0309B]
 gi|315580274|gb|EFU92465.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0309A]
          Length = 233

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 41/93 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G     +V+ D+ G++  V NIL    INI+   + R    
Sbjct: 140 GGGNIQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKG 199

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E AI  + +D + +  ++ +L+    I  V  F
Sbjct: 200 EKAIMIIEVDQAEVGDIVMQLAEIPHIYSVNYF 232


>gi|306834575|ref|ZP_07467688.1| L-serine ammonia-lyase beta subunit [Streptococcus bovis ATCC
           700338]
 gi|304423377|gb|EFM26530.1| L-serine ammonia-lyase beta subunit [Streptococcus bovis ATCC
           700338]
          Length = 223

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 43/90 (47%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++   +  + +    + IV+ DI G++  V +IL E+ INIA  ++ R ++ 
Sbjct: 130 GGGNIEVTELNGFSVSLKMNTPTLIIVHQDIPGMIAKVTDILSEHNINIAQMNVTRERAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D    +  +E++     +  V
Sbjct: 190 EKAIMIIEVDSRDCHKAVEQIQQIPHLHNV 219


>gi|257784308|ref|YP_003179525.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit
           [Atopobium parvulum DSM 20469]
 gi|257472815|gb|ACV50934.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit
           [Atopobium parvulum DSM 20469]
          Length = 549

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 34/95 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ R   +      +      I + + D  G++  +  IL    IN+A     RS+  
Sbjct: 128 GGGRIRISGVNGARIHMSGDMPTIFVSHRDKPGVLAALTTILATQNINVATMRTFRSERG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A +   ID  I   VL+   +   + +  Q   
Sbjct: 188 GFAHTVFEIDEPIEQKVLDLFQLAPHVSYAAQVSI 222


>gi|225857971|ref|YP_002739481.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae 70585]
 gi|225721396|gb|ACO17250.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae 70585]
          Length = 223

 Score = 91.6 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 44/94 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D    +  +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFFK 223


>gi|23098973|ref|NP_692439.1| L-serine dehydratase beta subunit [Oceanobacillus iheyensis HTE831]
 gi|22777201|dbj|BAC13474.1| L-serine dehydratase beta subunit [Oceanobacillus iheyensis HTE831]
          Length = 220

 Score = 91.6 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 40/93 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      I I++ D  G +  V  IL ++ INI H  + R    
Sbjct: 126 GGGKVEITELNGFELRLSGNHPAILIMHNDRFGAIASVTKILAKHEINIGHMEVNRKDVG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A+  + +D +I + +L +L+    I  + + 
Sbjct: 186 KEALMVIEVDQNIEDEILNELNAADHIISISKI 218


>gi|329930404|ref|ZP_08283967.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Paenibacillus sp. HGF5]
 gi|328935055|gb|EGG31543.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Paenibacillus sp. HGF5]
          Length = 227

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 13/90 (14%), Positives = 39/90 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G    +++   +    +   ++ + + D  G+V  +  +L   G+NIA+  + R    
Sbjct: 126 GGGSVEMLRVNGFDVKFTMNYPVLLVFHDDTPGMVAHITRLLEAGGVNIAYMDVDRKGRG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A++ +  D ++   +++ +    ++  V
Sbjct: 186 GDAMTVVESDEAVPAELMKHIEGLPSVHRV 215


>gi|227519493|ref|ZP_03949542.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0104]
 gi|229544896|ref|ZP_04433621.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1322]
 gi|229549163|ref|ZP_04437888.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis ATCC 29200]
 gi|255971880|ref|ZP_05422466.1| L-serine deaminase [Enterococcus faecalis T1]
 gi|256616778|ref|ZP_05473624.1| L-serine deaminase [Enterococcus faecalis ATCC 4200]
 gi|256763346|ref|ZP_05503926.1| L-serine deaminase [Enterococcus faecalis T3]
 gi|256854020|ref|ZP_05559385.1| L-serine dehydratase [Enterococcus faecalis T8]
 gi|256957948|ref|ZP_05562119.1| L-serine deaminase [Enterococcus faecalis DS5]
 gi|256961032|ref|ZP_05565203.1| L-serine deaminase [Enterococcus faecalis Merz96]
 gi|256963826|ref|ZP_05567997.1| L-serine deaminase [Enterococcus faecalis HIP11704]
 gi|257079886|ref|ZP_05574247.1| L-serine deaminase [Enterococcus faecalis JH1]
 gi|257081715|ref|ZP_05576076.1| L-serine deaminase [Enterococcus faecalis E1Sol]
 gi|257084312|ref|ZP_05578673.1| L-serine deaminase [Enterococcus faecalis Fly1]
 gi|257087689|ref|ZP_05582050.1| L-serine deaminase [Enterococcus faecalis D6]
 gi|257090907|ref|ZP_05585268.1| L-serine deaminase [Enterococcus faecalis CH188]
 gi|257416891|ref|ZP_05593885.1| L-serine deaminase [Enterococcus faecalis AR01/DG]
 gi|257420113|ref|ZP_05597107.1| L-serine deaminase [Enterococcus faecalis T11]
 gi|257421666|ref|ZP_05598656.1| L-serine dehydratase [Enterococcus faecalis X98]
 gi|293384578|ref|ZP_06630444.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis R712]
 gi|293386807|ref|ZP_06631378.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis S613]
 gi|300860470|ref|ZP_07106557.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TUSoD Ef11]
 gi|307269249|ref|ZP_07550603.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX4248]
 gi|307271773|ref|ZP_07553044.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0855]
 gi|307276958|ref|ZP_07558068.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX2134]
 gi|307288659|ref|ZP_07568640.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0109]
 gi|307290274|ref|ZP_07570190.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0411]
 gi|312900082|ref|ZP_07759399.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0470]
 gi|312902546|ref|ZP_07761752.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0635]
 gi|312906404|ref|ZP_07765412.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis DAPTO 512]
 gi|312951895|ref|ZP_07770783.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0102]
 gi|312979437|ref|ZP_07791125.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis DAPTO 516]
 gi|227073105|gb|EEI11068.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0104]
 gi|229305717|gb|EEN71713.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis ATCC 29200]
 gi|229309997|gb|EEN75984.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1322]
 gi|255962898|gb|EET95374.1| L-serine deaminase [Enterococcus faecalis T1]
 gi|256596305|gb|EEU15481.1| L-serine deaminase [Enterococcus faecalis ATCC 4200]
 gi|256684597|gb|EEU24292.1| L-serine deaminase [Enterococcus faecalis T3]
 gi|256710963|gb|EEU26006.1| L-serine dehydratase [Enterococcus faecalis T8]
 gi|256948444|gb|EEU65076.1| L-serine deaminase [Enterococcus faecalis DS5]
 gi|256951528|gb|EEU68160.1| L-serine deaminase [Enterococcus faecalis Merz96]
 gi|256954322|gb|EEU70954.1| L-serine deaminase [Enterococcus faecalis HIP11704]
 gi|256987916|gb|EEU75218.1| L-serine deaminase [Enterococcus faecalis JH1]
 gi|256989745|gb|EEU77047.1| L-serine deaminase [Enterococcus faecalis E1Sol]
 gi|256992342|gb|EEU79644.1| L-serine deaminase [Enterococcus faecalis Fly1]
 gi|256995719|gb|EEU83021.1| L-serine deaminase [Enterococcus faecalis D6]
 gi|256999719|gb|EEU86239.1| L-serine deaminase [Enterococcus faecalis CH188]
 gi|257158719|gb|EEU88679.1| L-serine deaminase [Enterococcus faecalis ARO1/DG]
 gi|257161941|gb|EEU91901.1| L-serine deaminase [Enterococcus faecalis T11]
 gi|257163490|gb|EEU93450.1| L-serine dehydratase [Enterococcus faecalis X98]
 gi|291078124|gb|EFE15488.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis R712]
 gi|291083810|gb|EFE20773.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis S613]
 gi|300849509|gb|EFK77259.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TUSoD Ef11]
 gi|306498695|gb|EFM68196.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0411]
 gi|306500413|gb|EFM69749.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0109]
 gi|306506381|gb|EFM75541.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX2134]
 gi|306511651|gb|EFM80650.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0855]
 gi|306514468|gb|EFM83029.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX4248]
 gi|310627558|gb|EFQ10841.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis DAPTO 512]
 gi|310630084|gb|EFQ13367.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0102]
 gi|310634216|gb|EFQ17499.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0635]
 gi|311287808|gb|EFQ66364.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis DAPTO 516]
 gi|311292839|gb|EFQ71395.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0470]
 gi|315025512|gb|EFT37444.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX2137]
 gi|315030458|gb|EFT42390.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX4000]
 gi|315032570|gb|EFT44502.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0017]
 gi|315035093|gb|EFT47025.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0027]
 gi|315143888|gb|EFT87904.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX2141]
 gi|315148683|gb|EFT92699.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX4244]
 gi|315154315|gb|EFT98331.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0031]
 gi|315155584|gb|EFT99600.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0043]
 gi|315159592|gb|EFU03609.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0312]
 gi|315165290|gb|EFU09307.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1302]
 gi|315168703|gb|EFU12720.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1341]
 gi|315579645|gb|EFU91836.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0630]
 gi|327535938|gb|AEA94772.1| L-serine dehydratase [Enterococcus faecalis OG1RF]
 gi|329578038|gb|EGG59452.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1467]
          Length = 233

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 41/93 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G     +V+ D+ G++  V NIL    INI+   + R    
Sbjct: 140 GGGNIQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKG 199

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E AI  + +D + +  ++ +L+    I  V  F
Sbjct: 200 EKAIMIIEVDQAEVGDIVMQLAEIPHIYSVNYF 232


>gi|168335116|ref|ZP_02693224.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Epulopiscium sp. 'N.t. morphotype B']
          Length = 212

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 37/88 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  + + I  I+ +       I I   D+ G+V  + N L    INIA   L R +  
Sbjct: 125 GGGNIKIVNINGIDIEFSGEYYTILIKQKDVKGVVAHITNCLSGCDINIAFMRLYREEKG 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIR 90
           E A + +  D  I + V+  +  N +I 
Sbjct: 185 EMAYTIIEADNPIDDDVIRFVKKNKSIL 212


>gi|255974875|ref|ZP_05425461.1| L-serine deaminase [Enterococcus faecalis T2]
 gi|307278731|ref|ZP_07559798.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0860]
 gi|255967747|gb|EET98369.1| L-serine deaminase [Enterococcus faecalis T2]
 gi|306504592|gb|EFM73795.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0860]
          Length = 233

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 41/93 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G     +V+ D+ G++  V NIL    INI+   + R    
Sbjct: 140 GGGNIQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKG 199

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E AI  + +D + +  ++ +L+    I  V  F
Sbjct: 200 EKAIMIIEVDQAEVGDIVMQLAEIPHIYSVNYF 232


>gi|15900049|ref|NP_344653.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae TIGR4]
 gi|15902139|ref|NP_357689.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae R6]
 gi|111656936|ref|ZP_01407755.1| hypothetical protein SpneT_02001824 [Streptococcus pneumoniae
           TIGR4]
 gi|116516124|ref|YP_815593.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae D39]
 gi|148985451|ref|ZP_01818656.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP3-BS71]
 gi|148987836|ref|ZP_01819299.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP6-BS73]
 gi|148994301|ref|ZP_01823565.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP9-BS68]
 gi|148996513|ref|ZP_01824231.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP11-BS70]
 gi|149001808|ref|ZP_01826781.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP14-BS69]
 gi|149007919|ref|ZP_01831497.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP18-BS74]
 gi|149010968|ref|ZP_01832273.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP19-BS75]
 gi|149017779|ref|ZP_01834238.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP23-BS72]
 gi|168483590|ref|ZP_02708542.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC1873-00]
 gi|168489423|ref|ZP_02713622.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP195]
 gi|168492418|ref|ZP_02716561.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC0288-04]
 gi|168493808|ref|ZP_02717951.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC3059-06]
 gi|168577059|ref|ZP_02722888.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae MLV-016]
 gi|182683072|ref|YP_001834819.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CGSP14]
 gi|194397086|ref|YP_002036818.1| L-serine dehydratase subunit alpha [Streptococcus pneumoniae G54]
 gi|221231041|ref|YP_002510193.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           ATCC 700669]
 gi|225853731|ref|YP_002735243.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae JJA]
 gi|225855886|ref|YP_002737397.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae P1031]
 gi|225860141|ref|YP_002741650.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae Taiwan19F-14]
 gi|237650917|ref|ZP_04525169.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CCRI 1974]
 gi|237821344|ref|ZP_04597189.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CCRI 1974M2]
 gi|298229649|ref|ZP_06963330.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae str. Canada MDR_19F]
 gi|298254962|ref|ZP_06978548.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae str. Canada MDR_19A]
 gi|298501897|ref|YP_003723837.1| L-serine ammonia-lyase [Streptococcus pneumoniae TCH8431/19A]
 gi|303254802|ref|ZP_07340902.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           BS455]
 gi|303259148|ref|ZP_07345126.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP-BS293]
 gi|303260905|ref|ZP_07346854.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP14-BS292]
 gi|303263232|ref|ZP_07349155.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae BS397]
 gi|303267675|ref|ZP_07353505.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae BS457]
 gi|303270023|ref|ZP_07355749.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae BS458]
 gi|307066778|ref|YP_003875744.1| L-serine deaminase [Streptococcus pneumoniae AP200]
 gi|307126328|ref|YP_003878359.1| L-serine dehydratase, iron-sulfur-dependent subunit beta
           [Streptococcus pneumoniae 670-6B]
 gi|307707808|ref|ZP_07644285.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis NCTC 12261]
 gi|307710252|ref|ZP_07646695.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis SK564]
 gi|14971573|gb|AAK74293.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae TIGR4]
 gi|15457631|gb|AAK98899.1| L-serine dehydratase beta subunit [Streptococcus pneumoniae R6]
 gi|116076700|gb|ABJ54420.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae D39]
 gi|147757088|gb|EDK64127.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP11-BS70]
 gi|147760266|gb|EDK67255.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP14-BS69]
 gi|147760542|gb|EDK67517.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP18-BS74]
 gi|147764604|gb|EDK71534.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP19-BS75]
 gi|147922409|gb|EDK73529.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP3-BS71]
 gi|147926300|gb|EDK77373.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP6-BS73]
 gi|147927331|gb|EDK78363.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP9-BS68]
 gi|147931343|gb|EDK82321.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP23-BS72]
 gi|172042964|gb|EDT51010.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC1873-00]
 gi|182628406|gb|ACB89354.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CGSP14]
 gi|183572127|gb|EDT92655.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP195]
 gi|183573438|gb|EDT93966.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC0288-04]
 gi|183576188|gb|EDT96716.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC3059-06]
 gi|183577289|gb|EDT97817.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae MLV-016]
 gi|194356753|gb|ACF55201.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae G54]
 gi|220673501|emb|CAR67976.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           ATCC 700669]
 gi|225722246|gb|ACO18099.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae JJA]
 gi|225724697|gb|ACO20549.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae P1031]
 gi|225727062|gb|ACO22913.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae Taiwan19F-14]
 gi|298237492|gb|ADI68623.1| L-serine ammonia-lyase [Streptococcus pneumoniae TCH8431/19A]
 gi|301793403|emb|CBW35769.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           INV104]
 gi|301799272|emb|CBW31795.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           OXC141]
 gi|301801063|emb|CBW33730.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           INV200]
 gi|302598239|gb|EFL65285.1| putative L-serine dehydratase, beta chain [Streptococcus pneumoniae
           BS455]
 gi|302637742|gb|EFL68228.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP14-BS292]
 gi|302639566|gb|EFL70023.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae SP-BS293]
 gi|302640444|gb|EFL70865.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae BS458]
 gi|302642791|gb|EFL73108.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae BS457]
 gi|302647005|gb|EFL77229.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae BS397]
 gi|306408315|gb|ADM83742.1| L-serine deaminase [Streptococcus pneumoniae AP200]
 gi|306483390|gb|ADM90259.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae 670-6B]
 gi|307616068|gb|EFN95264.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis NCTC 12261]
 gi|307619014|gb|EFN98147.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis SK564]
 gi|327390514|gb|EGE88854.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae GA04375]
 gi|332075775|gb|EGI86242.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae GA17570]
 gi|332076564|gb|EGI87026.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae GA17545]
 gi|332077409|gb|EGI87870.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae GA41301]
          Length = 223

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 44/94 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D    +  +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFFK 223


>gi|315151757|gb|EFT95773.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0012]
          Length = 233

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 41/93 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G     +V+ D+ G++  V NIL    INI+   + R    
Sbjct: 140 GGGNIQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKG 199

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E AI  + +D + +  ++ +L+    I  V  F
Sbjct: 200 EKAIMIIEVDQAEVGDIVMQLAEIPHIYSVNYF 232


>gi|209560264|ref|YP_002286736.1| L-serine dehydratase, beta subunit [Streptococcus pyogenes NZ131]
 gi|209541465|gb|ACI62041.1| L-serine dehydratase, beta subunit [Streptococcus pyogenes NZ131]
          Length = 223

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 36/87 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I  V+ DI G++  V +IL    INIA  ++ R  + 
Sbjct: 130 GGGNIQITELNGFSVSLSMNTPTIVTVHKDIPGMIAKVTDILSSNNINIATMNVTRESAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTI 89
           E A   + +D         +++    I
Sbjct: 190 EKATMIIEVDSRECQEAANQIAKIPHI 216


>gi|307711111|ref|ZP_07647533.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis SK321]
 gi|307617073|gb|EFN96251.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus mitis SK321]
          Length = 223

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 44/94 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D    +  +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFFK 223


>gi|169834395|ref|YP_001693626.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae Hungary19A-6]
 gi|168996897|gb|ACA37509.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae Hungary19A-6]
          Length = 223

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 44/94 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D    +  +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFFK 223


>gi|323342650|ref|ZP_08082882.1| L-serine ammonia-lyase beta subunit [Erysipelothrix rhusiopathiae
           ATCC 19414]
 gi|322463762|gb|EFY08956.1| L-serine ammonia-lyase beta subunit [Erysipelothrix rhusiopathiae
           ATCC 19414]
          Length = 223

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 38/93 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  +I     ++D G   I I + D  G++  V  IL E  INI    + R +  
Sbjct: 129 GGGNVKITEINGTKVEIDGGVATILIFHEDCPGMIAKVATILSEMHINIGSMKVDREEKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A   + +D   L + L++L     I  V   
Sbjct: 189 KKAYMVIELDQDDLETSLDRLRCVENIYEVLYI 221


>gi|293364418|ref|ZP_06611144.1| L-serine ammonia-lyase beta subunit [Streptococcus oralis ATCC
           35037]
 gi|307702617|ref|ZP_07639569.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus oralis ATCC 35037]
 gi|322375122|ref|ZP_08049636.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus sp. C300]
 gi|291317264|gb|EFE57691.1| L-serine ammonia-lyase beta subunit [Streptococcus oralis ATCC
           35037]
 gi|307623733|gb|EFO02718.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus oralis ATCC 35037]
 gi|321280622|gb|EFX57661.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus sp. C300]
          Length = 223

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ D+ G++  V   L  + INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDVPGMIAHVTEALSRFDINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEEAIEEIRKIPHLHNVNFFK 223


>gi|313889530|ref|ZP_07823176.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pseudoporcinus SPIN 20026]
 gi|313122142|gb|EFR45235.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pseudoporcinus SPIN 20026]
          Length = 223

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 42/90 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    + IV+ DI G++  V +IL EY INIA  ++ R  + 
Sbjct: 130 GGGNIQVTELNGFSVSLTMNTPTLIIVHQDIPGMIAKVTDILSEYEINIAQMNVTRESAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D       + K++    +  V
Sbjct: 190 EKAIMIIEVDTHDCQDAVNKIATIPHLHNV 219


>gi|291301774|ref|YP_003513052.1| D-3-phosphoglycerate dehydrogenase [Stackebrandtia nassauensis DSM
           44728]
 gi|290570994|gb|ADD43959.1| D-3-phosphoglycerate dehydrogenase [Stackebrandtia nassauensis DSM
           44728]
          Length = 533

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 37/90 (41%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           +  +I   + ++D    ++ +   D  GIV  +G  LG+  INI    + R ++   A+ 
Sbjct: 442 KLTEIDGYDVEIDAEGPLLIMRYTDRPGIVGLIGGSLGDESINIGAMQVSRREAGGEALM 501

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            +  D  +   +L KL+  V          
Sbjct: 502 IVATDAEVPADLLTKLAGTVGATSASAVTL 531


>gi|211906486|gb|ACJ11736.1| phosphoglycerate dehydrogenase [Gossypium hirsutum]
          Length = 602

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N++   +GR    +
Sbjct: 509 DGIPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGTVGSILGEENVNVSFMSVGRVAPRK 568

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
           HA+  + +D       L+++     I
Sbjct: 569 HAVMAIGVDEQPSKETLKRIGEVPAI 594


>gi|70726201|ref|YP_253115.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus haemolyticus
           JCSC1435]
 gi|68446925|dbj|BAE04509.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus haemolyticus
           JCSC1435]
          Length = 532

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 39/92 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V +    R ++I + + D       +   + D  G+V   G +LG + INIA   LGR+ 
Sbjct: 433 VIAGFGARIVRINDYSVDFKPNAYQLVSYHGDKPGMVGLTGQLLGRHNINIASMSLGRNI 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  +   ++ +L        +
Sbjct: 493 QGGQAMMVLSIDQPVTEDIINELYDVGGFDKI 524


>gi|300856490|ref|YP_003781474.1| L-serine dehydratase subunit beta [Clostridium ljungdahlii DSM
           13528]
 gi|300436605|gb|ADK16372.1| L-serine dehydratase, beta chain [Clostridium ljungdahlii DSM
           13528]
          Length = 227

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 37/95 (38%), Gaps = 1/95 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ-S 61
             G     ++     +       I I + D+ G+V  V +IL ++ INIA   + R    
Sbjct: 127 GGGNVVISEVDGDKIEFTGSYPTILINHMDVPGMVAKVSDILYKHKINIAFMRVYRKSTR 186

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              A     +D  I   V+ +++    I+ ++   
Sbjct: 187 GSGATMVFEVDDLISEDVVNEINEISNIKKIRAIN 221


>gi|289168806|ref|YP_003447075.1| L-serine dehydratase, beta subunit [Streptococcus mitis B6]
 gi|288908373|emb|CBJ23215.1| L-serine dehydratase, beta subunit [Streptococcus mitis B6]
          Length = 223

 Score = 91.3 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 44/94 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D    +  ++++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRNCDEAIDEIRKIPHLHNVNFFK 223


>gi|315612248|ref|ZP_07887162.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis ATCC
           49296]
 gi|315315641|gb|EFU63679.1| L-serine ammonia-lyase beta subunit [Streptococcus sanguinis ATCC
           49296]
          Length = 223

 Score = 91.3 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ D+ G++  V   L  + INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDVPGMIAHVTEALSRFDINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEEAIEEIRKIPHLHNVNFFK 223


>gi|297583998|ref|YP_003699778.1| L-serine dehydratase subunit beta [Bacillus selenitireducens MLS10]
 gi|297142455|gb|ADH99212.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           selenitireducens MLS10]
          Length = 220

 Score = 91.3 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 36/94 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      I +V+ D  G +  V   L +  INI H  + R +  
Sbjct: 126 GGGKVEIKELNGFKLRLSGNHPAILVVHNDRYGTIASVATKLADKKINIGHMEVSRKEEG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+  + +D ++ +  L  L     I  V +  
Sbjct: 186 KEALMVIEVDENVEDDTLRSLETLDNITKVTKIH 219


>gi|313680095|ref|YP_004057834.1| l-serine ammonia-lyase [Oceanithermus profundus DSM 14977]
 gi|313152810|gb|ADR36661.1| L-serine ammonia-lyase [Oceanithermus profundus DSM 14977]
          Length = 215

 Score = 91.3 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 38/93 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  R  K+  ++  +      + + + D  G++  V  +L +  INIA    GR +  
Sbjct: 118 GGGSVRIWKVDGLDAYLSGEGPALLVRHVDTPGVIARVARVLADDEINIARIVSGRDRKG 177

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  L  D  + +  L  L+    + +VK  
Sbjct: 178 GEALMSLETDHPLSDVALAYLAHLSYVHWVKAL 210


>gi|172057923|ref|YP_001814383.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Exiguobacterium sibiricum 255-15]
 gi|171990444|gb|ACB61366.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Exiguobacterium sibiricum 255-15]
          Length = 220

 Score = 91.3 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 41/89 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++  +   +  G   + +++ D  G +  V +IL +Y INI H  + R +  
Sbjct: 126 GGGTIEITELNGVPLKLSGGGPALIVLHHDRFGAIAAVTSILADYEINIGHMEVSRHEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRF 91
           + A+  + ID  +  +VLE+++    +  
Sbjct: 186 KQALMAIEIDDRMPTAVLEEINRLPQVER 214


>gi|315174944|gb|EFU18961.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX1346]
          Length = 233

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 41/93 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G     +V+ D+ G++  V NIL    INI+   + R    
Sbjct: 140 GGGNIQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKG 199

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E AI  + +D + +  ++ +L+    I  V  F
Sbjct: 200 EKAIMIIEVDQAEVGDIVMQLAEIPHIYSVNYF 232


>gi|168487053|ref|ZP_02711561.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC1087-00]
 gi|183570010|gb|EDT90538.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus pneumoniae CDC1087-00]
          Length = 223

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 44/94 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ DI G++  V   L  YGINIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D    +  +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFFK 223


>gi|309799033|ref|ZP_07693286.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus infantis SK1302]
 gi|308117268|gb|EFO54691.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus infantis SK1302]
          Length = 223

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ D+ G++  V   L  + INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDVPGMIAHVTEALSRFNINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRNCEESIEEIRKIPHLHNVNFFQ 223


>gi|229541128|ref|ZP_04430188.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           coagulans 36D1]
 gi|229325548|gb|EEN91223.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           coagulans 36D1]
          Length = 220

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 42/90 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      + +V+ D  G +  V NIL  + INI H  + R ++ 
Sbjct: 126 GGGKIEVTELNGFELHLSGHHPAVLVVHQDRYGAIAAVSNILSAHEINIGHMEVSRKEAG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D ++ ++V+E++     I  V
Sbjct: 186 KMALMAIEVDQNLDDAVIEEMKRLPNITQV 215


>gi|116754525|ref|YP_843643.1| D-3-phosphoglycerate dehydrogenase [Methanosaeta thermophila PT]
 gi|116665976|gb|ABK15003.1| D-3-phosphoglycerate dehydrogenase [Methanosaeta thermophila PT]
          Length = 523

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 18/97 (18%), Positives = 43/97 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V+     R ++I +    V     ++ +++ D   I+  V  +LGE  INI   H+GR  
Sbjct: 427 VYRPDDRRIVQINDYRVHVPTEGNLVLVLHEDRPNIIGPVCVVLGEANINIGSMHVGRIS 486

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           + +  +  L +D  + +  ++++     +   ++   
Sbjct: 487 AGKPQLMVLNVDTPLDDETMKRILSVSGVLSARRISM 523


>gi|331267214|ref|YP_004326844.1| L-serine dehydratase, iron-sulfur-dependent,beta subunit
           [Streptococcus oralis Uo5]
 gi|326683886|emb|CBZ01504.1| L-serine dehydratase, iron-sulfur-dependent,beta subunit
           [Streptococcus oralis Uo5]
          Length = 223

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ D+ G++  V   L  + INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDVPGMIAHVTEALSRFDINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       ++++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEEAIKEIRKIPHLHNVNFFK 223


>gi|320105785|ref|YP_004181375.1| D-3-phosphoglycerate dehydrogenase [Terriglobus saanensis SP1PR4]
 gi|319924306|gb|ADV81381.1| D-3-phosphoglycerate dehydrogenase [Terriglobus saanensis SP1PR4]
          Length = 537

 Score = 90.9 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 8/105 (7%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V     PR +    I+ +  +   ++ I N D+ G++  +G ILGE  +N+A+F LGR+ 
Sbjct: 428 VLHGNSPRLLSYDGIDIEAPLTGTLLSIRNQDVPGVIGRIGTILGEQKVNVANFALGRNV 487

Query: 61  ST-----EHAISFLCIDGSI---LNSVLEKLSVNVTIRFVKQFEF 97
            +       A++ + ID        SVLE L     I  V+  E 
Sbjct: 488 RSQRVPQGQALAVVQIDLPAAAKAQSVLEALRKVEAIVSVRLVEL 532


>gi|228987333|ref|ZP_04147453.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229157724|ref|ZP_04285799.1| L-serine dehydratase, beta chain [Bacillus cereus ATCC 4342]
 gi|228625681|gb|EEK82433.1| L-serine dehydratase, beta chain [Bacillus cereus ATCC 4342]
 gi|228772305|gb|EEM20751.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 220

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  + + V+E++     I  V   E
Sbjct: 187 RRALMVIETDELLADKVIEEIKAQQNICQVTIME 220


>gi|55821319|ref|YP_139761.1| L-serine dehydratase subunit beta [Streptococcus thermophilus LMG
           18311]
 gi|55823231|ref|YP_141672.1| L-serine dehydratase subunit beta [Streptococcus thermophilus
           CNRZ1066]
 gi|55737304|gb|AAV60946.1| L-serine dehydratase beta subunit [Streptococcus thermophilus LMG
           18311]
 gi|55739216|gb|AAV62857.1| L-serine dehydratase beta subunit [Streptococcus thermophilus
           CNRZ1066]
          Length = 237

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++     ++ +    + IV+ D+ G+V  V +IL  YGINIA   + R  + 
Sbjct: 144 GGGNIQVTELNGFAVNLKMNTPTLIIVHQDVPGMVALVTDILSRYGINIAQMTVTRENAG 203

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D    +  +  ++    +  V  F 
Sbjct: 204 EKAIMIIEVDSHQCDEAVADIARIPNLHNVNFFS 237


>gi|47568200|ref|ZP_00238904.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus G9241]
 gi|47555190|gb|EAL13537.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus G9241]
          Length = 219

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 126 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  + + V+E++     I  V   E
Sbjct: 186 RRALMVIETDELLADKVIEEIKAQQNICQVTIME 219


>gi|29377199|ref|NP_816353.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis V583]
 gi|29344665|gb|AAO82423.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis V583]
          Length = 222

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 41/93 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G     +V+ D+ G++  V NIL    INI+   + R    
Sbjct: 129 GGGNIQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E AI  + +D + +  ++ +L+    I  V  F
Sbjct: 189 EKAIMIIEVDQAEVGDIVMQLAEIPHIYSVNYF 221


>gi|229918592|ref|YP_002887238.1| L-serine dehydratase, iron-sulfur-dependent, subunit beta
           [Exiguobacterium sp. AT1b]
 gi|229470021|gb|ACQ71793.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Exiguobacterium sp. AT1b]
          Length = 220

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 36/90 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++      +  G   + +++ D  G +  V  +L  + +NI H  + R +  
Sbjct: 126 GGGTIEITELNGFPLKLTGGGPALVVLHHDRFGAIAAVTGVLANHQLNIGHMEVSRHEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  + ID +I   V+ +L     I  +
Sbjct: 186 MQALMAIEIDETIPAEVIAELERLPQIERI 215


>gi|171778580|ref|ZP_02919707.1| hypothetical protein STRINF_00559 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282803|gb|EDT48227.1| hypothetical protein STRINF_00559 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 223

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 43/90 (47%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++   +  + +    + IV+ DI G++  V +IL E+ INIA  ++ R ++ 
Sbjct: 130 GGGNIEVTELNGFSVSLKMNTPTLIIVHQDIPGMIAKVTDILSEHNINIAQMNVTRERAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D    +  +E++     +  V
Sbjct: 190 EKAIMIIEVDSRDCHKAVEQIQHIPHLHNV 219


>gi|295113664|emb|CBL32301.1| L-serine ammonia-lyase [Enterococcus sp. 7L76]
 gi|323481644|gb|ADX81083.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis 62]
          Length = 222

 Score = 90.9 bits (225), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 41/93 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G     +V+ D+ G++  V NIL    INI+   + R    
Sbjct: 129 GGGNIQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E AI  + +D + +  ++ +L+    I  V  F
Sbjct: 189 EKAIMIIEVDQAEVGDIVMQLAEIPHIYSVNYF 221


>gi|326791739|ref|YP_004309560.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium lentocellum DSM 5427]
 gi|326542503|gb|ADZ84362.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium lentocellum DSM 5427]
          Length = 226

 Score = 90.5 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 34/94 (36%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I      +      +   + DI G V  + ++  E  INIA   L RSQ  
Sbjct: 127 GGGLVEIHEINGNKVQITGEYPTVITCHNDIPGTVAKISSLFYEKQINIAFMKLVRSQKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A     +D SI   ++ ++     I  V    
Sbjct: 187 KGATMTFEVDHSIPEDIISEIKNVDGINRVIVIN 220


>gi|327441099|dbj|BAK17464.1| L-serine deaminase [Solibacillus silvestris StLB046]
          Length = 220

 Score = 90.5 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 40/94 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +  G   I +V+ D  G +  V N L  + +NI H  + R +  
Sbjct: 126 GGGKIEISEVNGFKLRLTGGMPAILVVHDDRAGCIANVANCLAMHDVNIGHMEVSRIERG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  + +D +I   +LE++S    I  V +  
Sbjct: 186 LTALMVIEVDQNIDKRLLEQISYIPHITKVSKIN 219


>gi|306828715|ref|ZP_07461907.1| L-serine ammonia-lyase beta subunit [Streptococcus mitis ATCC 6249]
 gi|304428893|gb|EFM31981.1| L-serine ammonia-lyase beta subunit [Streptococcus mitis ATCC 6249]
          Length = 223

 Score = 90.5 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ DI G++  V   L  + INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIAHVTEALSRFDINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEEAIEEIRKIPHLHNVNFFK 223


>gi|302546895|ref|ZP_07299237.1| phosphoglycerate dehydrogenase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302464513|gb|EFL27606.1| phosphoglycerate dehydrogenase [Streptomyces himastatinicus ATCC
           53653]
          Length = 529

 Score = 90.5 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 43/93 (46%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
              + + + +   D+ +   +I +   D  G+V  VG++LGE G+NIA   + RS     
Sbjct: 436 NIQKIVSVGQHTIDLAVSDHLIFLRYKDRPGVVGTVGHVLGEAGLNIAGMQVSRSVPGGE 495

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            ++ L +D ++   VL +++      F +    
Sbjct: 496 TLAVLNVDSNVPADVLNEIAQETDATFARSVSL 528


>gi|270291918|ref|ZP_06198133.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus sp. M143]
 gi|270279446|gb|EFA25288.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus sp. M143]
          Length = 223

 Score = 90.5 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ DI G++  V   L  + INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIAHVTEALSRFDINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEEAIEEIRKIPHLHNVNFFK 223


>gi|306826074|ref|ZP_07459410.1| L-serine ammonia-lyase beta subunit [Streptococcus sp. oral taxon
           071 str. 73H25AP]
 gi|304431790|gb|EFM34770.1| L-serine ammonia-lyase beta subunit [Streptococcus sp. oral taxon
           071 str. 73H25AP]
          Length = 223

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ D+ G++  V   L  + INIA  ++ R +  
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDVPGMIAHVTEALSRFDINIAQMNVTREKVG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEEAIEEIRKIPHLHNVNFFK 223


>gi|225443272|ref|XP_002273552.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 624

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG PR   +   + DV +   +I     D  G++  VGNILGE  +N++   +GR+    
Sbjct: 531 DGIPRLTCVGSFSVDVSLEGNLILCRQVDQPGMIGRVGNILGECNVNVSFMSVGRTVKRT 590

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  + +D       L+K+     I
Sbjct: 591 RAIMAIGVDEEPDKDTLKKIGEVPAI 616


>gi|57234596|ref|YP_181341.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides ethenogenes
           195]
 gi|57225044|gb|AAW40101.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides ethenogenes
           195]
          Length = 526

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G    +++ +   D+   G   +   + D  G++   G I G+  INI++ HL R ++  
Sbjct: 433 GDVHIVRLNDYWIDIVPTGGYFLFADHIDRPGLIGAAGKITGDADINISYMHLSRQKARG 492

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D  +     ++L     ++ V+  + 
Sbjct: 493 QALMILALDEPLPEKQRQQLLSLPDVQTVQVVKI 526


>gi|218899301|ref|YP_002447712.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus G9842]
 gi|228902650|ref|ZP_04066801.1| L-serine dehydratase, beta chain [Bacillus thuringiensis IBL 4222]
 gi|228909972|ref|ZP_04073793.1| L-serine dehydratase, beta chain [Bacillus thuringiensis IBL 200]
 gi|228967179|ref|ZP_04128215.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|218545365|gb|ACK97759.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus G9842]
 gi|228792548|gb|EEM40114.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228849807|gb|EEM94640.1| L-serine dehydratase, beta chain [Bacillus thuringiensis IBL 200]
 gi|228857091|gb|EEN01600.1| L-serine dehydratase, beta chain [Bacillus thuringiensis IBL 4222]
          Length = 220

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 39/90 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL  + INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILATHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D  + + V+E++     I  V
Sbjct: 187 RRALMVIETDELLADEVIEEIKAQQNICQV 216


>gi|251778424|ref|ZP_04821344.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|243082739|gb|EES48629.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 228

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 13/94 (13%), Positives = 34/94 (36%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++     +       + +   D+ G++  V +IL +  IN+A   + R+   
Sbjct: 129 GGGNIQISEVNGNPVEFTGNYETLIVSQRDLPGVIHSVTSILSKENINVAFMKVFRNHKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A     +D  +    + ++     +  V    
Sbjct: 189 KDATMIFEMDNKVSEKAIREIEKLELVHRVISIS 222


>gi|228992883|ref|ZP_04152808.1| L-serine dehydratase, beta chain [Bacillus pseudomycoides DSM
           12442]
 gi|228998928|ref|ZP_04158512.1| L-serine dehydratase, beta chain [Bacillus mycoides Rock3-17]
 gi|229006459|ref|ZP_04164114.1| L-serine dehydratase, beta chain [Bacillus mycoides Rock1-4]
 gi|228754792|gb|EEM04182.1| L-serine dehydratase, beta chain [Bacillus mycoides Rock1-4]
 gi|228760844|gb|EEM09806.1| L-serine dehydratase, beta chain [Bacillus mycoides Rock3-17]
 gi|228766932|gb|EEM15570.1| L-serine dehydratase, beta chain [Bacillus pseudomycoides DSM
           12442]
          Length = 220

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIASVASILAKHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D  + + V+E++     I  V
Sbjct: 187 RRALMVIETDELLADEVIEEIKGQSNICQV 216


>gi|297559156|ref|YP_003678130.1| D-3-phosphoglycerate dehydrogenase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296843604|gb|ADH65624.1| D-3-phosphoglycerate dehydrogenase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 529

 Score = 90.5 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 43/91 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I     ++ +   M+ +   D  G+V  VG +LG+ G+NIA   + R Q    A+ 
Sbjct: 438 KLVEINNYTMEIGLAEHMVFLSYEDRPGVVGTVGALLGDAGVNIAGMQVIRDQEGGKALI 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D ++ +  L  +S  +     +Q +  
Sbjct: 498 ALTVDSAVPDETLASISAEIDADISRQVDLE 528


>gi|296131563|ref|YP_003638810.1| D-3-phosphoglycerate dehydrogenase [Thermincola sp. JR]
 gi|296030141|gb|ADG80909.1| D-3-phosphoglycerate dehydrogenase [Thermincola potens JR]
          Length = 523

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 47/97 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F +  PR I+I +   DV     ++ + + D   I+  V NI+GE  INIA   +GR +
Sbjct: 427 LFGEDDPRIIQIDQFRIDVVPEGNILFVPHIDKPKIIGPVANIIGENNINIAGMQVGRKE 486

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+  L +D  + + +L +++    +  V+    
Sbjct: 487 IGGKAVMMLAVDTPLPDVLLAEIAKVDGVEEVRMITL 523


>gi|226529328|ref|NP_001147079.1| LOC100280688 [Zea mays]
 gi|195607108|gb|ACG25384.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 624

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 39/93 (41%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P    +     DV +   +I     D  G++  VGNILG+  +NI    +GR+   + 
Sbjct: 532 GVPHLTLVGPYEVDVSLEGNLILCRQIDQPGMIGKVGNILGDTNVNINFMSVGRTFRGKQ 591

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI  + +D       LEK+   + I      E 
Sbjct: 592 AIMAIGVDEEPDKDTLEKIGAILAIEEFVFLEL 624


>gi|30264215|ref|NP_846592.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. Ames]
 gi|47529658|ref|YP_021007.1| l-serine dehydratase, iron-sulfur-dependent subunit beta [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|49187045|ref|YP_030297.1| L-serine dehydratase, iron-sulfur-dependent subunit beta [Bacillus
           anthracis str. Sterne]
 gi|65321531|ref|ZP_00394490.1| COG1760: L-serine deaminase [Bacillus anthracis str. A2012]
 gi|165871165|ref|ZP_02215815.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0488]
 gi|167633586|ref|ZP_02391910.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0442]
 gi|167639533|ref|ZP_02397804.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0193]
 gi|170687245|ref|ZP_02878463.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0465]
 gi|170705645|ref|ZP_02896108.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0389]
 gi|177652723|ref|ZP_02935139.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0174]
 gi|190565839|ref|ZP_03018758.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis Tsiankovskii-I]
 gi|227816918|ref|YP_002816927.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. CDC 684]
 gi|229600693|ref|YP_002868438.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0248]
 gi|254683905|ref|ZP_05147765.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. CNEVA-9066]
 gi|254736253|ref|ZP_05193959.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. Western North America USA6153]
 gi|254744142|ref|ZP_05201825.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. Kruger B]
 gi|254754076|ref|ZP_05206111.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. Vollum]
 gi|254758232|ref|ZP_05210259.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. Australia 94]
 gi|30258860|gb|AAP28078.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. Ames]
 gi|47504806|gb|AAT33482.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|49180972|gb|AAT56348.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. Sterne]
 gi|164713084|gb|EDR18611.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0488]
 gi|167512592|gb|EDR87967.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0193]
 gi|167530992|gb|EDR93679.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0442]
 gi|170129185|gb|EDS98049.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0389]
 gi|170668862|gb|EDT19607.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0465]
 gi|172082058|gb|EDT67126.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0174]
 gi|190562758|gb|EDV16724.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis Tsiankovskii-I]
 gi|227006591|gb|ACP16334.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. CDC 684]
 gi|229265101|gb|ACQ46738.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           anthracis str. A0248]
          Length = 219

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 40/94 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL +  INI+   + R +  
Sbjct: 126 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILAKQEINISTMSVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  + + V+E++     I  V   E
Sbjct: 186 RRALMVIETDEILADEVIEEIKAQQNICQVTIME 219


>gi|322378113|ref|ZP_08052599.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus sp. M334]
 gi|321280950|gb|EFX57964.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus sp. M334]
          Length = 223

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 43/94 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ DI G++  V   L  Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYDINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D    +  +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFFK 223


>gi|288906424|ref|YP_003431646.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus gallolyticus UCN34]
 gi|306832461|ref|ZP_07465613.1| L-serine ammonia-lyase beta subunit [Streptococcus gallolyticus
           subsp. gallolyticus TX20005]
 gi|325979486|ref|YP_004289202.1| L-serine dehydratase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|288733150|emb|CBI14731.1| putative L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus gallolyticus UCN34]
 gi|304425361|gb|EFM28481.1| L-serine ammonia-lyase beta subunit [Streptococcus gallolyticus
           subsp. gallolyticus TX20005]
 gi|325179414|emb|CBZ49458.1| L-serine dehydratase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 223

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 43/90 (47%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++   +  + +    + IV+ DI G++  V +IL E+ INIA  ++ R ++ 
Sbjct: 130 GGGNIEVTELNGFSVSLKMNTPTLIIVHQDIPGMIAKVTDILSEHHINIAQMNVTRERAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D    +  +E++     +  V
Sbjct: 190 EKAIMIIEVDSRDCHKAVEQIQQIPHLHNV 219


>gi|125561721|gb|EAZ07169.1| hypothetical protein OsI_29415 [Oryza sativa Indica Group]
          Length = 621

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 38/93 (40%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P    +     DV +   +I     D  G++  VGNILG+  +NI+   +GR+   + 
Sbjct: 529 GVPHLTVVGPYEVDVSLEGNLILCRQIDQPGMIGKVGNILGQTNVNISFMSVGRTFRGKQ 588

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI  + +D       LE +     I      E 
Sbjct: 589 AIMAIGVDEEPDKETLEHIGHIPAIEEFVFLEL 621


>gi|42408279|dbj|BAD09434.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica
           Group]
 gi|42409460|dbj|BAD09817.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica
           Group]
 gi|215769351|dbj|BAH01580.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 621

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 38/93 (40%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P    +     DV +   +I     D  G++  VGNILG+  +NI+   +GR+   + 
Sbjct: 529 GVPHLTVVGPYEVDVSLEGNLILCRQIDQPGMIGKVGNILGQTNVNISFMSVGRTFRGKQ 588

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI  + +D       LE +     I      E 
Sbjct: 589 AIMAIGVDEEPDKETLEHIGHIPAIEEFVFLEL 621


>gi|302837628|ref|XP_002950373.1| hypothetical protein VOLCADRAFT_60404 [Volvox carteri f.
           nagariensis]
 gi|300264378|gb|EFJ48574.1| hypothetical protein VOLCADRAFT_60404 [Volvox carteri f.
           nagariensis]
          Length = 539

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           + G+P   KI   + ++ +G  ++     D  GIV  VG +L +  +NI+   + R+   
Sbjct: 439 AGGQPFLTKIGNFDVELAMGGSVLLTRQRDQPGIVGGVGMLLAKDQVNISFMTVCRTAKH 498

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             AI  + ID       L  ++    +  V  F+
Sbjct: 499 REAIMAIGIDSEPSLETLAAITEVPGVMEVTVFK 532


>gi|188590655|ref|YP_001922237.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum E3 str. Alaska E43]
 gi|188500936|gb|ACD54072.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum E3 str. Alaska E43]
          Length = 228

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 13/94 (13%), Positives = 34/94 (36%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++     +       + +   D+ G++  V +IL +  IN+A   + R+   
Sbjct: 129 GGGNIQISEVNGNPVEFTGNYETLIVSQRDLPGVIHSVTSILSKENINVAFMKVFRNHKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A     +D  +    + ++     +  V    
Sbjct: 189 KDATMIFEMDNKVSEKAIREIEKLELVHRVISIS 222


>gi|319940181|ref|ZP_08014534.1| L-serine dehydratase [Streptococcus anginosus 1_2_62CV]
 gi|319810652|gb|EFW06982.1| L-serine dehydratase [Streptococcus anginosus 1_2_62CV]
          Length = 223

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEGAIEEIRKIPKLHNVNFFK 223


>gi|224476337|ref|YP_002633943.1| putative L-serine dehydratase subunit beta [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|222420944|emb|CAL27758.1| putative L-serine dehydratase, beta subunit [Staphylococcus
           carnosus subsp. carnosus TM300]
          Length = 221

 Score = 90.1 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 34/90 (37%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK     I +    V      + + + D  G +  V NIL    IN+    + R +  
Sbjct: 126 GGGKIEITAINDFPISVSGDYPALLVFHQDTFGTIARVTNILLNESINVGAMQVNRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+    +D     ++LE++     +  V
Sbjct: 186 DSALMMCELDEKPPITILEEMRQIDGVTDV 215


>gi|229117636|ref|ZP_04247007.1| L-serine dehydratase, beta chain [Bacillus cereus Rock1-3]
 gi|228665815|gb|EEL21286.1| L-serine dehydratase, beta chain [Bacillus cereus Rock1-3]
          Length = 220

 Score = 90.1 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLTGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D  + + V+E++     I  V
Sbjct: 187 RRALMVIETDELLADEVIEEIKGQQNICQV 216


>gi|255538186|ref|XP_002510158.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223550859|gb|EEF52345.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 598

 Score = 90.1 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 39/86 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +GKP    +     DV +   +I     D  G++  VG+ILGE  +N++   +GR    +
Sbjct: 505 EGKPHLTMVGSFGVDVSLEGSLILCRQIDQPGMIGKVGSILGEENVNVSFMTVGRIAPRK 564

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            A+  + +D       L+++     +
Sbjct: 565 QAVMTIGVDEEPNKEALKRIGEIPLV 590


>gi|322391186|ref|ZP_08064658.1| L-serine ammonia-lyase beta subunit [Streptococcus peroris ATCC
           700780]
 gi|321145939|gb|EFX41328.1| L-serine ammonia-lyase beta subunit [Streptococcus peroris ATCC
           700780]
          Length = 223

 Score = 90.1 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ D+ G++  V   L  + INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDVPGMIAHVTEALSRFDINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRNCEESIEEIRKIPHLHNVNFFK 223


>gi|225428898|ref|XP_002285358.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 595

 Score = 90.1 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N++   +GR    +
Sbjct: 502 DGIPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGSILGEENVNVSFMSVGRVAPRK 561

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
           HA+  + +D       L+K+     +
Sbjct: 562 HAVMAIGVDEQPSKVTLKKIGEIPAV 587


>gi|290968021|ref|ZP_06559570.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Megasphaera genomosp. type_1 str. 28L]
 gi|290781927|gb|EFD94506.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Megasphaera genomosp. type_1 str. 28L]
          Length = 219

 Score = 90.1 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 34/93 (36%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    +I      +      +  V+ D+ GI+     IL    IN+++  + RS   
Sbjct: 124 GGGKIEIREINGAQVSLRGEEHTLITVHRDLPGIIAQATTILAIGHINVSNMRVFRSGKN 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  +C D  +   ++  +     I  V   
Sbjct: 184 AAAVMIVCTDSPVPADMVAMIRKIEAIESVVTL 216


>gi|229031786|ref|ZP_04187775.1| L-serine dehydratase, beta chain [Bacillus cereus AH1271]
 gi|228729532|gb|EEL80520.1| L-serine dehydratase, beta chain [Bacillus cereus AH1271]
          Length = 220

 Score = 90.1 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLTGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  + + V+E+++    I  V   E
Sbjct: 187 RRALMVIETDELLADEVIEEINAQQNICQVTIME 220


>gi|116628041|ref|YP_820660.1| L-serine dehydratase beta subunit [Streptococcus thermophilus
           LMD-9]
 gi|116101318|gb|ABJ66464.1| L-serine ammonia-lyase [Streptococcus thermophilus LMD-9]
          Length = 223

 Score = 90.1 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++     ++ +    + IV+ D+ G+V  V +IL  YGINIA   + R  + 
Sbjct: 130 GGGNIQVTELNGFAVNLKMNTPTLIIVHQDVPGMVALVTDILSRYGINIAQMTVTRENAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D    +  +  ++    +  V  F 
Sbjct: 190 EKAIMIIEVDSHQCDEAVADIARIPNLHNVNFFS 223


>gi|257790707|ref|YP_003181313.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit
           [Eggerthella lenta DSM 2243]
 gi|257474604|gb|ACV54924.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit
           [Eggerthella lenta DSM 2243]
          Length = 536

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 36/93 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     KI +I+  +      I +   D  G++  +   + + G+NIA   + R +  
Sbjct: 128 GGGAAVIRKIDDIDVRITGESTSIVVRQRDETGVLAHIAQSISDEGVNIATTRMYRERKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A + L  D  +  +    +  +  I  V+  
Sbjct: 188 DIAYTVLETDQEVDGAAKAAIEDHPAILDVRVI 220


>gi|289432486|ref|YP_003462359.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. GT]
 gi|288946206|gb|ADC73903.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. GT]
          Length = 526

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G    +K+ +   D+   G   +   + D  G++   G I G+  INI++ HL R ++  
Sbjct: 433 GDVHIVKLNDYWIDIVPTGGYFLFADHIDRPGLIGSAGKITGDADINISYMHLSRQKARG 492

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D  +     ++L     ++ V+  + 
Sbjct: 493 QALMILALDEPLPEKQRQQLLSLPDVQMVQVVKI 526


>gi|322388419|ref|ZP_08062022.1| L-serine ammonia-lyase beta subunit [Streptococcus infantis ATCC
           700779]
 gi|321140732|gb|EFX36234.1| L-serine ammonia-lyase beta subunit [Streptococcus infantis ATCC
           700779]
          Length = 223

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ D+ G++  V   L  + INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAVSLNMNTPTIIIVHQDVPGMIAHVTEALSRFDINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRNCEESIEEIRKIPHLHNVNFFQ 223


>gi|239982472|ref|ZP_04704996.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
 gi|291454320|ref|ZP_06593710.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
 gi|291357269|gb|EFE84171.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
          Length = 533

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I E + D+ +   M+ +   D  G+V  VG +LGE G+NI    + R+     A++
Sbjct: 442 KIVAIGEHDVDLSLADHMVVLRYEDRPGVVGTVGRVLGESGVNIGGMQVSRATVGGEALA 501

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D ++  +VL +L+  +     +  + 
Sbjct: 502 VLTVDDTVSQAVLTELAEEIGASVARSVDL 531


>gi|289642877|ref|ZP_06475013.1| D-3-phosphoglycerate dehydrogenase [Frankia symbiont of Datisca
           glomerata]
 gi|289507354|gb|EFD28317.1| D-3-phosphoglycerate dehydrogenase [Frankia symbiont of Datisca
           glomerata]
          Length = 529

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 39/91 (42%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           +   I +   D+     +      D  G+V  VG +LGE  INIA   + R ++   A+ 
Sbjct: 437 KVTAIDDFEVDIRPQAHLAFFRYEDRPGVVGAVGALLGEAQINIAGAQVSRRKAGGEALM 496

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D ++   VL +++  +     +    +
Sbjct: 497 SLSLDDTVPVDVLTEIAKIIGASAARSVSLH 527


>gi|147669219|ref|YP_001214037.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. BAV1]
 gi|146270167|gb|ABQ17159.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. BAV1]
          Length = 526

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G    +K+ +   D+   G   +   + D  G++   G I G+  INI++ HL R ++  
Sbjct: 433 GDVHIVKLNDYWIDIVPTGGYFLFADHIDRPGLIGSAGKITGDADINISYMHLSRQKARG 492

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D  +     ++L     ++ V+  + 
Sbjct: 493 QALMILALDEPLPEKQRQQLLSLPDVQMVQVVKI 526


>gi|168028593|ref|XP_001766812.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682021|gb|EDQ68443.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 565

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 42/86 (48%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   ++   + DV +   +I     D  G++  VG+ILGE  +NI+   +GR    E
Sbjct: 472 DGVPYLSRVGSFSVDVSLEGSIILYRQVDQPGMIGKVGSILGEENVNISFMSVGRKSPRE 531

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
           HA+  + +D     + L+KL     +
Sbjct: 532 HAVMAIGVDEEPSKATLQKLGDIPAV 557


>gi|73748439|ref|YP_307678.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. CBDB1]
 gi|73660155|emb|CAI82762.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. CBDB1]
          Length = 526

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G    +K+ +   D+   G   +   + D  G++   G I G+  INI++ HL R ++  
Sbjct: 433 GDVHIVKLNDYWIDIVPTGGYFLFADHIDRPGLIGSAGKITGDADINISYMHLSRQKARG 492

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D  +     ++L     ++ V+  + 
Sbjct: 493 QALMILALDEPLPEKQRQQLLSLPDVQMVQVVKI 526


>gi|320547686|ref|ZP_08041971.1| L-serine dehydratase [Streptococcus equinus ATCC 9812]
 gi|320447761|gb|EFW88519.1| L-serine dehydratase [Streptococcus equinus ATCC 9812]
          Length = 223

 Score = 90.1 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 43/90 (47%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++   +  + +    + IV+ DI G++  V +IL E+ INIA  ++ R ++ 
Sbjct: 130 GGGNIEVTELNGFSVSLKMNTPTLIIVHQDIPGMIAKVTDILSEHNINIAQMNVTRERAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D    +  +E++     +  V
Sbjct: 190 EKAIMIIEVDSRDCHQAVEQIQHIPHLHNV 219


>gi|326790990|ref|YP_004308811.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium lentocellum DSM 5427]
 gi|326541754|gb|ADZ83613.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium lentocellum DSM 5427]
          Length = 222

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 39/95 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     K+  +    D     + I + D  G+V  +   L E+ INIA+    R    
Sbjct: 128 GGGAISIDKVNGMEVFFDGEYETLFINHEDRTGVVAHITQCLSEWQINIAYMRSYRQAKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           E A + +  D  I + VL  +  N ++++ K+   
Sbjct: 188 EVASTIIETDQPICDEVLAAIMENSSVQYAKKINL 222


>gi|314936177|ref|ZP_07843524.1| phosphoglycerate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
 gi|313654796|gb|EFS18541.1| phosphoglycerate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 531

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 40/92 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V      R ++I + + D           + D+ G+V   G +LG++ INIA   LGRS 
Sbjct: 433 VIDGFGARIVRINDYSVDFKPNTYQFISYHKDLPGMVGLTGQLLGKHDINIASMSLGRSS 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
               A+  L ID  I   V+++L        +
Sbjct: 493 EGGQAMMILSIDQPITQQVIKELYEIGDFDNI 524


>gi|317488582|ref|ZP_07947127.1| serine dehydratase subunit alpha [Eggerthella sp. 1_3_56FAA]
 gi|325831988|ref|ZP_08165085.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit
           [Eggerthella sp. HGA1]
 gi|316912324|gb|EFV33888.1| serine dehydratase subunit alpha [Eggerthella sp. 1_3_56FAA]
 gi|325486309|gb|EGC88761.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit
           [Eggerthella sp. HGA1]
          Length = 536

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 36/93 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     KI +I+  +      I +   D  G++  +   + + G+NIA   + R +  
Sbjct: 128 GGGAAVIRKIDDIDVRITGESTSIVVRQRDETGVLAHIAQSISDEGVNIATTRMYRERKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A + L  D  +  +    +  +  I  V+  
Sbjct: 188 DIAYTVLETDQEVDGAAKAAIEDHPAILDVRVI 220


>gi|15672812|ref|NP_266986.1| beta-subunit of L-serine dehydratase [Lactococcus lactis subsp.
           lactis Il1403]
 gi|12723754|gb|AAK04928.1|AE006316_9 beta-subunit of L-serine dehydratase [Lactococcus lactis subsp.
           lactis Il1403]
 gi|326406375|gb|ADZ63446.1| L-serine dehydratase subunit beta [Lactococcus lactis subsp. lactis
           CV56]
          Length = 223

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 44/94 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  +  G     +++ D+ G++  V ++L E+ INIA  ++ R    
Sbjct: 130 GGGMIQVTELNGFDIAISAGVPTFVVIHEDVPGMIARVSSVLSEHQINIAQMNVTREAKG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  L +D   +  V+E++ +   +  V  F 
Sbjct: 190 EKAIMILEVDTPNVKEVIEEMKLIPRLHAVNFFN 223


>gi|226226235|ref|YP_002760341.1| L-serine dehydratase beta chain [Gemmatimonas aurantiaca T-27]
 gi|226089426|dbj|BAH37871.1| L-serine dehydratase beta chain [Gemmatimonas aurantiaca T-27]
          Length = 222

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 16/90 (17%), Positives = 34/90 (37%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    +I     +V      I +V  D+ G +  +  +L +  +NIA   L R +  
Sbjct: 125 GAGRVLVTEIDGYPVEVPGNSDTIVLVAEDVKGSIARIAGLLADAQLNIATLKLTRKERG 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A   + +D      V + +     +++ 
Sbjct: 185 GDAFMVIEVDERPNEEVRDAIRALGWVKWA 214


>gi|313892402|ref|ZP_07825993.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Dialister microaerophilus UPII 345-E]
 gi|329121934|ref|ZP_08250547.1| L-serine ammonia-lyase beta subunit [Dialister micraerophilus DSM
           19965]
 gi|313119163|gb|EFR42364.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Dialister microaerophilus UPII 345-E]
 gi|327467380|gb|EGF12879.1| L-serine ammonia-lyase beta subunit [Dialister micraerophilus DSM
           19965]
          Length = 220

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 43/91 (47%), Gaps = 1/91 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+ +  +I  I+ ++      +   + D+ GIV  V   L  + INI++  + R +  
Sbjct: 124 GGGRIKITEIDGISVEITGEEYTLITNHYDVPGIVAAVSLRLANHNINISNMRVFRKKKG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSV-NVTIRFV 92
            +A+  +  D  +  S++++L   N  I+ V
Sbjct: 184 LNAVMIVHTDQEVPESMIKELVDCNKNIKRV 214


>gi|229086711|ref|ZP_04218878.1| L-serine dehydratase, beta chain [Bacillus cereus Rock3-44]
 gi|228696585|gb|EEL49403.1| L-serine dehydratase, beta chain [Bacillus cereus Rock3-44]
          Length = 219

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 126 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIASVASILAKHEINISTMSVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D  + N V+E++     I  V
Sbjct: 186 RKALMVIETDQLLANEVIEEIKGQSNICQV 215


>gi|229098610|ref|ZP_04229550.1| L-serine dehydratase, beta chain [Bacillus cereus Rock3-29]
 gi|229104745|ref|ZP_04235406.1| L-serine dehydratase, beta chain [Bacillus cereus Rock3-28]
 gi|228678618|gb|EEL32834.1| L-serine dehydratase, beta chain [Bacillus cereus Rock3-28]
 gi|228684689|gb|EEL38627.1| L-serine dehydratase, beta chain [Bacillus cereus Rock3-29]
          Length = 214

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 121 GGGKIEVVELNGFDLQLTGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 180

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D  + + V+E++     I  V
Sbjct: 181 RRALMVIETDELLADEVIEEIKGQQNICQV 210


>gi|229174817|ref|ZP_04302339.1| L-serine dehydratase, beta chain [Bacillus cereus MM3]
 gi|228608680|gb|EEK65980.1| L-serine dehydratase, beta chain [Bacillus cereus MM3]
          Length = 220

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLTGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  +  D  + + V+E+++    I  V   E
Sbjct: 187 RRALMVIETDELLADEVIEEINAQQNICQVTIME 220


>gi|94265987|ref|ZP_01289710.1| Amino acid-binding ACT [delta proteobacterium MLMS-1]
 gi|93453453|gb|EAT03869.1| Amino acid-binding ACT [delta proteobacterium MLMS-1]
          Length = 221

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 40/97 (41%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF   +PR +++     +      M+ +   D  G +  +G  +G+ G+NI+   +G+  
Sbjct: 124 VFGKKEPRLVRLNSFRLEALPQGPMLLVYINDTPGAIGNLGMTIGDAGVNISLMTVGKES 183

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            +   I  L  +  +   +L+K+     +      + 
Sbjct: 184 ESGQNIILLNTNTLVSRDLLKKVRGLEQVYDAMVLDM 220


>gi|229815478|ref|ZP_04445810.1| hypothetical protein COLINT_02526 [Collinsella intestinalis DSM
           13280]
 gi|229809011|gb|EEP44781.1| hypothetical protein COLINT_02526 [Collinsella intestinalis DSM
           13280]
          Length = 538

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/95 (18%), Positives = 36/95 (37%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R   I  ++ ++      + + + D  G +  +   L +  +NIA     R+++ 
Sbjct: 135 GGGKMRISAINGVHVEISGLYTTLFVAHRDAPGALASLTGALAQAQMNIAFCRTYRTEAG 194

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A S    DG+    VL  +     + +    E 
Sbjct: 195 GQAYSVFETDGAPQRDVLPIVRALDLVNYATFIEL 229


>gi|52080188|ref|YP_078979.1| L-serine dehydratase subunit beta [Bacillus licheniformis ATCC
           14580]
 gi|52785565|ref|YP_091394.1| SdaAB [Bacillus licheniformis ATCC 14580]
 gi|319646033|ref|ZP_08000263.1| SdaAB protein [Bacillus sp. BT1B_CT2]
 gi|52003399|gb|AAU23341.1| L-serine dehydratase (beta chain) [Bacillus licheniformis ATCC
           14580]
 gi|52348067|gb|AAU40701.1| SdaAB [Bacillus licheniformis ATCC 14580]
 gi|317391783|gb|EFV72580.1| SdaAB protein [Bacillus sp. BT1B_CT2]
          Length = 220

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 41/93 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++      +      I +V+ D  G +  V N+L ++ INI H  + R    
Sbjct: 126 GGGKIEIIELNGFELRLSGNHPAILVVHNDRYGTIAGVANVLAKFAINIGHMEVARKDVG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A+  + +D +I  +V ++L     I  V Q 
Sbjct: 186 QEALMTIEVDQTIDPAVFDELRALPNIIEVTQI 218


>gi|158320771|ref|YP_001513278.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Alkaliphilus oremlandii OhILAs]
 gi|158140970|gb|ABW19282.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Alkaliphilus oremlandii OhILAs]
          Length = 223

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 15/96 (15%), Positives = 31/96 (32%), Gaps = 1/96 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  +          + + + D  G++  V  +L  Y INIA   + R    
Sbjct: 127 GGGNIVINEINGLEIKFTGEYDTLIVSHTDKPGVIAKVTAVLALYDINIAFMRVYRYTKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSV-NVTIRFVKQFEF 97
           ++A   +  D  I   ++  +      +        
Sbjct: 187 QNAFMIIETDNEIAPEIVTYIKKTIPEVPQAYLVNI 222


>gi|229075846|ref|ZP_04208822.1| L-serine dehydratase, beta chain [Bacillus cereus Rock4-18]
 gi|228707161|gb|EEL59358.1| L-serine dehydratase, beta chain [Bacillus cereus Rock4-18]
          Length = 214

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 121 GGGKIEVVELNGFDLQLTGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 180

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D  + + V+E++     I  V
Sbjct: 181 RRALMVIETDELLADEVIEEIKGQQNICQV 210


>gi|302786926|ref|XP_002975234.1| hypothetical protein SELMODRAFT_102593 [Selaginella moellendorffii]
 gi|300157393|gb|EFJ24019.1| hypothetical protein SELMODRAFT_102593 [Selaginella moellendorffii]
          Length = 629

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   ++   + DV +   +I     D  G++  VG +LG+  +NI+   +GR+   +
Sbjct: 536 DGVPHLSQVGSFSIDVSLEGSVILCRQVDQPGMIGKVGGLLGDENVNISFMSVGRTSPRQ 595

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  + +D      VL+K+     +  +   + 
Sbjct: 596 KAVMAIGVDDEPSKEVLQKIGSISAVEELVFLKL 629


>gi|315636539|ref|ZP_07891775.1| phosphoglycerate dehydrogenase [Arcobacter butzleri JV22]
 gi|315479188|gb|EFU69885.1| phosphoglycerate dehydrogenase [Arcobacter butzleri JV22]
          Length = 528

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   R I++     DVD    MI + N DI G++  VG +LG+  INIA F L R  
Sbjct: 433 VFADDVQRVIELDGFAIDVDPKGKMIVMKNKDIPGVIGTVGKLLGDNKINIADFRLSR-G 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++   ID  + + +++ L        V   E 
Sbjct: 492 KDGIALAIALIDEKVTSEIIKNLDNLEATIAVAYAEI 528


>gi|229163078|ref|ZP_04291034.1| L-serine dehydratase, beta chain [Bacillus cereus R309803]
 gi|228620484|gb|EEK77354.1| L-serine dehydratase, beta chain [Bacillus cereus R309803]
          Length = 219

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 41/90 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 126 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D  + + V+E+++    I  V
Sbjct: 186 RRALMVIETDELLADEVIEEINAQQNICQV 215


>gi|157738251|ref|YP_001490935.1| D-3-phosphoglycerate dehydrogenase [Arcobacter butzleri RM4018]
 gi|157700105|gb|ABV68265.1| D-3-phosphoglycerate dehydrogenase [Arcobacter butzleri RM4018]
          Length = 528

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   R I++     DVD    MI + N DI G++  VG +LG+  INIA F L R  
Sbjct: 433 VFADDVQRVIELDGFAIDVDPKGKMIVMKNKDIPGVIGTVGKLLGDNKINIADFRLSR-G 491

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A++   ID  + + +++ L        V   E 
Sbjct: 492 KDGIALAIALIDEKVTSEIIKNLDNLEATIAVAYAEI 528


>gi|317050557|ref|YP_004111673.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
 gi|316945641|gb|ADU65117.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
          Length = 544

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 44/96 (45%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   R I++ E + D +    M+   N D  G++  V  +LGE GINI+HF L R  
Sbjct: 447 VFENAMARVIRLDEYDVDFNPEAPMLIFKNQDRNGLIGEVATLLGEAGINISHFALNRHP 506

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             E A+  +    ++   +L +L+    I       
Sbjct: 507 RGETALGVVNTGVAVSAELLTRLNRVPGIMNAWVIR 542


>gi|147823108|emb|CAN68604.1| hypothetical protein VITISV_036580 [Vitis vinifera]
          Length = 610

 Score = 89.7 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG PR   +   + DV +   +I     D  G++  VGNILGE  +N++   +GR+    
Sbjct: 517 DGIPRLTCVGSFSVDVSLEGNLILCRQVDQPGMIGRVGNILGECNVNVSFMSVGRTVKRT 576

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  + +D       L+K+     I
Sbjct: 577 RAIMAIGVDEEPXKDTLKKIGEVPAI 602


>gi|302785179|ref|XP_002974361.1| hypothetical protein SELMODRAFT_149626 [Selaginella moellendorffii]
 gi|300157959|gb|EFJ24583.1| hypothetical protein SELMODRAFT_149626 [Selaginella moellendorffii]
          Length = 545

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   ++   + DV +   +I     D  G++  VG +LG+  +NI+   +GR+   +
Sbjct: 452 DGVPHLSQVGSFSIDVSLEGSVILCRQVDQPGMIGKVGGLLGDENVNISFMSVGRTSPRQ 511

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  + +D      VL+K+     +  +   + 
Sbjct: 512 KAVMAIGVDDEPSKEVLQKIGSISAVEELVFLKL 545


>gi|315221596|ref|ZP_07863516.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus anginosus F0211]
 gi|315189430|gb|EFU23125.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus anginosus F0211]
          Length = 223

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 43/94 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFSISLSMNTPTIIIVHQDVPGMIAHVTEALSRYNINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D    +  +E++     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCDGAIEEIKKIPKLHNVNFFK 223


>gi|242074584|ref|XP_002447228.1| hypothetical protein SORBIDRAFT_06g030920 [Sorghum bicolor]
 gi|241938411|gb|EES11556.1| hypothetical protein SORBIDRAFT_06g030920 [Sorghum bicolor]
          Length = 620

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG++LGE  +N++   +GR    +
Sbjct: 527 DGVPHLTKVGAFQVDVSLEGSLILCRQVDQPGMIGSVGSVLGEENVNVSFMSVGRIAPRK 586

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
           HA+  + +D     + L K+     I
Sbjct: 587 HAVMAIGVDEEPSKATLTKIGEIPAI 612


>gi|152976546|ref|YP_001376063.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cereus subsp. cytotoxis NVH 391-98]
 gi|152025298|gb|ABS23068.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           cytotoxicus NVH 391-98]
          Length = 220

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 41/90 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIASVASILAKHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D ++ N V+E++     I  V
Sbjct: 187 RKALMVIETDEALENEVIEEIKEQSNICQV 216


>gi|228941301|ref|ZP_04103854.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228974233|ref|ZP_04134803.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980824|ref|ZP_04141129.1| L-serine dehydratase, beta chain [Bacillus thuringiensis Bt407]
 gi|228778993|gb|EEM27255.1| L-serine dehydratase, beta chain [Bacillus thuringiensis Bt407]
 gi|228785573|gb|EEM33582.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228818460|gb|EEM64532.1| L-serine dehydratase, beta chain [Bacillus thuringiensis serovar
           berliner ATCC 10792]
          Length = 228

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 38/90 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL    INI+   + R +  
Sbjct: 135 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILATNEINISTMSVSRKEKG 194

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D  + + V+E++     I  V
Sbjct: 195 RRALMVIETDELLADEVIEEIKAQQNICQV 224


>gi|222640652|gb|EEE68784.1| hypothetical protein OsJ_27507 [Oryza sativa Japonica Group]
          Length = 528

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 38/93 (40%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P    +     DV +   +I     D  G++  VGNILG+  +NI+   +GR+   + 
Sbjct: 436 GVPHLTVVGPYEVDVSLEGNLILCRQIDQPGMIGKVGNILGQTNVNISFMSVGRTFRGKQ 495

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           AI  + +D       LE +     I      E 
Sbjct: 496 AIMAIGVDEEPDKETLEHIGHIPAIEEFVFLEL 528


>gi|281491318|ref|YP_003353298.1| L-serine dehydratase subunit beta [Lactococcus lactis subsp. lactis
           KF147]
 gi|281375059|gb|ADA64577.1| L-serine dehydratase, beta subunit [Lactococcus lactis subsp.
           lactis KF147]
          Length = 223

 Score = 89.3 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 44/94 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  +  G     +++ D+ G++  V ++L E+ INIA  ++ R    
Sbjct: 130 GGGMIQVTELNGFDIAISAGVPTFVVIHEDVPGMIARVSSVLSEHQINIAQMNVTREAKG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  L +D   +  V+E++ +   +  V  F 
Sbjct: 190 EKAIMILEVDTPNVKEVIEEMKLIPRLHAVNFFN 223


>gi|326941919|gb|AEA17815.1| L-serine dehydratase [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 220

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 38/90 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL    INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILATNEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D  + + V+E++     I  V
Sbjct: 187 RRALMVIETDELLADEVIEEIKAQQNICQV 216


>gi|325290434|ref|YP_004266615.1| L-serine ammonia-lyase [Syntrophobotulus glycolicus DSM 8271]
 gi|324965835|gb|ADY56614.1| L-serine ammonia-lyase [Syntrophobotulus glycolicus DSM 8271]
          Length = 223

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 37/94 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I +   + +     I  V AD  G++  +  +L +  INIA   + R    
Sbjct: 127 GGGMIVIREINQFPVEFNGEYPAIVSVYADYPGMIAEITAVLAKASINIAKMKVSREGRG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A++ +  D  +   VL K+     +  V   E
Sbjct: 187 KRALTVIETDDIVPIEVLGKIRKLAKVEEVIFIE 220


>gi|319790479|ref|YP_004152112.1| D-3-phosphoglycerate dehydrogenase [Thermovibrio ammonificans HB-1]
 gi|317114981|gb|ADU97471.1| D-3-phosphoglycerate dehydrogenase [Thermovibrio ammonificans HB-1]
          Length = 533

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 50/97 (51%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  +  P+ ++I    FD+     ++ I N D+ G++  +G+ILG++ +NIA F LGR +
Sbjct: 437 VMDEKFPKIVEINGFLFDLTPEGKLLLIKNYDVPGVIGKLGSILGKHRVNIAGFQLGRKE 496

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A   + ID  +    +E++     I  VKQ   
Sbjct: 497 KGKEAKGVILIDDDVPQQAIEEIKEIPEILEVKQVNL 533


>gi|291521648|emb|CBK79941.1| L-serine ammonia-lyase [Coprococcus catus GD/7]
          Length = 222

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 43/94 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R  +I  +  +       + +V+ D LG+V  +  +L  +G+NIA   L R    
Sbjct: 128 GGGKVRISRINNVEVEFTGEYSSVIVVHQDQLGLVAHITAVLSHFGVNIAFMRLFRESKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A + + +DG +   + E +S N  +  V   E
Sbjct: 188 QTAYTLVEVDGDLPKGIKEMISDNHYVHDVMIIE 221


>gi|222153940|ref|YP_002563117.1| L-serine dehydratase, beta chain [Streptococcus uberis 0140J]
 gi|222114753|emb|CAR43913.1| putative L-serine dehydratase, beta chain [Streptococcus uberis
           0140J]
          Length = 223

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 39/90 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    + IV+ DI G++  V +IL    INIA  ++ R  + 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTLIIVHQDIPGMIAKVTDILSANDINIAQMNVTRESAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D       + ++     +  V
Sbjct: 190 EKAIMIIEVDSRNCQDAVNQIERIPNLHNV 219


>gi|302391962|ref|YP_003827782.1| L-serine ammonia-lyase [Acetohalobium arabaticum DSM 5501]
 gi|302204039|gb|ADL12717.1| L-serine ammonia-lyase [Acetohalobium arabaticum DSM 5501]
          Length = 223

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 39/94 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  +  D+      +  ++ D  G+V  V  IL EY +NIA   + R    
Sbjct: 127 GGGSIVVTEIDGVEVDLTGEYPTLITLHEDKPGVVAKVSAILNEYQLNIAEMKVVRQNKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A + + +D  +  S+L K+     ++ VK   
Sbjct: 187 TLATAVIGLDYQLDVSILNKIQKVSEVKKVKLVN 220


>gi|254458447|ref|ZP_05071872.1| phosphoglycerate dehydrogenase [Campylobacterales bacterium GD 1]
 gi|207084755|gb|EDZ62042.1| phosphoglycerate dehydrogenase [Campylobacterales bacterium GD 1]
          Length = 528

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F DG  R + I   + +V +   MI   N+D+ G++  +G+ L    +NI+ F L R++
Sbjct: 433 IFDDGVKRIVAIDGFDIEVALKGDMILFKNSDVPGVIGSIGSTLARNNVNISDFSLARNK 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
               A++ + +D ++  + L  L+       V  
Sbjct: 493 DA-EALAVILVDNAVNEATLNALASLEACLSVNY 525


>gi|312898124|ref|ZP_07757516.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Megasphaera micronuciformis F0359]
 gi|310620792|gb|EFQ04360.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Megasphaera micronuciformis F0359]
          Length = 219

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 36/90 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    +I      +      +   + D  GI+  V  +L   GIN++   + RS   
Sbjct: 124 GGGKIEIREINGFEAVLTGEDHTLMTFHHDKPGIIARVSTLLAMKGINVSTMRVFRSGRN 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E A+  +  DG + N  +E++     +  V
Sbjct: 184 ERAVMIIATDGRVPNESVEEIKKIDGVNNV 213


>gi|312866854|ref|ZP_07727067.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus parasanguinis F0405]
 gi|311097637|gb|EFQ55868.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus parasanguinis F0405]
          Length = 223

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAISLNMNTPTIIIVHQDVPGMIAHVTEALSRYDINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D     + +E +     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEAAIEDIRKIPHLHNVNFFK 223


>gi|311068106|ref|YP_003973029.1| L-serine dehydratase subunit beta [Bacillus atrophaeus 1942]
 gi|310868623|gb|ADP32098.1| L-serine dehydratase subunit beta [Bacillus atrophaeus 1942]
          Length = 220

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 41/93 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      I +V+ D  G +  V N+L ++ IN+ H  + R    
Sbjct: 126 GGGKIEITELNGFELRLSGNHPAILVVHNDKFGTIAGVANVLAKFSINVGHMEVARKDIG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A+  + +D +I + VL++L     I  V + 
Sbjct: 186 QLALMTIEVDQNIDDDVLDELKKLPNIIQVTKI 218


>gi|291287172|ref|YP_003503988.1| D-3-phosphoglycerate dehydrogenase [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884332|gb|ADD68032.1| D-3-phosphoglycerate dehydrogenase [Denitrovibrio acetiphilus DSM
           12809]
          Length = 544

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/100 (28%), Positives = 47/100 (47%), Gaps = 3/100 (3%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF+D   R +   +   D+      +   N D  GI+  VG ILG++ INIA F L R+ 
Sbjct: 445 VFADQTGRIVIYDKYYTDLIAEGTFLYFNNLDRPGIIGKVGTILGKHSINIADFDLARNV 504

Query: 61  STE---HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             +    A++F+ +D  +   VL+++     +   K   F
Sbjct: 505 KEDGEADAVAFVRVDSKVPAGVLDEILALDGMLEAKVITF 544


>gi|315644826|ref|ZP_07897955.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Paenibacillus vortex V453]
 gi|315279768|gb|EFU43069.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Paenibacillus vortex V453]
          Length = 227

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 13/90 (14%), Positives = 39/90 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G    +++   +    +   ++ + + D  G+V  +  +L   G+NIA+  + R    
Sbjct: 126 GGGSVEMLRVNGFDVKFTMNYPVLLVFHDDTPGMVAHITRLLDGGGVNIAYMDVDRKGRG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A++ +  D ++   +++ +    ++  V
Sbjct: 186 GDAMTVVESDEAVPVELMKHIEGLPSVHRV 215


>gi|320334181|ref|YP_004170892.1| L-serine dehydratase, iron-sulfur-dependent subunit beta
           [Deinococcus maricopensis DSM 21211]
 gi|319755470|gb|ADV67227.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Deinococcus maricopensis DSM 21211]
          Length = 221

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 14/93 (15%), Positives = 36/93 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G    +++             +     D +GI+  V +++   G+NIA  +  R +  
Sbjct: 123 GGGAIEVVRVDGFRVQFTGASPTLLTRYTDAIGIIARVASLIASDGVNIATLNCTREKRG 182

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  + +D  + +  +  LS    + +++  
Sbjct: 183 GAAMLSIELDAPLSDEAVRMLSRWPEMAWIRML 215


>gi|223933685|ref|ZP_03625661.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus suis 89/1591]
 gi|253752801|ref|YP_003025942.1| putative L-serine dehydratase, beta chain [Streptococcus suis SC84]
 gi|253754626|ref|YP_003027767.1| L-serine dehydratase, beta chain [Streptococcus suis P1/7]
 gi|253756559|ref|YP_003029699.1| L-serine dehydratase, beta chain [Streptococcus suis BM407]
 gi|302024646|ref|ZP_07249857.1| L-serine dehydratase, beta chain [Streptococcus suis 05HAS68]
 gi|330833761|ref|YP_004402586.1| L-serine dehydratase subunit beta [Streptococcus suis ST3]
 gi|223897638|gb|EEF64023.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus suis 89/1591]
 gi|251817090|emb|CAZ52742.1| putative L-serine dehydratase, beta chain [Streptococcus suis SC84]
 gi|251819023|emb|CAZ56870.1| putative L-serine dehydratase, beta chain [Streptococcus suis
           BM407]
 gi|251820872|emb|CAR47638.1| putative L-serine dehydratase, beta chain [Streptococcus suis P1/7]
 gi|319759219|gb|ADV71161.1| L-serine dehydratase, beta chain [Streptococcus suis JS14]
 gi|329307984|gb|AEB82400.1| L-serine dehydratase, beta chain [Streptococcus suis ST3]
          Length = 223

 Score = 89.3 bits (221), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 46/94 (48%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   + ++++    I IV+ D+ G++  V ++L +Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFSVNLNMNTPTIIIVHQDVPGMIAKVTDVLSKYDINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D     + + ++     +  V  F 
Sbjct: 190 EKAIMIIEVDARQCENSIAEIEKIPHLHNVTFFN 223


>gi|310826937|ref|YP_003959294.1| hypothetical protein ELI_1345 [Eubacterium limosum KIST612]
 gi|308738671|gb|ADO36331.1| hypothetical protein ELI_1345 [Eubacterium limosum KIST612]
          Length = 222

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 34/95 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  +   +      I +   D  G++  +   L +  INIA   L R +  
Sbjct: 128 GGGAAVIREINGVEIALSGEYNTILVKQRDKPGVLAHITRCLSDCQINIAFTKLYREKKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           E A + +  D  I   V+  +  +  I    + E 
Sbjct: 188 EIAYTIIETDEEITGEVIAAIEASGNIISATRIEL 222


>gi|146319825|ref|YP_001199537.1| L-serine deaminase [Streptococcus suis 05ZYH33]
 gi|146322016|ref|YP_001201727.1| L-serine deaminase [Streptococcus suis 98HAH33]
 gi|145690631|gb|ABP91137.1| L-serine deaminase [Streptococcus suis 05ZYH33]
 gi|145692822|gb|ABP93327.1| L-serine deaminase [Streptococcus suis 98HAH33]
 gi|292559421|gb|ADE32422.1| Probable L-serine dehydratase, beta chain [Streptococcus suis GZ1]
          Length = 227

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 46/94 (48%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   + ++++    I IV+ D+ G++  V ++L +Y INIA  ++ R ++ 
Sbjct: 134 GGGNIQVTELNGFSVNLNMNTPTIIIVHQDVPGMIAKVTDVLSKYDINIAQMNVTREKAG 193

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D     + + ++     +  V  F 
Sbjct: 194 EKAIMIIEVDARQCENSIAEIEKIPHLHNVTFFN 227


>gi|319946004|ref|ZP_08020253.1| L-serine ammonia-lyase beta subunit [Streptococcus australis ATCC
           700641]
 gi|319747812|gb|EFW00057.1| L-serine ammonia-lyase beta subunit [Streptococcus australis ATCC
           700641]
          Length = 223

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAISLNMNTPTIIIVHQDVPGMIAHVTEALSRYDINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D    +  +E +     +  V  F+
Sbjct: 190 EKAIMIIEVDSRNCDEAIELIRQIPHLHNVNFFQ 223


>gi|304317084|ref|YP_003852229.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778586|gb|ADL69145.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 228

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 33/94 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  +N +       +   + D  GI+  V  +L EY INIA   + R    
Sbjct: 129 GGGNVVLKEINGMNVEFTGEYETLITKHIDKPGIIAMVTKVLAEYKINIAFMRVYRQLKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           ++AI  +  D  I   V   +     I       
Sbjct: 189 DNAIMVIESDQVIPEDVRISIENINGIERAIVIN 222


>gi|257869767|ref|ZP_05649420.1| L-serine dehydratase [Enterococcus gallinarum EG2]
 gi|257803931|gb|EEV32753.1| L-serine dehydratase [Enterococcus gallinarum EG2]
          Length = 221

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 37/90 (41%), Gaps = 1/90 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G     IV+ D+ G+V  V N+L E  INI    + R    
Sbjct: 129 GGGNIQISELNGFKISLTLGTPTYVIVHQDVPGMVARVTNLLSEAQINIGTMTVTRESKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D    + + +++     +   
Sbjct: 189 EKAIMIIEVDER-NDQLAQQIKALPHVYSA 217


>gi|322390502|ref|ZP_08064020.1| L-serine ammonia-lyase beta subunit [Streptococcus parasanguinis
           ATCC 903]
 gi|321142776|gb|EFX38236.1| L-serine ammonia-lyase beta subunit [Streptococcus parasanguinis
           ATCC 903]
          Length = 230

 Score = 88.9 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 137 GGGNIQVTELNGFAISLNMNTPTIIIVHQDVPGMIAHVTEALSRYDINIAQMNVTREKAG 196

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D     + ++ +     +  V  F+
Sbjct: 197 EKAIMIIEVDSRSCEAAIDDIRKIPHLHNVNFFK 230


>gi|298204781|emb|CBI25279.3| unnamed protein product [Vitis vinifera]
          Length = 432

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG PR   +   + DV +   +I     D  G++  VGNILGE  +N++   +GR+    
Sbjct: 339 DGIPRLTCVGSFSVDVSLEGNLILCRQVDQPGMIGRVGNILGECNVNVSFMSVGRTVKRT 398

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  + +D       L+K+     I
Sbjct: 399 RAIMAIGVDEEPDKDTLKKIGEVPAI 424


>gi|312863760|ref|ZP_07723998.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus vestibularis F0396]
 gi|322516529|ref|ZP_08069445.1| L-serine ammonia-lyase beta subunit [Streptococcus vestibularis
           ATCC 49124]
 gi|311101296|gb|EFQ59501.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus vestibularis F0396]
 gi|322124917|gb|EFX96337.1| L-serine ammonia-lyase beta subunit [Streptococcus vestibularis
           ATCC 49124]
          Length = 223

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++     ++ +    + IV+ D+ G++  V +IL  YGINIA   + R  + 
Sbjct: 130 GGGNIQVTELNGFAVNLKMNTPTLIIVHQDVPGMIALVTDILSRYGINIAQMTVTRENAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + ID    +  +  ++    +  V  F 
Sbjct: 190 EKAIMIIEIDSHQCDEAVTDIARIPNLHNVNFFS 223


>gi|119356910|ref|YP_911554.1| D-3-phosphoglycerate dehydrogenase [Chlorobium phaeobacteroides DSM
           266]
 gi|119354259|gb|ABL65130.1| D-3-phosphoglycerate dehydrogenase [Chlorobium phaeobacteroides DSM
           266]
          Length = 526

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 21/97 (21%), Positives = 43/97 (44%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF D + R + I     +      +I   N D  G++  V  +L  + +N+A   L R +
Sbjct: 430 VFGDKELRIVMIDRFIVEFKPEGTIIIYNNIDQPGVIAQVTQLLLLHNLNVASIALSRDE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + AI+ + +DG +  ++L+++S    +        
Sbjct: 490 EKKLAITAIVVDGGVTTTLLDEISTVNGVSDSTLLSL 526


>gi|297832018|ref|XP_002883891.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297329731|gb|EFH60150.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 602

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 38/86 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG ILGE  +N++   +GR    +
Sbjct: 509 DGVPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGTVGRILGESNVNVSFMSVGRIAPRK 568

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            A+  + +D       L+K+     +
Sbjct: 569 QAVMAIGVDDMPSKETLKKIGEIPAV 594


>gi|193213940|ref|YP_001995139.1| D-3-phosphoglycerate dehydrogenase [Chloroherpeton thalassium ATCC
           35110]
 gi|193087417|gb|ACF12692.1| D-3-phosphoglycerate dehydrogenase [Chloroherpeton thalassium ATCC
           35110]
          Length = 526

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 42/96 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V    + R + I +   +      ++   N D  G++  VG  L + G+NIA   L R +
Sbjct: 430 VLGAKELRVVMIDKFLCEFKPEGQILIYNNQDKPGVLARVGMALLKRGLNIASVALSRDE 489

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             + A++ + +D ++   VLE +     +   +  +
Sbjct: 490 EKKEALTVISLDDTVDTEVLEDIEKVDGVFSPRLIK 525


>gi|269215713|ref|ZP_06159567.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit [Slackia
           exigua ATCC 700122]
 gi|269131200|gb|EEZ62275.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit [Slackia
           exigua ATCC 700122]
          Length = 569

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 38/94 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  ++  +      + I   D  G++  + +I+    INIA   L R +  
Sbjct: 152 GGGAAVITRINGVDVRLTGEFHSVVIRQTDAKGVLAHIASIISACDINIATTRLFREKKG 211

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A + +  D  I   + + L V+  I  V+  +
Sbjct: 212 DTAYTIMQTDDEIPAGIADALLVHPDIHDVRIVK 245


>gi|266622161|ref|ZP_06115096.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium hathewayi DSM 13479]
 gi|288866139|gb|EFC98437.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium hathewayi DSM 13479]
          Length = 222

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 40/94 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK R ++I ++  D       + +V+ D  G+   +  +L +  +NIA   + R    
Sbjct: 128 GGGKVRIVRINQVKVDFTGEYSAVIVVHQDKPGVAAHITKVLSDCSVNIAFMRIFREAKG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A + +  D  +  ++ E L  N+ +  V   +
Sbjct: 188 HTAYTIVESDNRLPGNITETLRENIHVHDVMIVQ 221


>gi|297798490|ref|XP_002867129.1| hypothetical protein ARALYDRAFT_491252 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297312965|gb|EFH43388.1| hypothetical protein ARALYDRAFT_491252 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 603

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 38/86 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N+    +GR    +
Sbjct: 510 DGVPHLTKVGSFEVDVTLEGSIILCRQVDQPGMIGTVGSILGESNVNVNFMSVGRIAPRK 569

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  + +D       L+K+     I
Sbjct: 570 QAIMAIGVDDIPSKDTLKKIGEIPAI 595


>gi|15235282|ref|NP_195146.1| EDA9 (embryo sac development arrest 9); ATP binding [Arabidopsis
           thaliana]
 gi|2911042|emb|CAA17552.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|7270370|emb|CAB80137.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|17380672|gb|AAL36166.1| putative phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|23297595|gb|AAN12903.1| putative phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 603

 Score = 88.6 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 38/86 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N+    +GR    +
Sbjct: 510 DGVPHLTKVGSFEVDVTLEGSIILCRQVDQPGMIGTVGSILGESNVNVNFMSVGRIAPRK 569

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  + +D       L+K+     +
Sbjct: 570 QAIMAIGVDDIPSKETLKKIGEIPAV 595


>gi|158522823|ref|YP_001530693.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
 gi|158511649|gb|ABW68616.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
          Length = 532

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 41/99 (41%), Gaps = 1/99 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           +F   + R ++I +   ++         I N D  G +  +G  LG +G+NI    +G+ 
Sbjct: 433 IFGKKEARVVRINDFRLEMIPTKGHFAIIHNLDKPGAIGSIGTTLGTFGVNIERMQVGQQ 492

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
             T   I FL     I +  L  +     ++ V  FE +
Sbjct: 493 GDTLRNIIFLRTGSRIPDDALAAVKELPLVKDVTVFELD 531


>gi|51535610|dbj|BAD37553.1| putative D-3 [Oryza sativa Japonica Group]
 gi|51536377|dbj|BAD37570.1| putative D-3 [Oryza sativa Japonica Group]
          Length = 625

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DGKP    +   + DV +   +I     D  GI+  VG+ILG+  +N+    +GR+   +
Sbjct: 532 DGKPHLTLVGPFSVDVSLEGNLILCRQVDQPGIIGKVGSILGKMNVNVNFMSVGRTAPGK 591

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  + +D       L+ +    ++
Sbjct: 592 QAIMAIGVDEEPEKEALKLIGDIPSV 617


>gi|21536501|gb|AAM60833.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
          Length = 603

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 38/86 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N+    +GR    +
Sbjct: 510 DGVPHLTKVGSFEVDVTLEGSIILCRQVDQPGMIGTVGSILGESNVNVNFMSVGRIAPRK 569

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  + +D       L+K+     +
Sbjct: 570 QAIMAIGVDDIPSKETLKKIGEIPAV 595


>gi|224113315|ref|XP_002316453.1| predicted protein [Populus trichocarpa]
 gi|222865493|gb|EEF02624.1| predicted protein [Populus trichocarpa]
          Length = 633

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 41/86 (47%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G P   ++   + DV +   +I     D  G++  VGNILGE  +N++   +GR+    
Sbjct: 540 NGIPHLTQVGSFSVDVSLEGNLILCRQVDQPGMIGQVGNILGEQNVNVSFMSVGRTARRR 599

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
           +AI  + +D       L+K+     I
Sbjct: 600 NAIMAIGVDEEPNLESLKKIGEVPAI 625


>gi|255555301|ref|XP_002518687.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223542068|gb|EEF43612.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 596

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 39/86 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N++   +GR    +
Sbjct: 503 DGIPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGSILGEENVNVSFMSVGRIAPRK 562

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            A+  + +D       L+K+     I
Sbjct: 563 QAVMAIGVDDQPKKESLKKIGDIPAI 588


>gi|239624630|ref|ZP_04667661.1| L-serine dehydratase [Clostridiales bacterium 1_7_47_FAA]
 gi|239521016|gb|EEQ60882.1| L-serine dehydratase [Clostridiales bacterium 1_7_47FAA]
          Length = 219

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 39/94 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++  +   +      + +++ D  G +  V  ++ + G+NI +F L R Q  
Sbjct: 124 GGGNILVTEVNGMEVSITGQHTTLIVLHRDAPGTIAAVTEVMADAGVNICNFRLSRQQKG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  + IDGS    + +K+ V   +      +
Sbjct: 184 GDAVMTIEIDGSFGPELNQKIKVLPNVFSSTMLQ 217


>gi|115469298|ref|NP_001058248.1| Os06g0655100 [Oryza sativa Japonica Group]
 gi|113596288|dbj|BAF20162.1| Os06g0655100 [Oryza sativa Japonica Group]
          Length = 629

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DGKP    +   + DV +   +I     D  GI+  VG+ILG+  +N+    +GR+   +
Sbjct: 536 DGKPHLTLVGPFSVDVSLEGNLILCRQVDQPGIIGKVGSILGKMNVNVNFMSVGRTAPGK 595

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  + +D       L+ +    ++
Sbjct: 596 QAIMAIGVDEEPEKEALKLIGDIPSV 621


>gi|270307961|ref|YP_003330019.1| phosphoglycerate dehydrogenase [Dehalococcoides sp. VS]
 gi|270153853|gb|ACZ61691.1| phosphoglycerate dehydrogenase [Dehalococcoides sp. VS]
          Length = 526

 Score = 88.6 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 42/94 (44%), Gaps = 1/94 (1%)

Query: 5   GKPRFIKIQEINFDVDI-GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G    +K+ +   D+   G   +   + D  G++   G I G+  INI++ HL R ++  
Sbjct: 433 GDVHIVKLNDYWIDIVPTGGYFLFADHIDRPGLIGAAGKITGDADINISYMHLSRQKARG 492

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D  +     ++L     ++ V+  + 
Sbjct: 493 QALMILALDEPLPEKQRQQLLSLQDVQTVQVVKI 526


>gi|308177181|ref|YP_003916587.1| phosphoglycerate dehydrogenase [Arthrobacter arilaitensis Re117]
 gi|307744644|emb|CBT75616.1| phosphoglycerate dehydrogenase [Arthrobacter arilaitensis Re117]
          Length = 531

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 44/90 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I     ++ I   MI +  AD  G+V  +GN+LGE G+NIA   + R +    A++
Sbjct: 440 KLVGINGHEIEIPISDHMIVVRYADRPGVVGSLGNVLGEQGVNIAGMQVSRDEKKAEALA 499

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            + ID ++   VL+ +   +     ++   
Sbjct: 500 VINIDSALPQGVLDVVGAAIGASVAREINL 529


>gi|296090450|emb|CBI40269.3| unnamed protein product [Vitis vinifera]
          Length = 432

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N++   +GR    +
Sbjct: 339 DGIPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGSILGEENVNVSFMSVGRVAPRK 398

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
           HA+  + +D       L+K+     +
Sbjct: 399 HAVMAIGVDEQPSKVTLKKIGEIPAV 424


>gi|330684332|gb|EGG96064.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU121]
          Length = 531

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 41/85 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V S   PR ++I   + D    +  I   + D  GIV   GN+LG  GINI    LGR+ 
Sbjct: 433 VLSGFGPRIVRINNFSLDFKPSQYQIVTCHNDQPGIVGKTGNLLGNKGINIGSMTLGRTN 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSV 85
               A+  L ID    ++++ +L+ 
Sbjct: 493 EGGQALMILSIDQPASHALVAELNN 517


>gi|326505978|dbj|BAJ91228.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326514850|dbj|BAJ99786.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 617

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 39/86 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG++LGE  +N++   +GR    +
Sbjct: 524 DGIPHLTKVGAFEVDVSMEGSLILCRQVDQPGMIGSVGSVLGEENVNVSFMSVGRIAPRK 583

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  + +D     + L K+     I
Sbjct: 584 TAIMAIGVDEEPSKTTLTKIGEIPAI 609


>gi|284161805|ref|YP_003400428.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus profundus DSM
           5631]
 gi|284011802|gb|ADB57755.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus profundus DSM
           5631]
          Length = 525

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 39/94 (41%), Gaps = 2/94 (2%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR--SQS 61
             + R ++I +   D       +  ++ D  G++  VG ++G+Y INIA   +GR   + 
Sbjct: 430 GEECRILRIDKYKVDFVPKGHYVISLHEDKPGVIGRVGTLMGKYNINIAGMIVGRYGDKP 489

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
               +  L +D      +L+K+     I      
Sbjct: 490 GGIQLMLLLLDDPPTEEILKKMVELEGIIDATYV 523


>gi|310658669|ref|YP_003936390.1| l-serine dehydratase, iron-sulfur-dependent subunit beta
           [Clostridium sticklandii DSM 519]
 gi|308825447|emb|CBH21485.1| l-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium sticklandii]
          Length = 221

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 34/95 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  I+         I +   D  G+V  +  +L E  INIA   L R    
Sbjct: 127 GGGSVLVRQINGIDVKFTGEYATIMVQQIDKPGVVAHITKVLSENNINIAFMSLFRESLG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           E A + L +D  +   +L KL  +  I        
Sbjct: 187 EKAFTMLELDEKVSEDILLKLKEHEYIIDTFLISI 221


>gi|187934314|ref|YP_001887295.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum B str. Eklund 17B]
 gi|187722467|gb|ACD23688.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium botulinum B str. Eklund 17B]
          Length = 226

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 13/94 (13%), Positives = 34/94 (36%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++     +       + +   D+ G++  V +IL +  IN+A   + R+   
Sbjct: 127 GGGNIQISEVNGNPVEFTGNYETLIVSQRDLPGVIHSVTSILSKENINVAFMKVFRNHKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A     +D  I    + ++     +  +    
Sbjct: 187 KDATMIFEMDNKISEKAIREIEKLELVHRIISIS 220


>gi|299136357|ref|ZP_07029541.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX8]
 gi|298602481|gb|EFI58635.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX8]
          Length = 540

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 7/104 (6%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V     PR +    I+ + ++   ++ I N D+ G++  +G ILGE  +NIA+F LGRS 
Sbjct: 434 VLHGHSPRLLSYDGIDVEAELTGTLVVIRNQDVPGVIGRIGTILGEAKLNIANFALGRST 493

Query: 61  S--TEHAISFLCID-----GSILNSVLEKLSVNVTIRFVKQFEF 97
                 A++ + +D        L   L +L    +I  V   E 
Sbjct: 494 RLPGSQALAVVQLDVPAEAQPALQQALAELRKVESITSVHIVEL 537


>gi|239637958|ref|ZP_04678919.1| phosphoglycerate dehydrogenase [Staphylococcus warneri L37603]
 gi|239596521|gb|EEQ79057.1| phosphoglycerate dehydrogenase [Staphylococcus warneri L37603]
          Length = 531

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 41/85 (48%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V S   PR ++I   + D    +  I   + D  GIV   GN+LG+ GINI    LGR+ 
Sbjct: 433 VLSGFGPRIVRINNFSLDFKPNQYQIVTCHNDQPGIVGKTGNLLGDNGINIGSMTLGRTI 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSV 85
               A+  L ID     +++ +L+ 
Sbjct: 493 EGGQALMILSIDQPASQTLVTELNN 517


>gi|224105607|ref|XP_002313870.1| predicted protein [Populus trichocarpa]
 gi|222850278|gb|EEE87825.1| predicted protein [Populus trichocarpa]
          Length = 543

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 38/86 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   ++     DV +   +I     D  G++  VG++LG   +N++   +GR    +
Sbjct: 450 DGIPHLTRVGSFEVDVSLEGSIILCRQVDQPGMIGKVGSVLGGQNVNVSFMSVGRIAPRK 509

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            A+  + +D       L+K+     +
Sbjct: 510 QAVMAIGVDEQPSKETLKKIGDIPAV 535


>gi|125556326|gb|EAZ01932.1| hypothetical protein OsI_23958 [Oryza sativa Indica Group]
          Length = 613

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DGKP    +   + DV +   +I     D  GI+  VG+ILG+  +N+    +GR+   +
Sbjct: 520 DGKPHLTLVGPFSVDVSLEGNLILCRQVDQPGIIGKVGSILGKMNVNVNFMSVGRTAPGK 579

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  + +D       L+ +    ++
Sbjct: 580 QAIMAIGVDEEPEKEALKLIGDIPSV 605


>gi|90399366|emb|CAH68268.1| H0212B02.14 [Oryza sativa Indica Group]
 gi|116311962|emb|CAJ86321.1| OSIGBa0113E10.4 [Oryza sativa Indica Group]
          Length = 613

 Score = 88.2 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG++LGE  +N++   +GR    +
Sbjct: 520 DGIPHLTKVGSFQVDVSLEGSLILCRQVDQPGMIGAVGSVLGEENVNVSFMSVGRIAPRK 579

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
           HA+  + +D     S L K+     I
Sbjct: 580 HAVMAIGVDEEPKKSTLTKIGEIPAI 605


>gi|205373332|ref|ZP_03226136.1| SdaAB [Bacillus coahuilensis m4-4]
          Length = 220

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 37/94 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      I +V+ D  G V  V  IL  + INI H  + R +  
Sbjct: 126 GGGKIEITELNGFELKLSGAHPAILVVHNDRYGAVAAVSAILAAHCINIGHMEVSRKEMG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+  +  D +I   VL +L     I  V +  
Sbjct: 186 QLALMIIETDQTIDREVLVELESLDNIVKVTKIS 219


>gi|229019354|ref|ZP_04176178.1| L-serine dehydratase, beta chain [Bacillus cereus AH1273]
 gi|229025600|ref|ZP_04182007.1| L-serine dehydratase, beta chain [Bacillus cereus AH1272]
 gi|228735694|gb|EEL86282.1| L-serine dehydratase, beta chain [Bacillus cereus AH1272]
 gi|228741922|gb|EEL92098.1| L-serine dehydratase, beta chain [Bacillus cereus AH1273]
          Length = 220

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D  + + V+ +++    I  V
Sbjct: 187 RRALMVIETDELLADEVIAEINGQQNICQV 216


>gi|226498082|ref|NP_001147127.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
 gi|195607486|gb|ACG25573.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 612

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 39/86 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG++LGE  IN++   +GR    +
Sbjct: 519 DGVPHLTKVGAFQVDVSLEGSLILCRQVDQPGMIGSVGSVLGEENINVSFMSVGRIAPRK 578

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
           HA+  + +D       L K+     I
Sbjct: 579 HAVMAIGVDEEPSKVTLRKIGEIPAI 604


>gi|323706077|ref|ZP_08117646.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534521|gb|EGB24303.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 228

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 34/93 (36%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  +N +       +   + D  GI+  V  +L E+ INIA   + R    
Sbjct: 129 GGGNVVLKEINGMNVEFTGEYETLITKHIDKPGIIAMVTKVLSEHMINIAFMRVYRQLKG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + AI  +  D +I   V  ++     I      
Sbjct: 189 DMAIMVIESDQTIPEDVRIRIEHIDGIEKAIVV 221


>gi|115460988|ref|NP_001054094.1| Os04g0650800 [Oryza sativa Japonica Group]
 gi|32488924|emb|CAE04505.1| OSJNBb0059K02.15 [Oryza sativa Japonica Group]
 gi|113565665|dbj|BAF16008.1| Os04g0650800 [Oryza sativa Japonica Group]
 gi|125550010|gb|EAY95832.1| hypothetical protein OsI_17701 [Oryza sativa Indica Group]
 gi|215768007|dbj|BAH00236.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 613

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG++LGE  +N++   +GR    +
Sbjct: 520 DGIPHLTKVGSFQVDVSLEGSLILCRQVDQPGMIGAVGSVLGEENVNVSFMSVGRIAPRK 579

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
           HA+  + +D     S L K+     I
Sbjct: 580 HAVMAIGVDEEPKKSTLTKIGEIPAI 605


>gi|125598081|gb|EAZ37861.1| hypothetical protein OsJ_22207 [Oryza sativa Japonica Group]
          Length = 613

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DGKP    +   + DV +   +I     D  GI+  VG+ILG+  +N+    +GR+   +
Sbjct: 520 DGKPHLTLVGPFSVDVSLEGNLILCRQVDQPGIIGKVGSILGKMNVNVNFMSVGRTAPGK 579

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  + +D       L+ +    ++
Sbjct: 580 QAIMAIGVDEEPEKEALKLIGDIPSV 605


>gi|117927917|ref|YP_872468.1| D-3-phosphoglycerate dehydrogenase [Acidothermus cellulolyticus
           11B]
 gi|117648380|gb|ABK52482.1| D-3-phosphoglycerate dehydrogenase [Acidothermus cellulolyticus
           11B]
          Length = 530

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 45/90 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + +KI + + D+ +   +      D  GIV  +G ILGE+GINIA   + R     HA+ 
Sbjct: 438 KLVKIDDFDVDLTLSEHLGFFRYEDRPGIVGILGRILGEHGINIAGMQVARDVKGGHALI 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D +I ++V+E +   +     +  + 
Sbjct: 498 ALTVDSAIPDTVVETVVREIGASSGRAVDL 527


>gi|307111670|gb|EFN59904.1| hypothetical protein CHLNCDRAFT_56437 [Chlorella variabilis]
          Length = 609

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 17/92 (18%), Positives = 39/92 (42%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P   ++   + D+ +   ++ +   D  GI+  V +      +NI+   + R      
Sbjct: 513 GLPFLTRVGGFDVDLALEGEVVLVRQTDQPGIIAAVSSEFAASKVNISFMTVSRVAKGTE 572

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           AI  + +D +   +V++ +S    ++ V  F 
Sbjct: 573 AIMAIGVDEAPSAAVMDAISKIKGVQEVTLFS 604


>gi|302781158|ref|XP_002972353.1| hypothetical protein SELMODRAFT_413029 [Selaginella moellendorffii]
 gi|300159820|gb|EFJ26439.1| hypothetical protein SELMODRAFT_413029 [Selaginella moellendorffii]
          Length = 627

 Score = 88.2 bits (218), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 41/86 (47%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   ++ + + DV +   +I     D  GI+  VG +LG+  +N++   +GR+   +
Sbjct: 534 DGLPHLSQVGQFSMDVSLEGSVILCKQVDQPGIIGKVGGLLGDGNVNVSFMSVGRTSPRK 593

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            A+  + +D      VL ++     +
Sbjct: 594 QAVMAIGVDEEPSKEVLHRIGAIPAV 619


>gi|229013350|ref|ZP_04170490.1| L-serine dehydratase, beta chain [Bacillus mycoides DSM 2048]
 gi|229134948|ref|ZP_04263755.1| L-serine dehydratase, beta chain [Bacillus cereus BDRD-ST196]
 gi|229168884|ref|ZP_04296602.1| L-serine dehydratase, beta chain [Bacillus cereus AH621]
 gi|228614614|gb|EEK71721.1| L-serine dehydratase, beta chain [Bacillus cereus AH621]
 gi|228648623|gb|EEL04651.1| L-serine dehydratase, beta chain [Bacillus cereus BDRD-ST196]
 gi|228747943|gb|EEL97808.1| L-serine dehydratase, beta chain [Bacillus mycoides DSM 2048]
          Length = 220

 Score = 87.8 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLTGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D  + + V+ +++    I  V
Sbjct: 187 RRALMVIETDELLADEVIAEINGQQNICQV 216


>gi|224034059|gb|ACN36105.1| unknown [Zea mays]
          Length = 612

 Score = 87.8 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 39/86 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG++LGE  IN++   +GR    +
Sbjct: 519 DGVPHLTKVGAFQVDVSLEGSLILCRQVDQPGMIGSVGSVLGEENINVSFMSVGRIAPRK 578

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
           HA+  + +D       L K+     I
Sbjct: 579 HAVMAIGVDEEPSKVTLRKIGEIPAI 604


>gi|116789697|gb|ABK25346.1| unknown [Picea sitchensis]
          Length = 622

 Score = 87.8 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 39/94 (41%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
            G P   K+   + DV +   +I     D  G++  VGNILGE  +N+    +GR    +
Sbjct: 529 GGIPHLSKVGAFSVDVSLEGSVILCRQTDQPGMIGTVGNILGEENVNVNFMSVGRIAPRK 588

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  + +D       L+K+     I      + 
Sbjct: 589 KAVMAIGVDEEPSKGALKKIGDVPAIEEFVYLKL 622


>gi|163941882|ref|YP_001646766.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           weihenstephanensis KBAB4]
 gi|163864079|gb|ABY45138.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           weihenstephanensis KBAB4]
          Length = 220

 Score = 87.8 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLTGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D  + + V+ +++    I  V
Sbjct: 187 RRALMVIETDELLADEVIAEINGQQNICQV 216


>gi|296875543|ref|ZP_06899615.1| L-serine dehydratase beta subunit [Streptococcus parasanguinis ATCC
           15912]
 gi|296433467|gb|EFH19242.1| L-serine dehydratase beta subunit [Streptococcus parasanguinis ATCC
           15912]
          Length = 223

 Score = 87.8 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 41/94 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      +++    I IV+ D+ G++  V   L  Y INIA  ++ R ++ 
Sbjct: 130 GGGNIQVTELNGFAISLNMNTPTIIIVHQDVPGMIAHVTEALSRYDINIAQMNVTREKAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  + +D       +E +     +  V  F+
Sbjct: 190 EKAIMIIEVDSRSCEVAIEDIRKIPHLHNVNFFK 223


>gi|224060560|ref|XP_002300235.1| predicted protein [Populus trichocarpa]
 gi|118485917|gb|ABK94804.1| unknown [Populus trichocarpa]
 gi|222847493|gb|EEE85040.1| predicted protein [Populus trichocarpa]
          Length = 597

 Score = 87.8 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 38/86 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG++LG   +N++   +GR    +
Sbjct: 504 DGIPHLTKVGSFEVDVSLEGSIILCRQVDQPGMIGKVGSVLGVENVNVSFMSVGRIAPRK 563

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            A+  + +D       L+K+     +
Sbjct: 564 QAVMAIGVDEQPSKETLKKIGDIPAV 589


>gi|315162115|gb|EFU06132.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Enterococcus faecalis TX0645]
          Length = 233

 Score = 87.8 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 42/93 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G     +V+ D+ G++  V NIL    INI+   + R    
Sbjct: 140 GGGNIQISELNGFKLSLSMGTPTFIVVHQDVPGMIAKVTNILSASDINISTMTVTRESKG 199

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E AI  + +D + +  ++ +L+  + I  V  F
Sbjct: 200 EKAIMIIEVDQAEVGDIVMQLAEILHIYSVNYF 232


>gi|195979021|ref|YP_002124265.1| probable L-serine dehydratase beta chain SdaAB [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
 gi|195975726|gb|ACG63252.1| probable L-serine dehydratase beta chain SdaAB [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
          Length = 223

 Score = 87.8 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 41/90 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    + IV+ DI G++  V +IL    INIA   + R  + 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTLIIVHQDIPGMIAKVTDILSASDINIAQMTVTRESAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D     + +++++    +  V
Sbjct: 190 EKAIMIIEVDSRDCQAAVKQIATIPNLHNV 219


>gi|28210417|ref|NP_781361.1| D-3-phosphoglycerate dehydrogenase [Clostridium tetani E88]
 gi|28202854|gb|AAO35298.1| D-3-phosphoglycerate dehydrogenase [Clostridium tetani E88]
          Length = 533

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 43/93 (46%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
            + + ++I E   DV     M+ + N D+ G++  VG  LG  G+N+A   +GR    + 
Sbjct: 441 NEGKLVEIMEYEVDVKPTECMVFLQNYDVPGVIGHVGTFLGTNGVNVATMQVGRKLKGDK 500

Query: 65  AISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           A+  L +D  +    L  L  +  I + K  + 
Sbjct: 501 ALMLLNVDDKVTQDTLLGLQKHDDILWAKFVQL 533


>gi|308081353|ref|NP_001183055.1| hypothetical protein LOC100501398 [Zea mays]
 gi|238009062|gb|ACR35566.1| unknown [Zea mays]
          Length = 598

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 39/86 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG++LGE  IN++   +GR    +
Sbjct: 505 DGVPHLTKVGAFQVDVSLEGSLILCRQVDQPGMIGSVGSVLGEENINVSFMSVGRIAPRK 564

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
           HA+  + +D       L K+     I
Sbjct: 565 HAVMAIGVDEEPSKVTLRKIGEIPAI 590


>gi|319653242|ref|ZP_08007344.1| L-serine dehydratase subunit [Bacillus sp. 2_A_57_CT2]
 gi|317395163|gb|EFV75899.1| L-serine dehydratase subunit [Bacillus sp. 2_A_57_CT2]
          Length = 220

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 39/90 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++      +      I +V+ D  G++  V NIL ++ INI H  + R +  
Sbjct: 126 GGGTIEITELNSFELKLSGEHPAILVVHNDQFGVISAVTNILSKHQINIGHMEVSRKEKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + AI  + +D  I + V+ +L     I  +
Sbjct: 186 KMAIMVIEVDQKIGHDVMTELEGLPNITQI 215


>gi|255281326|ref|ZP_05345881.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Bryantella formatexigens DSM 14469]
 gi|255268283|gb|EET61488.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Bryantella formatexigens DSM 14469]
          Length = 268

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 21/91 (23%), Positives = 36/91 (39%), Gaps = 1/91 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  +          I I + D  G++  V  +L E  INIA   + RS   
Sbjct: 175 GGGSIEIQEINGMEVSFGCEYPTILIFHHDRPGVINKVTGVLAEEKINIAFMCVFRSSRW 234

Query: 63  EHAISFLCIDGSILNSVLEKL-SVNVTIRFV 92
           ++A   +  DG +   +LE +   +  +  V
Sbjct: 235 QNACMIIETDGDVKREILEHIRRESEDVMEV 265


>gi|261368971|ref|ZP_05981854.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Subdoligranulum variabile DSM 15176]
 gi|282568925|gb|EFB74460.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Subdoligranulum variabile DSM 15176]
          Length = 218

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 37/87 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      I  +   +      + + + D  G++  V ++L + G+NI +F L R Q  
Sbjct: 124 GGGNIVIDAINGMAVRISGQHPSLIVQHRDRPGVIAEVTDLLADRGVNICNFSLSRRQKG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTI 89
             A+  + +DG +  ++  ++     +
Sbjct: 184 GVAVMTIEMDGGLDEALAARVRALPDV 210


>gi|302385249|ref|YP_003821071.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium saccharolyticum WM1]
 gi|302195877|gb|ADL03448.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium saccharolyticum WM1]
          Length = 219

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 38/96 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     K+ ++          + +++ D+ GI+  V N++     NI +F L R +  
Sbjct: 124 GGGNIVITKVNDMEVYFTGQNTTLIVMHQDLPGIIAHVTNLVAVGKANICNFRLNRQEKG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
             AI  + +D     S++ ++     +      + N
Sbjct: 184 GLAIMTIEMDSDFDQSLVREIKAIPHVYNTILLKLN 219


>gi|118443198|ref|YP_877338.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium novyi NT]
 gi|118133654|gb|ABK60698.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium novyi NT]
          Length = 227

 Score = 87.8 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 33/94 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      I+  + +       +   + D  G++  +  +L    INI    + R    
Sbjct: 127 GGGNILIFDIEGQDVEFRGDYPTLITTHKDTPGVISKITTMLYTENINIGSMKVYRGGKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            +A   L  D  I   +++K+     I+ ++   
Sbjct: 187 VNATMALETDNIIPEDIIDKIKGITEIQKIRVIN 220


>gi|125624524|ref|YP_001033007.1| L-serine dehydratase beta subunit [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|124493332|emb|CAL98305.1| L-serine dehydratase beta subunit [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|300071318|gb|ADJ60718.1| L-serine dehydratase beta subunit [Lactococcus lactis subsp.
           cremoris NZ9000]
          Length = 223

 Score = 87.4 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 44/94 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  +  G     +++ D+ G++  V ++L E+ INIA  ++ R    
Sbjct: 130 GGGMIQVTELNGFDIAISAGVPTFVVIHEDVPGMIARVSSVLSEHQINIAQMNVTREAKG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  L +D   +  V+E++ +   +  V  F 
Sbjct: 190 EKAIMILEVDIPNVKEVIEEMKLIPRLHAVNFFN 223


>gi|312879110|ref|ZP_07738910.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Aminomonas paucivorans DSM 12260]
 gi|310782401|gb|EFQ22799.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Aminomonas paucivorans DSM 12260]
          Length = 224

 Score = 87.4 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 34/94 (36%), Gaps = 1/94 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      +             +   + D  G++  V  +L E G+NIA  ++ R    
Sbjct: 124 GGGAVELQSVDGFQLRATGAFPTLVTFHRDEPGVIAAVSALLAEGGLNIASMNVHRQGRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSV-NVTIRFVKQF 95
             A   L +DG+   ++L +L   +  +  +   
Sbjct: 184 AKAAMVLELDGAPDGALLARLEACHPGLERLLVL 217


>gi|229061812|ref|ZP_04199145.1| L-serine dehydratase, beta chain [Bacillus cereus AH603]
 gi|228717558|gb|EEL69222.1| L-serine dehydratase, beta chain [Bacillus cereus AH603]
          Length = 214

 Score = 87.4 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL ++ INI+   + R +  
Sbjct: 121 GGGKIEVVELNGFDLQLTGTSPALLIVNNDRFGAIAAVASILAKHEINISTMSVSRKEKG 180

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  +  D  + + V+ +++    I  V
Sbjct: 181 RRALMVIETDELLADEVIAEINGQQNICQV 210


>gi|160935599|ref|ZP_02082974.1| hypothetical protein CLOBOL_00489 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441343|gb|EDP19053.1| hypothetical protein CLOBOL_00489 [Clostridium bolteae ATCC
           BAA-613]
          Length = 219

 Score = 87.4 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 38/94 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++  +   +      + +++ D  G +  V  ++ + G+NI +F L R    
Sbjct: 124 GGGNILVKEVNGMEVSITGQHTTLIVLHRDAPGTIAAVTEVMADAGVNICNFRLSRQSRG 183

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  + IDGS    + EK+ V   I      +
Sbjct: 184 GEAVMTIEIDGSFGPELNEKIKVLPNIFSSTMLQ 217


>gi|168002445|ref|XP_001753924.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162694900|gb|EDQ81246.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 523

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 41/86 (47%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+ +   DV +   +I     D  G++  VG+ILG+  +NI+   +GR    +
Sbjct: 430 DGVPYLSKVGDFGVDVSLEDSIILCRQVDQPGMIGKVGSILGQENVNISFMSVGRKSPRQ 489

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
           HA+  + +D       L+KL     +
Sbjct: 490 HAVMAIGVDEEPSKVTLQKLGDIPAV 515


>gi|154686001|ref|YP_001421162.1| SdaAB [Bacillus amyloliquefaciens FZB42]
 gi|154351852|gb|ABS73931.1| SdaAB [Bacillus amyloliquefaciens FZB42]
          Length = 220

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 41/93 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      I +V+ D  G +  V N+L ++ IN+ H  + R    
Sbjct: 126 GGGKIEITELNGFELRLSGNHPAILVVHNDKFGTIAGVANVLAKFSINVGHMEVARKDVG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A+  + +D +I   VL++LS    I  V + 
Sbjct: 186 QLALMTIEVDQNIEEEVLDELSTLPNIIQVTKI 218


>gi|332179200|gb|AEE14889.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermodesulfobium narugense DSM 14796]
          Length = 220

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 19/94 (20%), Positives = 36/94 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     KI     ++      +   + D  GI+  +  I+    INIA+ ++ R +  
Sbjct: 125 GGGNIVVKKIDNYEVNLTGNYETLITCHKDHPGIIAKITQIISSKNINIAYMYVSRLEKG 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+  +  D  I   +   L  +  + FVK   
Sbjct: 185 KDAMMTIETDDYITPDIYSALLKSPDLNFVKIIH 218


>gi|256827421|ref|YP_003151380.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit/L-serine
           dehydratase, iron-sulfur-dependent, beta subunit
           [Cryptobacterium curtum DSM 15641]
 gi|256583564|gb|ACU94698.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit/L-serine
           dehydratase, iron-sulfur-dependent, beta subunit
           [Cryptobacterium curtum DSM 15641]
          Length = 541

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 39/93 (41%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  ++ ++      + I   D +G++  +   +   G NIA     R Q  
Sbjct: 128 GGGAATLTRINGVDVNITGECTSVIIQQRDTVGVLAHITQSISHIGGNIATLRCYREQRG 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E A + L +DGS+  SV E +  +  I  ++  
Sbjct: 188 ETAYTVLEVDGSVPISVCEAIMGHPGIMSIRVI 220


>gi|284047795|ref|YP_003398134.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Acidaminococcus fermentans DSM 20731]
 gi|283952016|gb|ADB46819.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Acidaminococcus fermentans DSM 20731]
          Length = 221

 Score = 87.4 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 37/96 (38%), Gaps = 2/96 (2%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILG--EYGINIAHFHLGRSQ 60
             G  R   +  +  D    R  I + + D  G++  V NI+      +NIA+F L R  
Sbjct: 124 GGGNIRVDYVDGMKVDFTGERNTILVPHYDRPGVIAAVTNIMWQKHKDVNIANFKLSRPV 183

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               A+  + IDG     V+E +     +  V    
Sbjct: 184 KGGIAMMTIEIDGMPPADVIETIRSVQYVTNVVLIR 219


>gi|269791881|ref|YP_003316785.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269099516|gb|ACZ18503.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 224

 Score = 87.4 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 17/89 (19%), Positives = 32/89 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++             +   + D  G++  V  IL E GIN+   ++ R    
Sbjct: 123 GGGAVELQEVDGFVLRATGELPTMVTFHRDEPGVIAAVTAILAEAGINVGSMNVHRQGRG 182

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRF 91
           + A   L +DG     V+E++    +   
Sbjct: 183 KGAAMVLELDGLPPEQVVERIKGCHSAIR 211


>gi|116511642|ref|YP_808858.1| L-serine ammonia-lyase [Lactococcus lactis subsp. cremoris SK11]
 gi|116107296|gb|ABJ72436.1| L-serine ammonia-lyase [Lactococcus lactis subsp. cremoris SK11]
          Length = 223

 Score = 87.4 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 43/94 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  +  G     +++ D+ G++  V ++L E+ INIA  ++ R    
Sbjct: 130 GGGMIQVTELNGFDIAISAGVPTFVVIHEDVPGMIARVSSLLSEHQINIAQMNVTREAKG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E AI  L +D   +  V+ ++ +   +  V  F 
Sbjct: 190 EKAIMILEVDTPNVKEVIGEMKLIPRLHAVNFFN 223


>gi|294056127|ref|YP_003549785.1| D-3-phosphoglycerate dehydrogenase [Coraliomargarita akajimensis
           DSM 45221]
 gi|293615460|gb|ADE55615.1| D-3-phosphoglycerate dehydrogenase [Coraliomargarita akajimensis
           DSM 45221]
          Length = 528

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 44/92 (47%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
            PR + I     +V+    ++ + N D+ GIV F+G  LGE  +NIA+  L R +    A
Sbjct: 437 NPRIVTIDGHGVEVNTDATLLVLKNKDVPGIVGFIGVTLGEDEVNIANMSLSRDKGEGFA 496

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +S   +D +   +   K++ +  I   +  + 
Sbjct: 497 VSVFELDTAPSEACATKITEHHAIEKYRVIKL 528


>gi|317012830|gb|ADU83438.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           Lithuania75]
          Length = 524

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|308173548|ref|YP_003920253.1| L-serine dehydratase subunit beta [Bacillus amyloliquefaciens DSM
           7]
 gi|307606412|emb|CBI42783.1| L-serine dehydratase (beta chain) [Bacillus amyloliquefaciens DSM
           7]
 gi|328553519|gb|AEB24011.1| L-serine dehydratase (beta chain) [Bacillus amyloliquefaciens
           TA208]
 gi|328911689|gb|AEB63285.1| L-serine dehydratase (beta chain) [Bacillus amyloliquefaciens LL3]
          Length = 220

 Score = 87.0 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 41/93 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      I +V+ D  G +  V N+L ++ IN+ H  + R    
Sbjct: 126 GGGKIEITELNGFELRLSGNHPAILVVHNDKFGTIAGVANVLAKFSINVGHMEVARKDVG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A+  + +D +I   VL++LS    I  V + 
Sbjct: 186 QLALMTIEVDQNIEEEVLDELSTLPNIIQVTKI 218


>gi|15645025|ref|NP_207195.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 26695]
 gi|2313497|gb|AAD07461.1| phosphoglycerate dehydrogenase (serA) [Helicobacter pylori 26695]
          Length = 524

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|109947057|ref|YP_664285.1| D-3-phosphoglycerate dehydrogenase [Helicobacter acinonychis str.
           Sheeba]
 gi|109714278|emb|CAJ99286.1| D-3-phosphoglycerate dehydrogenase [Helicobacter acinonychis str.
           Sheeba]
          Length = 524

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN+   +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNVFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|325997911|gb|ADZ50119.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 2017]
          Length = 524

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|307637719|gb|ADN80169.1| D-3-phospho glycerate dehydrogenase [Helicobacter pylori 908]
 gi|325996322|gb|ADZ51727.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 2018]
          Length = 524

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|317014441|gb|ADU81877.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           Gambia94/24]
          Length = 524

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|225001262|gb|ACN78491.1| putative phosphoglycerate dehydrogenase [Arachis hypogaea]
          Length = 223

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+   + DV +   +I     D  G++  VG++LG+  +N++   +GR    +
Sbjct: 130 DGIPHLTKVGSFDVDVSLEGSIILCRQVDQPGMIGKVGSVLGQENVNVSFMSVGRIAPRK 189

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            A+  + +D       L+K+     +
Sbjct: 190 QAVMAIGVDEQPSKETLKKIGEIPAV 215


>gi|50954968|ref|YP_062256.1| D-3-phosphoglycerate dehydrogenase [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50951450|gb|AAT89151.1| D-3-phosphoglycerate dehydrogenase [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 530

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   + +V I   +I +V  D  GIV   G   GE  INIA   + R+ +   A+S
Sbjct: 438 KVVEINGYDVEVPIAEHLIVMVYDDRPGIVAVYGREFGEAKINIAGMQIARTSAGGKALS 497

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D S+   +LEK+ 
Sbjct: 498 VLTVDSSVPEGLLEKVR 514


>gi|317177807|dbj|BAJ55596.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F16]
          Length = 524

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|317011252|gb|ADU84999.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           SouthAfrica7]
          Length = 524

 Score = 87.0 bits (215), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN+   +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNVFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|210135216|ref|YP_002301655.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori P12]
 gi|210133184|gb|ACJ08175.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori P12]
          Length = 524

 Score = 87.0 bits (215), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|323359647|ref|YP_004226043.1| phosphoglycerate dehydrogenase [Microbacterium testaceum StLB037]
 gi|323276018|dbj|BAJ76163.1| phosphoglycerate dehydrogenase [Microbacterium testaceum StLB037]
          Length = 534

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 43/91 (47%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           P+ + I   + +V I +  + +  AD  GIV   G  LGE GINIA   +    +T  A+
Sbjct: 441 PKVVAINGYDIEVPIEQHHLVMRYADRPGIVAIYGQKLGEAGINIAGLQVAAPDATGRAL 500

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           S L +D  + + +L  +   V     +Q + 
Sbjct: 501 SVLTVDSPVPDEILGAMREAVGADLFRQIDI 531


>gi|108563420|ref|YP_627736.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori HPAG1]
 gi|107837193|gb|ABF85062.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori HPAG1]
          Length = 524

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|308184795|ref|YP_003928928.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori SJM180]
 gi|308060715|gb|ADO02611.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori SJM180]
          Length = 524

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|329117432|ref|ZP_08246149.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus parauberis NCFD 2020]
 gi|326907837|gb|EGE54751.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Streptococcus parauberis NCFD 2020]
          Length = 223

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 42/90 (46%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    I IV+ DI G++  V +IL ++ INIA  ++ R  + 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTIIIVHQDIPGMIAHVTDILSDFDINIAQMNVTREAAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D     + ++ +     +  V
Sbjct: 190 EKAIMIIEVDSRDCQAAIQLIEKIPHLHNV 219


>gi|253576749|ref|ZP_04854075.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843780|gb|EES71802.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 223

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 16/95 (16%), Positives = 32/95 (33%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      I             + I +AD  G++  +  +     +NI +    R   T
Sbjct: 127 GGGTIVIRNIDGFEVKCSGELPTLVISHADRQGVLAGITALFSRENVNIGYIITDRKGRT 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             A++ +  D SI   ++E +     +  V   + 
Sbjct: 187 AEALTVVEADSSIPPELVEAIRALEHVSQVSYIDL 221


>gi|302875117|ref|YP_003843750.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium cellulovorans 743B]
 gi|307690257|ref|ZP_07632703.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium cellulovorans 743B]
 gi|302577974|gb|ADL51986.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium cellulovorans 743B]
          Length = 231

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 38/94 (40%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++ +   +       + I + D+ G++  V  I+ +  INIA   + R+   
Sbjct: 127 GGGNIIINEVDDEKLEFSGNYPTLIIKHKDLPGMISKVSEIISKQNINIAFLKVLRTSKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A      D ++ + V+ +++    I  V+   
Sbjct: 187 QSATMIFETDSTLNDDVVNEINTLNHIENVRMIN 220


>gi|317178639|dbj|BAJ56427.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F30]
          Length = 524

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A+S + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALSLIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|254779611|ref|YP_003057717.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori B38]
 gi|254001523|emb|CAX29541.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Helicobacter pylori B38]
          Length = 524

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|217034326|ref|ZP_03439742.1| hypothetical protein HP9810_491g19 [Helicobacter pylori 98-10]
 gi|216943211|gb|EEC22678.1| hypothetical protein HP9810_491g19 [Helicobacter pylori 98-10]
          Length = 524

 Score = 86.6 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|315924821|ref|ZP_07921038.1| D-isomer specific 2-hydroxyacid dehydrogenase [Pseudoramibacter
           alactolyticus ATCC 23263]
 gi|315621720|gb|EFV01684.1| D-isomer specific 2-hydroxyacid dehydrogenase [Pseudoramibacter
           alactolyticus ATCC 23263]
          Length = 389

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 12/94 (12%), Positives = 36/94 (38%), Gaps = 2/94 (2%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +      +   + N D+      I + + ++  ++  +  +L +  INIA+         
Sbjct: 298 NGNIVNSVNYPDCNMDICESAHRITVAHHNVPNMIAGITAVLAKDDINIANMT--NKNKG 355

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A + + +D  + +  +  L     +  V+  +
Sbjct: 356 QFAYTMIDVDSEVTDQAIADLKAIEGVTRVRLVK 389


>gi|297380233|gb|ADI35120.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori v225d]
          Length = 524

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|296331160|ref|ZP_06873634.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674316|ref|YP_003865988.1| L-serine dehydratase subunit beta [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151804|gb|EFG92679.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412560|gb|ADM37679.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 220

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 42/93 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      I +V+ D  G +  V N+L ++ IN+ H  + R    
Sbjct: 126 GGGKIEITELNGFELRLSGNHPAILVVHNDKFGTIAGVANVLAKFSINVGHMEVARKDIG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A+  + +D +I + VL++LS    I  V + 
Sbjct: 186 QLALMTIEVDQNIDDHVLDELSKLPNIIQVTKI 218


>gi|62321126|dbj|BAD94241.1| Phosphoglycerate dehydrogenase - like protein [Arabidopsis
           thaliana]
          Length = 259

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 38/86 (44%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG+ILGE  +N+    +GR    +
Sbjct: 166 DGVPHLTKVGSFEVDVTLEGSIILCRQVDQPGMIGTVGSILGESNVNVNFMSVGRIAPRK 225

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  + +D       L+K+     +
Sbjct: 226 QAIMAIGVDDIPSKETLKKIGEIPAV 251


>gi|207092309|ref|ZP_03240096.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 524

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|308062332|gb|ADO04220.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Cuz20]
          Length = 524

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|261838390|gb|ACX98156.1| 3-phosphoglycerate dehydrogenase [Helicobacter pylori 51]
          Length = 524

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|15612049|ref|NP_223701.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori J99]
 gi|4155559|gb|AAD06553.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Helicobacter pylori J99]
          Length = 524

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|315586946|gb|ADU41327.1| possible phosphoglycerate dehydrogenase [Helicobacter pylori 35A]
          Length = 524

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|308183160|ref|YP_003927287.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori PeCan4]
 gi|308065345|gb|ADO07237.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori PeCan4]
          Length = 524

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|302671074|ref|YP_003831034.1| L-serine dehydratase beta subunit SdhB [Butyrivibrio
           proteoclasticus B316]
 gi|302395547|gb|ADL34452.1| L-serine dehydratase beta subunit SdhB [Butyrivibrio
           proteoclasticus B316]
          Length = 222

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 16/96 (16%), Positives = 40/96 (41%), Gaps = 2/96 (2%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNI--LGEYGINIAHFHLGRSQ 60
             G     +I  ++ + +     I +++ D  G++  V ++       +NI++FHL R +
Sbjct: 125 GGGNILVNQINGMHVEFNGDNNTILVMHEDKPGVIANVTHMMHFEHADLNISNFHLSRQE 184

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               AI  + ID      +++++     ++      
Sbjct: 185 KGGDAIMTIEIDNQPPEELVDEIRQIEHVKNAILIR 220


>gi|217032273|ref|ZP_03437770.1| hypothetical protein HPB128_142g21 [Helicobacter pylori B128]
 gi|298735944|ref|YP_003728469.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori B8]
 gi|216946039|gb|EEC24652.1| hypothetical protein HPB128_142g21 [Helicobacter pylori B128]
 gi|298355133|emb|CBI66005.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori B8]
          Length = 524

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|225871463|ref|YP_002747410.1| L-serine dehydratase, beta chain [Streptococcus equi subsp. equi
           4047]
 gi|225700867|emb|CAW95614.1| putative L-serine dehydratase, beta chain [Streptococcus equi
           subsp. equi 4047]
          Length = 223

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    + IV+ DI G++  V +IL    INIA   + R  + 
Sbjct: 130 GGGNIQVTELNGFSVSLSMNTPTLIIVHQDIPGMIAKVTDILSASDINIAQMTVTRESAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D       +++++    +  V
Sbjct: 190 EKAIMIIEVDSRDCQVAVKQIATIPNLHNV 219


>gi|188527838|ref|YP_001910525.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Shi470]
 gi|188144078|gb|ACD48495.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Shi470]
          Length = 524

 Score = 86.6 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|302524967|ref|ZP_07277309.1| phosphoglycerate dehydrogenase [Streptomyces sp. AA4]
 gi|302433862|gb|EFL05678.1| phosphoglycerate dehydrogenase [Streptomyces sp. AA4]
          Length = 532

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 1   VFSDGKP-RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           V    +  + ++I+  +FD+     ++ I   D  G++  VG +LGE GINI    + +S
Sbjct: 434 VTGKDEVEKIVEIKGRHFDLRAEGDVLVIEYPDRPGVMGRVGTLLGEAGINIEAAQISQS 493

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
                +I  L +D  +  +VLE +   V    ++  +FN
Sbjct: 494 TDGSDSIMLLRVDRHVDANVLEPIGATVGAHTIRAVDFN 532


>gi|75759264|ref|ZP_00739364.1| L-serine dehydratase beta subunit [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|74493270|gb|EAO56386.1| L-serine dehydratase beta subunit [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
          Length = 215

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 18/82 (21%), Positives = 37/82 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   +++   +  +      + IVN D  G +  V +IL  + INI+   + R +  
Sbjct: 127 GGGKIEVVELNGFDLQLSGTSPALLIVNNDRFGAIAAVASILATHEINISTMSVSRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLS 84
             A+  +  D  + + V+E++ 
Sbjct: 187 RRALMVIETDELLADEVIEEIK 208


>gi|317009666|gb|ADU80246.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori India7]
          Length = 524

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKSIPACLSVHYVVI 524


>gi|317180143|dbj|BAJ57929.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F32]
          Length = 524

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|299536791|ref|ZP_07050099.1| L-serine dehydratase, beta chain [Lysinibacillus fusiformis ZC1]
 gi|298727803|gb|EFI68370.1| L-serine dehydratase, beta chain [Lysinibacillus fusiformis ZC1]
          Length = 220

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +  G   I +V+ D  G +  V N L  + +NI H  + R +  
Sbjct: 126 GGGKIEVSEVNGFKLRLTGGMPAILVVHDDRAGCIANVANCLAMHEVNIGHMEVSRIERG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  + +D +I + VL+++S+   I  V +  
Sbjct: 186 LTALMVIEVDQNIEDKVLQQISLIPYITKVSKIN 219


>gi|94985433|ref|YP_604797.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Deinococcus geothermalis DSM 11300]
 gi|94555714|gb|ABF45628.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Deinococcus geothermalis DSM 11300]
          Length = 221

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 14/93 (15%), Positives = 34/93 (36%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++Q +  +       + +   D +G++  +   +   G+NIA     R    
Sbjct: 123 GGGVIQVTQVQGLGVNFSGASPTVLLRYTDAVGMIARIATTIAADGVNIAALTCTRETRG 182

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             A+  + +D  +    L  L+      +V+  
Sbjct: 183 GQALLAIELDAPLSAEALAFLNRWPDTNWVRLL 215


>gi|222629679|gb|EEE61811.1| hypothetical protein OsJ_16432 [Oryza sativa Japonica Group]
          Length = 544

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P   K+     DV +   +I     D  G++  VG++LGE  +N++   +GR    +
Sbjct: 451 DGIPHLTKVGSFQVDVSLEGSLILCRQVDQPGMIGAVGSVLGEENVNVSFMSVGRIAPRK 510

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
           HA+  + +D     S L K+     I
Sbjct: 511 HAVMAIGVDEEPKKSTLTKIGEIPAI 536


>gi|261839790|gb|ACX99555.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 52]
          Length = 524

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEDILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|257064328|ref|YP_003144000.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit/L-serine
           dehydratase, iron-sulfur-dependent, beta subunit
           [Slackia heliotrinireducens DSM 20476]
 gi|256791981|gb|ACV22651.1| L-serine dehydratase, iron-sulfur-dependent, alpha subunit/L-serine
           dehydratase, iron-sulfur-dependent, beta subunit
           [Slackia heliotrinireducens DSM 20476]
          Length = 552

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 41/97 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  ++  +D     + I   D  G++ ++ N L  +GINIA   + R +  
Sbjct: 133 GGGAAVITRINGVDVRLDGEYHSLVISQKDAKGVLAYIANCLNVFGINIATTRMYRKRKG 192

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           + A + +  D  I  +  E +  N  I   +  + ++
Sbjct: 193 DVAFTIMQTDDEIPEAAREAICCNPLIFDARIIKSDL 229


>gi|225388457|ref|ZP_03758181.1| hypothetical protein CLOSTASPAR_02193 [Clostridium asparagiforme
           DSM 15981]
 gi|225045486|gb|EEG55732.1| hypothetical protein CLOSTASPAR_02193 [Clostridium asparagiforme
           DSM 15981]
          Length = 253

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 40/94 (42%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     +I  ++  +      + +++ D  G +  V  +L + G+NI +F L R Q  
Sbjct: 158 GGGNILVREINGMDVSITGQHTTLIVLHRDAPGTIASVTEVLADAGVNICNFRLSREQKG 217

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  + IDGS    + +K+ V   I      +
Sbjct: 218 GQAVMTIEIDGSFGQELNDKVQVLPNIFSSTMLQ 251


>gi|325188027|emb|CCA22570.1| unnamed protein product [Albugo laibachii Nc14]
          Length = 641

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 42/99 (42%), Gaps = 3/99 (3%)

Query: 1   VFSDGKPRFIKIQEINF--DVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR 58
           VF + +PR ++I E N          ++   N D+ G+V  +   L    INIA+F L R
Sbjct: 544 VFGE-EPRIVRIDEYNNFPSFRPEGNLLLFRNQDLPGVVARILKELAISKINIANFGLAR 602

Query: 59  SQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             +   A+  L +D     + +  L     +  ++  + 
Sbjct: 603 QDNVPLALGILALDAPPSTTTMATLRDLKDVESLQMVQI 641


>gi|291484136|dbj|BAI85211.1| L-serine dehydratase beta chain [Bacillus subtilis subsp. natto
           BEST195]
          Length = 220

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 42/93 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      I +V+ D  G +  V N+L ++ IN+ H  + R    
Sbjct: 126 GGGKIEITELNGFELRLSGNHPAILVVHNDKFGTIAGVANVLAKFSINVGHMEVARKDIG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A+  + +D +I + +L++LS    I  V + 
Sbjct: 186 QLALMTIEVDQNIDDHILDELSKLPNIIQVTKI 218


>gi|303228896|ref|ZP_07315707.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Veillonella atypica ACS-134-V-Col7a]
 gi|303231195|ref|ZP_07317933.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Veillonella atypica ACS-049-V-Sch6]
 gi|302514102|gb|EFL56106.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Veillonella atypica ACS-049-V-Sch6]
 gi|302516422|gb|EFL58353.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Veillonella atypica ACS-134-V-Col7a]
          Length = 220

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 35/94 (37%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    ++   +  +      + + + D  G +  +   L E  INIA   + R    
Sbjct: 125 GGGQIMITEVDGNDMSITGDEFTLVVFHEDRPGAISLISQALSESDINIASMRVFRKGKY 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+  +  D  +    ++ +     I+ V  FE
Sbjct: 185 KDAVMVITTDSVVNPITVQFMRECPGIQDVMTFE 218


>gi|330466217|ref|YP_004403960.1| D-3-phosphoglycerate dehydrogenase [Verrucosispora maris AB-18-032]
 gi|328809188|gb|AEB43360.1| D-3-phosphoglycerate dehydrogenase [Verrucosispora maris AB-18-032]
          Length = 532

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 38/74 (51%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
            +  ++   + ++    +++ +  AD  G+V  VG +LGE GINIA   + R ++    +
Sbjct: 439 IKLTEVDGFDVEIGAEGILLFLRYADRPGVVGTVGTLLGEAGINIAAMQVARREAGGETL 498

Query: 67  SFLCIDGSILNSVL 80
             L +D ++   +L
Sbjct: 499 MTLTVDQALGADLL 512


>gi|16078648|ref|NP_389467.1| L-serine dehydratase beta chain [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221309460|ref|ZP_03591307.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313785|ref|ZP_03595590.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318709|ref|ZP_03600003.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322980|ref|ZP_03604274.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321315351|ref|YP_004207638.1| L-serine dehydratase subunit beta [Bacillus subtilis BSn5]
 gi|6094257|sp|O34635|SDHB_BACSU RecName: Full=Probable L-serine dehydratase, beta chain; Short=SDH;
           AltName: Full=L-serine deaminase; Short=L-SD
 gi|2337814|emb|CAA74258.1| putative YhaQ protein [Bacillus subtilis subsp. subtilis str. 168]
 gi|2633957|emb|CAB13458.1| L-serine dehydratase (beta chain) [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|320021625|gb|ADV96611.1| L-serine dehydratase (beta chain) [Bacillus subtilis BSn5]
          Length = 220

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 42/93 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      I +V+ D  G +  V N+L ++ IN+ H  + R    
Sbjct: 126 GGGKIEITELNGFELRLSGNHPAILVVHNDKFGTIAGVANVLAKFSINVGHMEVARKDIG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A+  + +D +I + +L++LS    I  V + 
Sbjct: 186 QLALMTIEVDQNIDDHILDELSKLPNIIQVTKI 218


>gi|126649659|ref|ZP_01721895.1| L-serine dehydratase beta subunit [Bacillus sp. B14905]
 gi|126593378|gb|EAZ87323.1| L-serine dehydratase beta subunit [Bacillus sp. B14905]
          Length = 220

 Score = 86.2 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 42/94 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +  G   I +V+ D  G +  V N L  + +NI H  + R +  
Sbjct: 126 GGGKIEVSEVNGFKLRLTGGMPAILVVHDDRAGCIANVANCLAMHEVNIGHMEVSRIERG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A+  + +D +I + VL+++S+   I  V +  
Sbjct: 186 LTALMVIEVDQNIEDKVLQQISLIPYITKVSKIN 219


>gi|323703732|ref|ZP_08115372.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Desulfotomaculum nigrificans DSM 574]
 gi|323531320|gb|EGB21219.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Desulfotomaculum nigrificans DSM 574]
          Length = 220

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 33/94 (35%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    +I+     +      + + + D  G +  V  +L    INI H  + R    
Sbjct: 126 GGGKITITEIEGFKISLSGESPTLLVFHRDRFGAIAAVAKVLANNEINIGHMEVARKSKG 185

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+  +  D  +   ++ ++     +  V    
Sbjct: 186 DLALMVIETDQDLSVDIIGEVEQIDLVYKVALIN 219


>gi|282849852|ref|ZP_06259236.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Veillonella parvula ATCC 17745]
 gi|282580789|gb|EFB86188.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Veillonella parvula ATCC 17745]
          Length = 229

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 18/94 (19%), Positives = 36/94 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    ++   +  +      + + + D  G +  V   L E  INIA  H+ R    
Sbjct: 134 GGGQIMITEVDGNDMSITGDEFTLVVFHEDRPGAISLVSQALSESDINIATMHVFRKGKH 193

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+  +  D  +    ++ +     I+ V  FE
Sbjct: 194 KDAVMVITTDTVVNPITVQFMREFPGIQDVMTFE 227


>gi|150019310|ref|YP_001311564.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium beijerinckii NCIMB 8052]
 gi|149905775|gb|ABR36608.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium beijerinckii NCIMB 8052]
          Length = 226

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 37/94 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  + +++     D       + I + D  G++  V +IL    IN+A   + R Q  
Sbjct: 127 GGGNIQVVEVNNNKVDFTGIYETLIIAHKDAPGVINSVTSILYSENINVAFMRVFRQQKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             AI    +D  + N ++EK+     +  V    
Sbjct: 187 HEAIMIFEMDNKVNNILIEKIKEIELVHNVISIS 220


>gi|319761665|ref|YP_004125602.1| d-isomer specific 2-hydroxyacid dehydrogenase nad-binding protein
           [Alicycliphilus denitrificans BC]
 gi|330823536|ref|YP_004386839.1| phosphoglycerate dehydrogenase [Alicycliphilus denitrificans K601]
 gi|317116226|gb|ADU98714.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Alicycliphilus denitrificans BC]
 gi|329308908|gb|AEB83323.1| Phosphoglycerate dehydrogenase [Alicycliphilus denitrificans K601]
          Length = 409

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 38/86 (44%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ ++ G++  + +IL +  INIA  +L  +++  +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHRNVPGVLSQINSILSDNQINIAGQYLQTNEAVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +  LEKL+        +  
Sbjct: 383 DLDARSSDLALEKLAQVPGTIRSRVL 408


>gi|260654330|ref|ZP_05859820.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Jonquetella anthropi E3_33 E1]
 gi|260630963|gb|EEX49157.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Jonquetella anthropi E3_33 E1]
          Length = 225

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 33/83 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      I   +  +D     + + + D  GI+  + + +   GINIA   L R    
Sbjct: 123 GGGMVLLTSINGFDVAIDGMSTTLVVPHRDQPGIISALSSEMTHRGINIASMRLSRKFRG 182

Query: 63  EHAISFLCIDGSILNSVLEKLSV 85
           + A++ + +D  +   + + L  
Sbjct: 183 DQAVAVMEVDSPVDEPLRKVLEA 205


>gi|238018592|ref|ZP_04599018.1| hypothetical protein VEIDISOL_00422 [Veillonella dispar ATCC 17748]
 gi|237865063|gb|EEP66353.1| hypothetical protein VEIDISOL_00422 [Veillonella dispar ATCC 17748]
          Length = 220

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 35/94 (37%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    ++   +  +      + + + D  G +  V   L E  INIA   + R    
Sbjct: 125 GGGQIMITEVDGNDMSITGDEFTLVVFHEDRPGAISLVSQALSESDINIATMRVFRKGKH 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+  +  D  +    ++ +     I+ V  FE
Sbjct: 185 KDAVMVITTDTVVNPITVQFMRECPGIQDVMTFE 218


>gi|302780109|ref|XP_002971829.1| hypothetical protein SELMODRAFT_412481 [Selaginella moellendorffii]
 gi|300160128|gb|EFJ26746.1| hypothetical protein SELMODRAFT_412481 [Selaginella moellendorffii]
          Length = 625

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 40/86 (46%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG     ++ + + DV +   +I     D  GI+  VG +LG+  +N++   +GR+   +
Sbjct: 532 DGLAHLSQVGQFSMDVSLEGSVILCKQVDQPGIIGKVGGLLGDGNVNVSFMSVGRTSPRK 591

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            A+  + +D      VL ++     +
Sbjct: 592 QAVMAIGVDEEPSKEVLHRIGAIPAV 617


>gi|325570752|ref|ZP_08146478.1| L-serine ammonia-lyase beta subunit [Enterococcus casseliflavus
           ATCC 12755]
 gi|325156598|gb|EGC68778.1| L-serine ammonia-lyase beta subunit [Enterococcus casseliflavus
           ATCC 12755]
          Length = 221

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 38/90 (42%), Gaps = 1/90 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G     IV+ D+ G++  V N+L E  INI    + R    
Sbjct: 129 GGGNIQISELNGFKISLTLGTPTYVIVHQDVPGMIAKVTNLLSEAQINIGTMTVTREAVG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + AI  + +D    + + +++ V   +   
Sbjct: 189 DKAIMIIEVDQR-NDQLAQQIKVLPHVYSA 217


>gi|145593787|ref|YP_001158084.1| D-3-phosphoglycerate dehydrogenase [Salinispora tropica CNB-440]
 gi|145303124|gb|ABP53706.1| D-3-phosphoglycerate dehydrogenase [Salinispora tropica CNB-440]
          Length = 531

 Score = 85.9 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 43/85 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           +  ++   + ++    +++ +  AD  G+V  VG +LGE G+NIA   + R ++    + 
Sbjct: 439 KLTEVDGFDVEIGAEGILVFLRYADRPGVVGAVGTLLGEAGVNIAAMQVARREAGGETLM 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFV 92
            L +D ++   +L  ++ +V    V
Sbjct: 499 TLTVDQALGADLLTSVADSVGATSV 523


>gi|313893040|ref|ZP_07826617.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Veillonella sp. oral taxon 158 str. F0412]
 gi|313442393|gb|EFR60808.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Veillonella sp. oral taxon 158 str. F0412]
          Length = 220

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 34/94 (36%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++   +  +      + + + D  G +  +   L E  INIA   + R    
Sbjct: 125 GGGLIMITEVDGNDMSITGDEFTLVVFHEDRPGAISLISQALSESDINIATMRVFRKGKH 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+  +  D  +    ++ +     I+ V  FE
Sbjct: 185 KDAVMVITTDSVVNPITVQFMRECPGIQDVMTFE 218


>gi|227873626|ref|ZP_03991864.1| L-serine ammonia-lyase [Oribacterium sinus F0268]
 gi|227840544|gb|EEJ50936.1| L-serine ammonia-lyase [Oribacterium sinus F0268]
          Length = 222

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 37/96 (38%), Gaps = 2/96 (2%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEY--GINIAHFHLGRSQ 60
             G  R   I  +  D       I +++ D  G++  V  I+ +    +NI +F L R +
Sbjct: 125 GGGNIRVDVINGLRVDFTGESNTILVLHRDKPGMIALVTQIMYDKYKDLNIGNFRLSRPE 184

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               A+  + ID      ++++++    +       
Sbjct: 185 KGGIALMTIEIDQMPPEELMDEINKLPNVENALLIR 220


>gi|238063230|ref|ZP_04607939.1| D-3-phosphoglycerate dehydrogenase [Micromonospora sp. ATCC 39149]
 gi|237885041|gb|EEP73869.1| D-3-phosphoglycerate dehydrogenase [Micromonospora sp. ATCC 39149]
          Length = 532

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 17/85 (20%), Positives = 40/85 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           +  ++   + ++    +++ +   D  G+V  VG +LGE GINIA   + R ++    + 
Sbjct: 440 KLTEVDGFDVEIGAEGILLFLRYVDRPGVVGTVGTLLGEAGINIAAMQVARREAGGETLM 499

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFV 92
            L +D ++   +L   + ++     
Sbjct: 500 TLTVDQALGADLLTSAADSIGATSA 524


>gi|294794518|ref|ZP_06759654.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Veillonella sp. 3_1_44]
 gi|294454848|gb|EFG23221.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Veillonella sp. 3_1_44]
          Length = 229

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 35/94 (37%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    ++   +  +      + + + D  G +  V   L E  INIA   + R    
Sbjct: 134 GGGQIMITEVDGNDMSITGDEFTLVVFHEDRPGAISLVSQALSESDINIATMRVFRKGKH 193

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+  +  D  +    ++ +     I+ V  FE
Sbjct: 194 KDAVMVITTDTVVNPITVQFMREFPGIQDVMTFE 227


>gi|257867887|ref|ZP_05647540.1| L-serine dehydratase [Enterococcus casseliflavus EC30]
 gi|257874216|ref|ZP_05653869.1| L-serine dehydratase [Enterococcus casseliflavus EC10]
 gi|257876781|ref|ZP_05656434.1| L-serine dehydratase [Enterococcus casseliflavus EC20]
 gi|257801970|gb|EEV30873.1| L-serine dehydratase [Enterococcus casseliflavus EC30]
 gi|257808380|gb|EEV37202.1| L-serine dehydratase [Enterococcus casseliflavus EC10]
 gi|257810947|gb|EEV39767.1| L-serine dehydratase [Enterococcus casseliflavus EC20]
          Length = 221

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 38/90 (42%), Gaps = 1/90 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++      + +G     IV+ D+ G++  V N+L E  INI    + R    
Sbjct: 129 GGGNIQISELNGFKISLTLGTPTYVIVHQDVPGMIAKVTNLLSEAQINIGTMTVTREAVG 188

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + AI  + +D    + + +++ V   +   
Sbjct: 189 DKAIMIIEVDQR-NDQLAQQIKVLPHVYSA 217


>gi|257054946|ref|YP_003132778.1| D-3-phosphoglycerate dehydrogenase [Saccharomonospora viridis DSM
           43017]
 gi|256584818|gb|ACU95951.1| D-3-phosphoglycerate dehydrogenase [Saccharomonospora viridis DSM
           43017]
          Length = 531

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 23/99 (23%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 1   VFSDGKP-RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           V       + I++   +FD+     M+ +   D  GI+  VG +LGE GINI    + ++
Sbjct: 433 VTGKDDVHKLIEVNGRHFDIRAEGHMLLLEYPDRPGIMGRVGTLLGEAGINIEAAQISQT 492

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            +   A+  L +D ++   +L+ +   V  + ++   F+
Sbjct: 493 TNRADAVMLLRVDRAVNAHMLDPIGATVDAKMIRAVNFD 531


>gi|302542286|ref|ZP_07294628.1| phosphoglycerate dehydrogenase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302459904|gb|EFL22997.1| phosphoglycerate dehydrogenase [Streptomyces himastatinicus ATCC
           53653]
          Length = 533

 Score = 85.5 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
               + + + E + D+ +   M  +   D  G+V  +G ILGE GINIA   + R+    
Sbjct: 439 KNLQKIVAVGEYDVDLALADHMAFLRYTDRPGVVGTLGRILGEAGINIAGMQVSRAAVGG 498

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D +I  SVL +++  +     +    
Sbjct: 499 AALVALTVDDTIPQSVLTEIAEEIGATSARSVNL 532


>gi|269798579|ref|YP_003312479.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Veillonella parvula DSM 2008]
 gi|269095208|gb|ACZ25199.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Veillonella parvula DSM 2008]
          Length = 229

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 35/94 (37%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+    ++   +  +      + + + D  G +  V   L E  INIA   + R    
Sbjct: 134 GGGQIMITEVDGNDMSITGDEFTLVVFHEDRPGAISLVSQALSESDINIATMRVFRKGKH 193

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + A+  +  D  +    ++ +     I+ V  FE
Sbjct: 194 KDAVMVITTDTVVNPITVQFMRECPGIQDVMTFE 227


>gi|258645797|ref|ZP_05733266.1| phosphoglycerate dehydrogenase [Dialister invisus DSM 15470]
 gi|260403167|gb|EEW96714.1| phosphoglycerate dehydrogenase [Dialister invisus DSM 15470]
          Length = 530

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 41/96 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F   + + + +     D +    +I   + +  G++  +  ILG+ G+NI    +G S+
Sbjct: 431 LFDRKEAKIVSLDHFRVDFEPKGCIILAPHENKPGMIGQMSGILGKAGVNINGMQVGASK 490

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
                I  + ID  I +++L  L+    I  +    
Sbjct: 491 DKNTNIMAVAIDKDIPSAILPVLANIDGIHGITVIH 526


>gi|307720842|ref|YP_003891982.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas autotrophica DSM
           16294]
 gi|306978935|gb|ADN08970.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas autotrophica DSM
           16294]
          Length = 528

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 47/94 (50%), Gaps = 1/94 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           +F DG  R +     + +  +   +I   N+D+ G++  VG IL    +NI+ F L R++
Sbjct: 433 IFEDGLQRIVATDGFDIEFPVKGDIIFFKNSDVPGVIGSVGTILANNNVNISDFSLARNE 492

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQ 94
            +  A++ + +D ++ ++ L +L+       V  
Sbjct: 493 QS-EALAVILVDNAVNDTTLSELASLDACISVNY 525


>gi|255019203|ref|ZP_05291329.1| hypothetical protein LmonF_18231 [Listeria monocytogenes FSL
           F2-515]
          Length = 177

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 36/80 (45%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK   I++ E   +       I I++ D  G +  V +++ ++ INI    + R    
Sbjct: 97  GGGKVEIIRLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKG 156

Query: 63  EHAISFLCIDGSILNSVLEK 82
           + A+  + +D  +  +++ K
Sbjct: 157 DEALMVIEVDQQVEQALIAK 176


>gi|124486358|ref|YP_001030974.1| D-3-phosphoglycerate dehydrogenase [Methanocorpusculum labreanum Z]
 gi|124363899|gb|ABN07707.1| D-3-phosphoglycerate dehydrogenase [Methanocorpusculum labreanum Z]
          Length = 527

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 42/91 (46%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           PR + I +   D+     +I   + +  G+V  VG ILG++ +NI+   +G       ++
Sbjct: 437 PRILSIGKYATDLVPSGYVILADHVNRPGVVGPVGMILGKHNVNISSMQVGGRNVGSESL 496

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             L +D  +   V+++++ +  I   K    
Sbjct: 497 MILAVDDIVSPEVMQEVASSDGITAAKFVRL 527


>gi|182419137|ref|ZP_02950391.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium butyricum 5521]
 gi|237669226|ref|ZP_04529208.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182377092|gb|EDT74662.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium butyricum 5521]
 gi|237655113|gb|EEP52671.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 226

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 35/94 (37%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++ +   D       + + + D+ G++  + +IL    IN+A   + R +  
Sbjct: 127 GGGNIKICEVNDNEVDFTGMYETLIVQHKDVPGVIHSITHILYSENINVAFMRVFRDRKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E A     +D  +     +K+     +  V    
Sbjct: 187 EDATMIFEMDNKVSIETRKKIESLELVYKVISIS 220


>gi|291458214|ref|ZP_06597604.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291418747|gb|EFE92466.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 240

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 37/96 (38%), Gaps = 2/96 (2%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEY--GINIAHFHLGRSQ 60
             G  R   +  +  D       I +++ D  G++  V N++ E    INI +F L R +
Sbjct: 143 GGGNIRVDFVNGLRVDFTGENNTILVLHRDRPGLIASVTNLIYEEYRDINIGNFRLSRRE 202

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
               A+  + ID    + ++E +     +       
Sbjct: 203 RGGLALMTIEIDQVPPDQMVEAIQNLRDVEKALLIR 238


>gi|149183208|ref|ZP_01861654.1| L-serine dehydratase (beta chain) [Bacillus sp. SG-1]
 gi|148849073|gb|EDL63277.1| L-serine dehydratase (beta chain) [Bacillus sp. SG-1]
          Length = 221

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 39/94 (41%), Gaps = 1/94 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    ++      +      I +V+ D  G +  V  +L  + INI H  + R +  
Sbjct: 126 GGGKIEVTELNGFELKLTGHHPAILVVHEDRFGAIAAVSQVLANHEINIGHMDVSRKEVG 185

Query: 63  EHAISFLCIDG-SILNSVLEKLSVNVTIRFVKQF 95
           + A+  + ID  +I + V+++L     +  V   
Sbjct: 186 KMALMTIEIDQNNIDDKVIDELKALANVTQVTMI 219


>gi|78189340|ref|YP_379678.1| D-3-phosphoglycerate dehydrogenase [Chlorobium chlorochromatii
           CaD3]
 gi|78171539|gb|ABB28635.1| D-3-phosphoglycerate dehydrogenase [Chlorobium chlorochromatii
           CaD3]
          Length = 538

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 39/97 (40%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF + + R + + +   +      ++   N D   ++  V  +L  +   +A+  L    
Sbjct: 442 VFGEKEVRIVMVDQFLLEFKPEGSILLYTNNDQPDVIARVTQLLLAHHCAMAYLALSLDD 501

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
               A+S L ++G + N +LE +     +  +   E 
Sbjct: 502 LHNSAMSALVVNGKVTNDLLEAIKQLEGVTSLSLLEL 538


>gi|208434953|ref|YP_002266619.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori G27]
 gi|208432882|gb|ACI27753.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori G27]
          Length = 524

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEYILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|134102592|ref|YP_001108253.1| D-3-phosphoglycerate dehydrogenase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|291004723|ref|ZP_06562696.1| D-3-phosphoglycerate dehydrogenase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|133915215|emb|CAM05328.1| D-3-phosphoglycerate dehydrogenase (PgdH) [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 531

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 43/91 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + +++   +FD+     ++ +   D  G++  VG +LGE G+NI    + ++     A+ 
Sbjct: 441 KIVEVNGRHFDLRAEGNVLLLEYPDRPGVMGKVGTLLGEVGVNIEAATVSQTTERSDAVM 500

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D  +   VLE +   V  R V+   F 
Sbjct: 501 LLRVDRPVDAGVLEPIGAAVGARVVRAVTFE 531


>gi|126643167|ref|YP_001086151.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii ATCC
           17978]
          Length = 315

 Score = 85.1 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 34/86 (39%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ ++ G++  + N+  E GINI+   L      +     +
Sbjct: 231 VNFPEIALPLTAGQHRLLHIHKNVPGVLSKINNLFAEQGINISGQSLMT--KGDIGYLVM 288

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D S     L+ L        V+  
Sbjct: 289 DVDASASQEALDMLHEVEGTIRVRVL 314


>gi|88856753|ref|ZP_01131408.1| D-3-phosphoglycerate dehydrogenase [marine actinobacterium
           PHSC20C1]
 gi|88814050|gb|EAR23917.1| D-3-phosphoglycerate dehydrogenase [marine actinobacterium
           PHSC20C1]
          Length = 530

 Score = 84.7 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 41/90 (45%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   + +V +   +I ++  D  GIV   G   G+  INIA   + R     +A+S
Sbjct: 438 KIVEINGYDIEVPLADHLIVMMYEDRTGIVAVFGKEFGDAEINIAGMQIARESEGGNALS 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D      VL  ++  +  R+V   + 
Sbjct: 498 VLTVDSQASAEVLATVAERIDARYVHAIDI 527


>gi|308063839|gb|ADO05726.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Sat464]
          Length = 524

 Score = 84.7 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VF +   +  +I   + D++    M+   N DI G++  VGN    +GINIA F LGR+ 
Sbjct: 429 VFEEYILKLTEIDGFHIDIEPKGKMLLFRNTDIPGVIGSVGNAFARHGINIADFRLGRNT 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + A++ + +D  +   VLE+L        V     
Sbjct: 489 Q-KEALALIIVDEEVSLEVLEELKNIPACLSVHYVVI 524


>gi|255568067|ref|XP_002525010.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223535718|gb|EEF37382.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 633

 Score = 84.7 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 38/85 (44%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P   ++     DV +   +I     D  G++  VGNILGE+ +N++   +GR+     
Sbjct: 541 GIPHLTRVGSFAVDVSLEGNLILCRQVDQPGMIGRVGNILGEHNVNVSFMSVGRTVRRNQ 600

Query: 65  AISFLCIDGSILNSVLEKLSVNVTI 89
           AI  + +D       L K+     I
Sbjct: 601 AIMAIGVDEEPQGQALVKIGEVSAI 625


>gi|260549913|ref|ZP_05824129.1| phosphoglycerate dehydrogenase [Acinetobacter sp. RUH2624]
 gi|260407163|gb|EEX00640.1| phosphoglycerate dehydrogenase [Acinetobacter sp. RUH2624]
          Length = 410

 Score = 84.7 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 34/86 (39%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ ++ G++  + N+  E GINI+   L      +     +
Sbjct: 326 VNFPEIALPLTAGQHRLLHIHKNVPGVLSKINNLFAEQGINISGQSLMT--KGDIGYLIM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D S     L+ L        V+  
Sbjct: 384 DVDASASQEALDTLHEVEGTIRVRVL 409


>gi|169794522|ref|YP_001712315.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii AYE]
 gi|184159670|ref|YP_001848009.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii ACICU]
 gi|213158906|ref|YP_002320904.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii AB0057]
 gi|215482110|ref|YP_002324292.1| D-3-phosphoglycerate dehydrogenase(PGDH) [Acinetobacter baumannii
           AB307-0294]
 gi|239501925|ref|ZP_04661235.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii AB900]
 gi|260556956|ref|ZP_05829173.1| phosphoglycerate dehydrogenase [Acinetobacter baumannii ATCC 19606]
 gi|294837958|ref|ZP_06782641.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter sp. 6013113]
 gi|294843286|ref|ZP_06787969.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter sp. 6014059]
 gi|294858700|ref|ZP_06796469.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter sp. 6013150]
 gi|301344857|ref|ZP_07225598.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii AB056]
 gi|301512319|ref|ZP_07237556.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii AB058]
 gi|301594826|ref|ZP_07239834.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii AB059]
 gi|169147449|emb|CAM85310.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii AYE]
 gi|183211264|gb|ACC58662.1| Phosphoglycerate dehydrogenase [Acinetobacter baumannii ACICU]
 gi|193078532|gb|ABO13549.2| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii ATCC
           17978]
 gi|213058066|gb|ACJ42968.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii AB0057]
 gi|213988009|gb|ACJ58308.1| D-3-phosphoglycerate dehydrogenase(PGDH) [Acinetobacter baumannii
           AB307-0294]
 gi|260409562|gb|EEX02863.1| phosphoglycerate dehydrogenase [Acinetobacter baumannii ATCC 19606]
 gi|322509581|gb|ADX05035.1| serA [Acinetobacter baumannii 1656-2]
 gi|323519601|gb|ADX93982.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 410

 Score = 84.7 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 34/86 (39%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ ++ G++  + N+  E GINI+   L      +     +
Sbjct: 326 VNFPEIALPLTAGQHRLLHIHKNVPGVLSKINNLFAEQGINISGQSLMT--KGDIGYLVM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D S     L+ L        V+  
Sbjct: 384 DVDASASQEALDMLHEVEGTIRVRVL 409


>gi|289450401|ref|YP_003474901.1| L-serine dehydratase subunit beta [Clostridiales genomosp. BVAB3
           str. UPII9-5]
 gi|289184948|gb|ADC91373.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridiales genomosp. BVAB3 str. UPII9-5]
          Length = 231

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 36/94 (38%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G+     I  ++ ++      + + + D  G +  +   L +  INIA   L R    
Sbjct: 134 GGGQAVITAINGVDIELSGQYDSLMVQHLDRPGALAKITAHLSKQRINIAALKLYRESKG 193

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            +A + +  D  I   +++ ++ +  +  V    
Sbjct: 194 LNAFAIIEADERIPREIVDTIAADKGVIKVILIR 227


>gi|312199422|ref|YP_004019483.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Frankia sp. EuI1c]
 gi|311230758|gb|ADP83613.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Frankia sp. EuI1c]
          Length = 398

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 39/94 (41%), Gaps = 2/94 (2%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F  G    + +  ++     G   I  ++ ++ G++  + ++L E+ +NI    L     
Sbjct: 306 FDGGTAMSVNLPYLSLPPRPGGHRIAHLHRNVPGVLAKINSLLAEHKVNIDGQLLDTRGD 365

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             + ++ + +D     +VL+ L+       V+  
Sbjct: 366 YGYVLTDIGVD--YPAAVLDSLAAMPETVRVRLL 397


>gi|124003348|ref|ZP_01688198.1| L-serine dehydratase, beta chain [Microscilla marina ATCC 23134]
 gi|123991446|gb|EAY30877.1| L-serine dehydratase, beta chain [Microscilla marina ATCC 23134]
          Length = 224

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 32/93 (34%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G            D       + I   DI G + F+  +L + G NIA  ++ R    
Sbjct: 128 GGGVINIANYNGFRADFSASMNTLVIKAQDIKGSIAFIAQVLAQDGCNIAAMNVSRKGKN 187

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           + A  F+ ID  +    LE L     I  V   
Sbjct: 188 DMACQFIEIDSEVAPITLEYLQHLEWIHDVIYI 220


>gi|298252299|ref|ZP_06976102.1| D-3-phosphoglycerate dehydrogenase [Ktedonobacter racemifer DSM
           44963]
 gi|297546891|gb|EFH80759.1| D-3-phosphoglycerate dehydrogenase [Ktedonobacter racemifer DSM
           44963]
          Length = 575

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 41/103 (39%), Gaps = 10/103 (9%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST-- 62
            +PR +++     +      ++   N D  G++   G +LG+  +NI H  +G  +    
Sbjct: 473 DEPRIVRVGRYWTEFVPEGYILFCRNLDQPGMIGRAGTLLGKAQVNIRHMDVGPVERKPR 532

Query: 63  --------EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                   + A+  + +D +I +  L +LS    I  V     
Sbjct: 533 TRVPGNTTDTALMVISVDDAIPDWALRELSETGDIFGVTVVNL 575


>gi|325123680|gb|ADY83203.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 410

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 34/86 (39%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ ++ G++  + N+  E GINI+   L      +     +
Sbjct: 326 VNFPEIALPLTAGQHRLLHIHKNVPGVLSKINNLFAEQGINISGQSLMT--KGDIGYLVM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D S     L+ L        V+  
Sbjct: 384 DVDASASQEALDMLHEVEGTIRVRVL 409


>gi|169632282|ref|YP_001706018.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii SDF]
 gi|169151074|emb|CAO99732.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter baumannii]
          Length = 410

 Score = 84.7 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 34/86 (39%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ ++ G++  + N+  E GINI+   L      +     +
Sbjct: 326 VNFPEIALPLTAGQHRLLHIHKNVPGVLSKINNLFAEQGINISGQSLMT--KGDIGYLVM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D S     L+ L        V+  
Sbjct: 384 DVDASASQEALDMLHEVEGTIRVRVL 409


>gi|153953336|ref|YP_001394101.1| hypothetical protein CKL_0700 [Clostridium kluyveri DSM 555]
 gi|219853965|ref|YP_002471087.1| hypothetical protein CKR_0622 [Clostridium kluyveri NBRC 12016]
 gi|146346217|gb|EDK32753.1| SdhB [Clostridium kluyveri DSM 555]
 gi|219567689|dbj|BAH05673.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 227

 Score = 84.3 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 38/95 (40%), Gaps = 1/95 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ-S 61
             G     ++ +   +       I I + D+ G+V  V  +L E+ INIA   + R    
Sbjct: 127 GGGNVVINEVDKDKIEFTGVYPTILINHLDMPGMVARVSEVLYEHEINIAFMKVYRKSIK 186

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              A+    +D  I+  V++++     I  V+   
Sbjct: 187 GSRAVMVFEVDDFIIKDVVDEIENIPNIYKVRAIN 221


>gi|325833264|ref|ZP_08165770.1| phosphoglycerate dehydrogenase [Eggerthella sp. HGA1]
 gi|325485646|gb|EGC88114.1| phosphoglycerate dehydrogenase [Eggerthella sp. HGA1]
          Length = 530

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 21/79 (26%), Positives = 36/79 (45%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
            R + +     D+      +     D  G V  +G ILGE GINI    +G   + + A+
Sbjct: 439 ARLVSLFGYQLDIAPAGQSLVFEYVDAPGRVGAIGTILGEAGINITTMQIGTKPAEQCAL 498

Query: 67  SFLCIDGSILNSVLEKLSV 85
            ++ ++G + + VL KL  
Sbjct: 499 VYMNVEGDVDDDVLSKLRA 517


>gi|297156963|gb|ADI06675.1| D-3-phosphoglycerate dehydrogenase [Streptomyces bingchenggensis
           BCW-1]
          Length = 534

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 43/94 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
             + + + + + + D+ +   M  +   D  G+V  +G ILGE  INIA   + RS +  
Sbjct: 439 KNQQKIVAVGDYDVDLALADHMAFLRYTDRPGVVGTLGRILGEAEINIAGMQVSRSAAGG 498

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            A+  L +D +I   VL +++  +     +    
Sbjct: 499 AALVALTVDDTIPQPVLTEIAEEIGASSARSVNL 532


>gi|118471239|ref|YP_886720.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium smegmatis str.
           MC2 155]
 gi|118172526|gb|ABK73422.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium smegmatis str.
           MC2 155]
          Length = 528

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 36/78 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   NFD+      + +  +D  G +  +G +LG   +NI    L +  S +HA  
Sbjct: 438 KIVQINGRNFDLRAEGHNLIVNYSDKPGALGKIGTLLGGANVNILAAQLSQDASGDHATV 497

Query: 68  FLCIDGSILNSVLEKLSV 85
            L +D  + + V   ++ 
Sbjct: 498 MLRVDTDVPDDVRAAIAD 515


>gi|309389446|gb|ADO77326.1| L-serine ammonia-lyase [Halanaerobium praevalens DSM 2228]
          Length = 223

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 17/94 (18%), Positives = 37/94 (39%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++      +      +   ++D  G++  +  IL  Y +NIA   + R +  
Sbjct: 127 GGGNIIVSELNGTEVKLKGEYYTLITFHSDKPGLIAKISEILQIYNLNIAEMEVLRKEKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
             A + + +D  +   +L+ LS    I  +K  +
Sbjct: 187 SQATAIINLDQKVEKHILKLLSDIPGINNIKLVK 220


>gi|134299115|ref|YP_001112611.1| L-serine dehydratase, iron-sulfur-dependent subunit beta
           [Desulfotomaculum reducens MI-1]
 gi|134051815|gb|ABO49786.1| L-serine ammonia-lyase [Desulfotomaculum reducens MI-1]
          Length = 221

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 31/85 (36%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             GK    +I+     +      + + + D  G +  V  +L    INI H  + R    
Sbjct: 127 GGGKITITEIEGFKISLSGDSPTLLVFHHDRFGAIAKVAQVLACNEINIGHMEVARRSRG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNV 87
           + A+  +  D  + N  ++ +    
Sbjct: 187 DQALMVIETDQDLTNETIKAVKRID 211


>gi|255320181|ref|ZP_05361366.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter radioresistens
           SK82]
 gi|262380399|ref|ZP_06073553.1| phosphoglycerate dehydrogenase [Acinetobacter radioresistens SH164]
 gi|255302620|gb|EET81852.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter radioresistens
           SK82]
 gi|262297845|gb|EEY85760.1| phosphoglycerate dehydrogenase [Acinetobacter radioresistens SH164]
          Length = 410

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ ++ G++  +  +  E+ INI+   L      +     +
Sbjct: 326 VNFPEIALPLTEGKHRLLHIHKNMPGVLSKINTLFAEHNINISGQSLMT--KGDVGYLVM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D S     L+ L        V+  
Sbjct: 384 DVDASASQEALDTLHQVEGTIRVRVL 409


>gi|241765438|ref|ZP_04763407.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Acidovorax delafieldii 2AN]
 gi|241364811|gb|EER59789.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Acidovorax delafieldii 2AN]
          Length = 436

 Score = 84.3 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 36/86 (41%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ ++ G++  +  I  E  INIA  +L  ++   +    +
Sbjct: 352 VNFPEVALPAHPGKHRLLHIHRNVPGVLSEINRIFSENHINIAAQYLQTNEKIGYV--VI 409

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            ID +  +  L+KL+        +  
Sbjct: 410 DIDAASSDLALDKLAHVPGTLRSRVL 435


>gi|307326525|ref|ZP_07605720.1| D-3-phosphoglycerate dehydrogenase [Streptomyces violaceusniger Tu
           4113]
 gi|306887933|gb|EFN18924.1| D-3-phosphoglycerate dehydrogenase [Streptomyces violaceusniger Tu
           4113]
          Length = 533

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 44/92 (47%)

Query: 6   KPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           + + + + E + D+ +   M  +   D  G+V  +G ILGE GINIA   + R+ +   A
Sbjct: 441 QQKIVAVGEYDVDLALADHMAFLRYTDRPGVVGTLGRILGEAGINIAGMQVSRAAAGGAA 500

Query: 66  ISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
           +  L +D +I   VL +++  +     +    
Sbjct: 501 LVALTVDDTIPQPVLTEIAEEIGASSARSVNL 532


>gi|294651720|ref|ZP_06729021.1| phosphoglycerate dehydrogenase [Acinetobacter haemolyticus ATCC
           19194]
 gi|292822386|gb|EFF81288.1| phosphoglycerate dehydrogenase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 410

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ ++ G++  +  +  E GINI+   L      +     +
Sbjct: 326 VNFPEIALPLSDGQHRLLHIHKNVPGVLSKINTLFAEQGINISGQSLMT--KGDIGYLVM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D S     L+ L        V+  
Sbjct: 384 DVDASASQEALDTLHNVEGTIRVRVL 409


>gi|226953795|ref|ZP_03824259.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter sp. ATCC 27244]
 gi|226835466|gb|EEH67849.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter sp. ATCC 27244]
          Length = 410

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ ++ G++  +  +  E GINI+   L      +     +
Sbjct: 326 VNFPEIALPLSDGQHRLLHIHKNVPGVLSKINTLFAEQGINISGQSLMT--KGDIGYLVM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D S     L+ L        V+  
Sbjct: 384 DVDASASQEALDTLHNVEGTIRVRVL 409


>gi|218679036|ref|ZP_03526933.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli CIAT 894]
          Length = 231

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 34/62 (54%), Positives = 45/62 (72%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFI+I+ IN D D+G  MI I N D+ G++ F+G  LG  G+NIA+F LGR +
Sbjct: 156 VFSDGKPRFIQIKGINLDADVGSHMIYITNTDVPGMIGFIGTTLGTAGVNIANFQLGRDK 215

Query: 61  ST 62
           + 
Sbjct: 216 AG 217


>gi|262373589|ref|ZP_06066867.1| phosphoglycerate dehydrogenase [Acinetobacter junii SH205]
 gi|262311342|gb|EEY92428.1| phosphoglycerate dehydrogenase [Acinetobacter junii SH205]
          Length = 410

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ ++ G++  +  +  E GINI+   L      +     +
Sbjct: 326 VNFPEIALPLSDGQHRLLHIHKNVPGVLSKINTLFAEQGINISGQSLMT--KGDIGYLVM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D S     L+ L        V+  
Sbjct: 384 DVDASASQEALDTLHNVEGTIRVRVL 409


>gi|300783616|ref|YP_003763907.1| D-3-phosphoglycerate dehydrogenase [Amycolatopsis mediterranei U32]
 gi|299793130|gb|ADJ43505.1| D-3-phosphoglycerate dehydrogenase [Amycolatopsis mediterranei U32]
          Length = 532

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 44/91 (48%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + +++    FD+     ++ +   D  G++  VG +LGE GINI    + ++     A+ 
Sbjct: 442 KLVEVNGRGFDLRAEGTVLLVEYPDRPGVMGRVGTLLGEAGINIEAAQISQTTDGSDAVM 501

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D  I   +LE +  +V    ++  +FN
Sbjct: 502 LLRVDRHIDAHLLEPIGASVGAHTIRAVDFN 532


>gi|242096578|ref|XP_002438779.1| hypothetical protein SORBIDRAFT_10g026070 [Sorghum bicolor]
 gi|241917002|gb|EER90146.1| hypothetical protein SORBIDRAFT_10g026070 [Sorghum bicolor]
          Length = 613

 Score = 83.9 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 39/86 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P    +     DV +   +I     D  GI+  VG+ILG+  +N++   +GR+   +
Sbjct: 520 DGAPHLTLVGSFRVDVSLVGNLILCCQVDQPGIIGKVGSILGKMNVNVSFMSVGRTAPGK 579

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            AI  + +D       L+ +    ++
Sbjct: 580 QAIMAIGVDEEPEKEALKLIGDTPSV 605


>gi|291562725|emb|CBL41541.1| L-serine ammonia-lyase [butyrate-producing bacterium SS3/4]
          Length = 225

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 40/99 (40%), Gaps = 1/99 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++  ++ D+      I + + D  G + FV  +L  Y +NI    L R    
Sbjct: 127 GGGNAVITRLNGVDVDLTGNYSTIVVQHIDKKGTLAFVTAVLSAYDLNIGSLRLYRESKG 186

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF-EFNVD 100
           + A + + +D  + + V+  L     ++ V      N+D
Sbjct: 187 KMAYAIIEVDTMVSSQVINALRGFEAVKNVLLVPAINLD 225


>gi|331695673|ref|YP_004331912.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia dioxanivorans
           CB1190]
 gi|326950362|gb|AEA24059.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia dioxanivorans
           CB1190]
          Length = 533

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 23/91 (25%), Positives = 46/91 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   +FD+     ++ +  AD  G++  VG++LGE  +NI    + ++     AI 
Sbjct: 443 KLVEINGRHFDLRAEGDILLLEYADRPGVMGRVGSLLGEAAVNIEAAQISQTTDGRDAIM 502

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D  I  +VLE +  +V  + V+    +
Sbjct: 503 LLRVDRPIDPAVLEPIGASVGAKTVRLISLD 533


>gi|255527315|ref|ZP_05394194.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium carboxidivorans P7]
 gi|296185725|ref|ZP_06854134.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium carboxidivorans P7]
 gi|255509005|gb|EET85366.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium carboxidivorans P7]
 gi|296049853|gb|EFG89278.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Clostridium carboxidivorans P7]
          Length = 226

 Score = 83.9 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 19/81 (23%), Positives = 33/81 (40%)

Query: 16  NFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSI 75
           N +       I I + D+ G+V  V  +L  Y INIA   + RS     A     +D  I
Sbjct: 140 NIEFTGAYPTILINHVDLPGMVARVSAVLYYYRINIAFMRVYRSGKGSAAAMVFEVDDII 199

Query: 76  LNSVLEKLSVNVTIRFVKQFE 96
              +++++     I+  +   
Sbjct: 200 SQELIDEIRKIPNIKNARAIN 220


>gi|262370635|ref|ZP_06063960.1| D-3-phosphoglycerate dehydrogenase(PGDH) [Acinetobacter johnsonii
           SH046]
 gi|262314435|gb|EEY95477.1| D-3-phosphoglycerate dehydrogenase(PGDH) [Acinetobacter johnsonii
           SH046]
          Length = 410

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 35/86 (40%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ ++ G++  + N+  E+GINI+   L      +     +
Sbjct: 326 VNFPEIALPLTEGKHRLLHIHKNVPGVLSKINNLFAEHGINISGQSLMT--KGDVGYLVM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D +     L+ L        V+  
Sbjct: 384 DVDATASQEALDTLQDVEGTIRVRVL 409


>gi|326490081|dbj|BAJ94114.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326504998|dbj|BAK02886.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 613

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 38/88 (43%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           DG P    +   + DV +   +I     D  GI+  VG+ILG   +N+    +GR    +
Sbjct: 520 DGTPHLTLVGPFSVDVSLEGNLILCRQVDQPGIIGKVGSILGTMNLNVNFMSVGRIAPGK 579

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRF 91
            AI  + ID       L+ +    +++ 
Sbjct: 580 QAIMAIGIDEEPEKEALKLIGETPSVQE 607


>gi|150390084|ref|YP_001320133.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Alkaliphilus metalliredigens QYMF]
 gi|149949946|gb|ABR48474.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Alkaliphilus metalliredigens QYMF]
          Length = 222

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 34/88 (38%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
            +I ++  +       I + + D  G++     IL EYGINIA   + R    ++A   +
Sbjct: 134 TEINDLKLEFTGEYPTIIVSHKDRPGLIAKTTAILCEYGINIAFMRVYRYHKGQNAFMII 193

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             D  I+  V+  +     I        
Sbjct: 194 ETDNEIVPEVVGDIKKVAEIDNAYLISI 221


>gi|256380010|ref|YP_003103670.1| D-3-phosphoglycerate dehydrogenase [Actinosynnema mirum DSM 43827]
 gi|255924313|gb|ACU39824.1| D-3-phosphoglycerate dehydrogenase [Actinosynnema mirum DSM 43827]
          Length = 532

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 47/91 (51%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + +   +FD+     ++ +  +D  G++  VG +LGE G+N+    + + +    A+ 
Sbjct: 442 KIVGVNGRSFDLRAEGNVLLLEYSDRPGVMGTVGTLLGEAGVNVEAAQISQQKGGSEALM 501

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D  + ++VL+ +  +V  R ++   F+
Sbjct: 502 LLRVDRPVDSNVLDPIGASVGARTMRSVNFD 532


>gi|310794865|gb|EFQ30326.1| phosphoglycerate dehydrogenase [Glomerella graminicola M1.001]
          Length = 567

 Score = 83.5 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 37/102 (36%), Gaps = 7/102 (6%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLG----- 57
           S       K+   +        M+ + N D  G +  VG +LG +GINI    +      
Sbjct: 466 SGQGIYISKLDRFSATFQPQGTMLVLHNYDEPGKIGGVGTVLGRHGINITFMQVASLDGE 525

Query: 58  --RSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             R++    A+  L + G I   V++ L     I  V     
Sbjct: 526 EKRAEGGNEALMILGVKGEIGGEVVKDLKKAEGILNVSLVRM 567


>gi|239817102|ref|YP_002946012.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Variovorax paradoxus S110]
 gi|239803679|gb|ACS20746.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Variovorax paradoxus S110]
          Length = 410

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 35/86 (40%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ ++ G++  +  I  +  INI+   L  ++   +    +
Sbjct: 326 VNFPEVALPAHPGKHRLLHIHRNVPGVLSEINKIFSDNNINISSQFLQTNEKIGYV--VM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            ID +  +  LEKL+        +  
Sbjct: 384 DIDAAYSDLALEKLAKVNGTIRSRVL 409


>gi|121604756|ref|YP_982085.1| D-isomer specific 2-hydroxyacid dehydrogenase [Polaromonas
           naphthalenivorans CJ2]
 gi|120593725|gb|ABM37164.1| D-3-phosphoglycerate dehydrogenase [Polaromonas naphthalenivorans
           CJ2]
          Length = 409

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 36/86 (41%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ ++ G++  +  +  +  INIA  +L  +++  +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHRNVPGVLSEINRVFSDNHINIASQYLQTNEAIGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            ID +  +  L KL+        +  
Sbjct: 383 DIDAAHSDMALAKLANVPGTIRSRVL 408


>gi|262280301|ref|ZP_06058085.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258079|gb|EEY76813.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 410

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 35/86 (40%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ ++ G++  + N+  E GINI+   L      +     +
Sbjct: 326 VNFPEIALPLTAGQHRLLHIHKNVPGVLSKINNLFAEQGINISGQSLMT--KGDIGYLVM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D S  +  L+ L        V+  
Sbjct: 384 DVDASASHEALDMLHEVEGTIRVRVL 409


>gi|159036772|ref|YP_001536025.1| D-3-phosphoglycerate dehydrogenase [Salinispora arenicola CNS-205]
 gi|157915607|gb|ABV97034.1| D-3-phosphoglycerate dehydrogenase [Salinispora arenicola CNS-205]
          Length = 531

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 40/85 (47%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           +  ++   + ++    +++ +   D  G+V  VG +LG  G+NIA   + R ++    + 
Sbjct: 439 KLTEVDGFDVEIGAEGILVFLRYVDRPGVVGTVGTLLGAAGVNIAAMQVARREAGGETLM 498

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFV 92
            L +D ++   +L  ++ +V     
Sbjct: 499 TLTVDQALGADLLTSVADSVGATSA 523


>gi|297830606|ref|XP_002883185.1| hypothetical protein ARALYDRAFT_479462 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297329025|gb|EFH59444.1| hypothetical protein ARALYDRAFT_479462 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 585

 Score = 83.5 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 37/85 (43%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P   K+     DV +   +I     D  G++  V +ILG+  +N++   +GR    + 
Sbjct: 493 GIPSLTKVGLFGVDVSLEGSVILCRQVDQPGMIGKVASILGDENVNVSFMSVGRIAPGKQ 552

Query: 65  AISFLCIDGSILNSVLEKLSVNVTI 89
           A+  + +D       L+K+     I
Sbjct: 553 AVMAIGVDEQPSKETLKKIGDIPAI 577


>gi|299768589|ref|YP_003730615.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter sp. DR1]
 gi|298698677|gb|ADI89242.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter sp. DR1]
          Length = 410

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 35/86 (40%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ ++ G++  + N+  E GINI+   L      +     +
Sbjct: 326 VNFPEIALPLTAGQHRLLHIHKNVPGVLSKINNLFAEQGINISGQSLMT--KGDIGYLVM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D S  +  L+ L        V+  
Sbjct: 384 DVDASASHEALDMLHEVEGTIRVRVL 409


>gi|167758365|ref|ZP_02430492.1| hypothetical protein CLOSCI_00705 [Clostridium scindens ATCC 35704]
 gi|167664262|gb|EDS08392.1| hypothetical protein CLOSCI_00705 [Clostridium scindens ATCC 35704]
          Length = 387

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 13/94 (13%), Positives = 34/94 (36%), Gaps = 2/94 (2%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
                  +   + +  +      I +++ ++  ++     IL +  +NIA          
Sbjct: 296 HGNIQNSVNYPDSDMGLRGKNTRIVLLHHNVPNMIGQFTKILADDNMNIADM--SNKSKG 353

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            +A + + ID  +   V++ L     +  V+  E
Sbjct: 354 GYAYTMIDIDSPVPEKVVDDLRKVGEVLRVRVIE 387


>gi|293610749|ref|ZP_06693049.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827093|gb|EFF85458.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 410

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 35/86 (40%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ ++ G++  + N+  E GINI+   L      +     +
Sbjct: 326 VNFPEIALPLTAGQHRLLHIHKNVPGVLSKINNLFAEQGINISGQSLMT--KGDIGYLVM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D S  +  L+ L        V+  
Sbjct: 384 DVDASASHEALDMLHEVEGTIRVRVL 409


>gi|330509011|ref|YP_004385439.1| phosphoglycerate dehydrogenase [Methanosaeta concilii GP-6]
 gi|328929819|gb|AEB69621.1| phosphoglycerate dehydrogenase [Methanosaeta concilii GP-6]
          Length = 525

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 41/97 (42%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V  + + R +++      +     M+  V  D   I+     +LGE  INI   H+GR  
Sbjct: 429 VSGNKEKRIVQLDLYRTYIPTEGDMVIAVIDDKPNIIGPCCVVLGEGNINIGSMHVGRMD 488

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             +  +  L +D  + + ++++L     ++  K  E 
Sbjct: 489 EGQPQLMVLSVDQMVPDDLMKRLLQVPGVKSAKMVEL 525


>gi|111608868|gb|ABH10992.1| phosphoglycerate dehydrogenase [Polytomella parva]
          Length = 191

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 19/93 (20%), Positives = 41/93 (44%), Gaps = 1/93 (1%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           +G P   KI     ++ +   ++     D  GIV  +G +L +  +NI+   + R    +
Sbjct: 97  NGTPFITKIGNFLVELSVQGSVLLTRQRDQPGIVGRIGTLLAKENVNISFMTVSRKDD-K 155

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            AI  + +D     ++L++++    I     F+
Sbjct: 156 EAIMAIGVDSEPSEALLKEINKVNGIIESTVFK 188


>gi|50086287|ref|YP_047797.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter sp. ADP1]
 gi|49532263|emb|CAG69975.1| D-3-phosphoglycerate dehydrogenase [Acinetobacter sp. ADP1]
          Length = 410

 Score = 83.2 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 34/86 (39%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ +I G++  + N+  E  INI+   L      +     +
Sbjct: 326 VNFPEIALPLTEGKHRLLHIHKNIPGVLSKINNLFAEQNINISGQSLMT--KGDIGYLIM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D S     L+ L+       V+  
Sbjct: 384 DVDASASQEALDMLNQVEGTIRVRVL 409


>gi|257457493|ref|ZP_05622661.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Treponema vincentii ATCC 35580]
 gi|257445116|gb|EEV20191.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Treponema vincentii ATCC 35580]
          Length = 220

 Score = 82.8 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 38/91 (41%), Gaps = 1/91 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     KI      +      I +V+ DI G++  V  ++ +Y +N+  F+L R +  
Sbjct: 124 GGGNIVITKIDGREVKITGQSPTIIVVHNDIPGMIAAVTALMAQYKLNVYKFNLARDKKG 183

Query: 63  EHAISFLCIDG-SILNSVLEKLSVNVTIRFV 92
             AI  L IDG S+   +   +     +  V
Sbjct: 184 GTAIMTLQIDGRSLGEDLHAAIEKIPGVIKV 214


>gi|42565022|ref|NP_566637.2| D-3-phosphoglycerate dehydrogenase, putative / 3-PGDH, putative
           [Arabidopsis thaliana]
 gi|11994471|dbj|BAB02473.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 588

 Score = 82.8 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 37/85 (43%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P   K+     DV +   +I     D  G++  V +ILG+  +N++   +GR    + 
Sbjct: 496 GVPSLTKVGLFGVDVSLEGSVILCRQVDQPGMIGKVASILGDENVNVSFMSVGRIAPGKQ 555

Query: 65  AISFLCIDGSILNSVLEKLSVNVTI 89
           A+  + +D       L+K+     I
Sbjct: 556 AVMAIGVDEQPSKETLKKIGDIPAI 580


>gi|121593285|ref|YP_985181.1| D-3-phosphoglycerate dehydrogenase [Acidovorax sp. JS42]
 gi|120605365|gb|ABM41105.1| D-3-phosphoglycerate dehydrogenase [Acidovorax sp. JS42]
          Length = 434

 Score = 82.8 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 37/86 (43%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  V+ ++ G++  + +IL +  INIA  +L  ++   +    +
Sbjct: 350 VNFPEVALPEHAGKHRLLHVHHNVPGVLSQINSILSDNHINIAAQYLQTNEKIGYV--VI 407

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +  LEKL+        +  
Sbjct: 408 DLDARSSDLALEKLAQVPGTIRSRVL 433


>gi|295097448|emb|CBK86538.1| D-3-phosphoglycerate dehydrogenase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 410

 Score = 82.8 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  +    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLLHIHENRPGVLTAINQIFAEQGVNIAAQYLQTNSQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  I    L+ +         +  
Sbjct: 384 EADEDIAEKALQSMKAIPGTIRARLL 409


>gi|153853317|ref|ZP_01994726.1| hypothetical protein DORLON_00713 [Dorea longicatena DSM 13814]
 gi|149754103|gb|EDM64034.1| hypothetical protein DORLON_00713 [Dorea longicatena DSM 13814]
          Length = 387

 Score = 82.8 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 13/93 (13%), Positives = 40/93 (43%), Gaps = 2/93 (2%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +      +   + +  +   +  I +++ ++  ++  +  IL +  +NIA   L      
Sbjct: 296 NGNIKHSVNYPDCDMGLRGDKTRILVLHHNVPNMIGQISAILAKDNMNIAD--LTNKSKG 353

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           ++A + + +D  + + V+E+L     +  V+  
Sbjct: 354 KYAYTMIDVDSEVPDGVVEELKQIGEVLRVRVI 386


>gi|14596141|gb|AAK68798.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 516

 Score = 82.8 bits (204), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 37/85 (43%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P   K+     DV +   +I     D  G++  V +ILG+  +N++   +GR    + 
Sbjct: 424 GVPSLTKVGLFGVDVSLEGSVILCRQVDQPGMIGKVASILGDENVNVSFMSVGRIAPGKQ 483

Query: 65  AISFLCIDGSILNSVLEKLSVNVTI 89
           A+  + +D       L+K+     I
Sbjct: 484 AVMAIGVDEQPSKETLKKIGDIPAI 508


>gi|149377131|ref|ZP_01894880.1| D-3-phosphoglycerate dehydrogenase [Marinobacter algicola DG893]
 gi|149358549|gb|EDM47022.1| D-3-phosphoglycerate dehydrogenase [Marinobacter algicola DG893]
          Length = 409

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 31/86 (36%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+       +  +  ++ ++ G++  +  +  E GINI   +L   +   +    +
Sbjct: 325 VNFPEVALPSHPNQHRLLHIHENVPGVMSEINQVFSENGINICGQYLQTKEDIGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D       LEKL         +  
Sbjct: 383 DVDKEYGELALEKLLKVKGTIRCRVL 408


>gi|37958848|gb|AAP51112.1| putative phosphoglycerate dehydrogenase [uncultured bacterium]
          Length = 433

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 34/86 (39%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +  G+  +  ++ ++ GI+  +  +  E GINIA   L  + +       +
Sbjct: 349 VNFPEVSIPLGAGKHRLLHIHENVPGILSNINRVFAENGINIAAQSLMTNDAIG--YLVI 406

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D       L+K+         +  
Sbjct: 407 DVDAEYSEVALQKIQSIPGTIRSRVL 432


>gi|261342315|ref|ZP_05970173.1| D-3-phosphoglycerate dehydrogenase [Enterobacter cancerogenus ATCC
           35316]
 gi|288315658|gb|EFC54596.1| D-3-phosphoglycerate dehydrogenase [Enterobacter cancerogenus ATCC
           35316]
          Length = 410

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 11/86 (12%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  +    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLLHIHENRPGVLTAINQIFAEQGVNIAAQYLQTNSQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQSMKAIPGTIRARLL 409


>gi|219669853|ref|YP_002460288.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Desulfitobacterium hafniense DCB-2]
 gi|219540113|gb|ACL21852.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Desulfitobacterium hafniense DCB-2]
          Length = 223

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 34/84 (40%)

Query: 13  QEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCID 72
            +   ++      + ++  D+ G+V  V +++    INIA   + R +   HA+  +  D
Sbjct: 137 DQFKVEIMGDYHTLVVLQNDLPGVVAQVSSLIAATQINIAQMRVSREKKGAHALMIIETD 196

Query: 73  GSILNSVLEKLSVNVTIRFVKQFE 96
            +I  + L  +     +      E
Sbjct: 197 QAIDPAALALIKKLPAVNQAMAIE 220


>gi|71735117|ref|YP_276976.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555670|gb|AAZ34881.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 429

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 345 VNFPEVALPAHPGKHRLLHIHENIPGVLSEINKVFAENGINISGQFLQTNEKVGYV--VI 402

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +    KL         +  
Sbjct: 403 DVDAEYSDLAQAKLQQIKGTIRSRVL 428


>gi|302865806|ref|YP_003834443.1| D-3-phosphoglycerate dehydrogenase [Micromonospora aurantiaca ATCC
           27029]
 gi|315502351|ref|YP_004081238.1| d-3-phosphoglycerate dehydrogenase [Micromonospora sp. L5]
 gi|302568665|gb|ADL44867.1| D-3-phosphoglycerate dehydrogenase [Micromonospora aurantiaca ATCC
           27029]
 gi|315408970|gb|ADU07087.1| D-3-phosphoglycerate dehydrogenase [Micromonospora sp. L5]
          Length = 532

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 38/73 (52%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           +  ++   + ++    +++ +  AD  G+V  VG +LGE G+NIA   + R ++    + 
Sbjct: 440 KLTEVDGFDVEIGAEGILVFLRYADRPGVVGTVGTLLGEAGVNIAAMQVARREAGGETLM 499

Query: 68  FLCIDGSILNSVL 80
            L +D ++   +L
Sbjct: 500 TLTVDQALGADLL 512


>gi|294101091|ref|YP_003552949.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Aminobacterium colombiense DSM 12261]
 gi|293616071|gb|ADE56225.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Aminobacterium colombiense DSM 12261]
          Length = 228

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 32/96 (33%), Gaps = 3/96 (3%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++   N  V      +   + D  G+V  V  +  +  INIA   L R    
Sbjct: 125 GGGAVELQQVDGFNVSVSGELPSLITFHQDTHGVVAAVTRLFADMKINIATLSLYRKSKG 184

Query: 63  EHAISFLCID--GSILNSVLEKL-SVNVTIRFVKQF 95
             A   + +D       SV E +   + +I  V   
Sbjct: 185 GKASLVIELDLQSPPHRSVREAIEKAHPSIERVLPL 220


>gi|224152572|ref|XP_002337253.1| predicted protein [Populus trichocarpa]
 gi|222838623|gb|EEE76988.1| predicted protein [Populus trichocarpa]
          Length = 139

 Score = 82.4 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 39/86 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           D KP   K+     DV +   +I     D  G++  VGNILGE  +N++   +G+    +
Sbjct: 46  DRKPHLTKVDSFGVDVSMEGSLILCSQVDQPGMIGSVGNILGEENVNVSFMSVGKIAPQK 105

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            A+  + +D       L+++     +
Sbjct: 106 QAVMTIGVDEKPSKEALKRIGEIPAV 131


>gi|307297860|ref|ZP_07577666.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306917120|gb|EFN47502.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 222

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 36/95 (37%), Gaps = 1/95 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS- 61
             G  R   I +   DV      + I+NADI G +  +   +    +NI++  L R    
Sbjct: 122 GGGSVRITAIDDFETDVTGKYPSLVILNADIPGALSKIVGAISSSDMNISNLFLSRVDPF 181

Query: 62  TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
              A+  + +D      +L  +     ++ V   E
Sbjct: 182 RHEALCVVELDNEPDEHLLSAIKRLEVVKKVSYLE 216


>gi|89098295|ref|ZP_01171179.1| L-serine dehydratase (beta chain) [Bacillus sp. NRRL B-14911]
 gi|89086844|gb|EAR65961.1| L-serine dehydratase (beta chain) [Bacillus sp. NRRL B-14911]
          Length = 219

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 36/90 (40%), Gaps = 1/90 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     ++      +     ++ I + D  G +  V ++L  + INI H  + R +  
Sbjct: 126 GGGTIEITELNSFKLKLSGNPAILVI-HNDQFGAISAVTHVLAMHRINIGHMEVSRKEKG 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           + A+  + +D  I   V+ +L     I  +
Sbjct: 185 QMAMMVIEVDQRIDLDVIRELEQLPNITQI 214


>gi|332191510|gb|AEE29631.1| D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 651

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 38/85 (44%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P    +     DV +   +I     D  G++  VGNILGE  +N+    +GR+   + 
Sbjct: 559 GVPHLTCVGSFGVDVSLEGNLILCRQVDQPGMIGQVGNILGEQNVNVNFMSVGRTVLRKQ 618

Query: 65  AISFLCIDGSILNSVLEKLSVNVTI 89
           AI  + +D    N  LE++     I
Sbjct: 619 AIMAIGVDEEPDNKTLERIGGVSAI 643


>gi|260904884|ref|ZP_05913206.1| D-3-phosphoglycerate dehydrogenase [Brevibacterium linens BL2]
          Length = 530

 Score = 82.0 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 16/77 (20%), Positives = 38/77 (49%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           +  ++   + ++++   ++     D  GI+  +G  LG   INIA   +  S +   A+S
Sbjct: 438 KLTEVNGFDLEIELTDNLLIFRYEDRPGIIGQLGQALGANEINIAGMQVSPSATDNDALS 497

Query: 68  FLCIDGSILNSVLEKLS 84
            L +D ++   V++ ++
Sbjct: 498 VLAVDSAVSEEVVKAVA 514


>gi|224153962|ref|XP_002337418.1| predicted protein [Populus trichocarpa]
 gi|222839162|gb|EEE77513.1| predicted protein [Populus trichocarpa]
          Length = 139

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 39/86 (45%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           D KP   K+     DV +   +I     D  G++  VGNILGE  +N++   +G+    +
Sbjct: 46  DRKPHLTKVDSFGVDVSMEGSLILCSQVDQPGMIGSVGNILGEENVNVSFMSVGKIAPQK 105

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTI 89
            A+  + +D       L+++     +
Sbjct: 106 QAVMTIGVDEKPSKEALKRIGEIPAV 131


>gi|225869460|ref|YP_002745408.1| L-serine dehydratase, beta chain [Streptococcus equi subsp.
           zooepidemicus]
 gi|225702736|emb|CAX00881.1| putative L-serine dehydratase, beta chain [Streptococcus equi
           subsp. zooepidemicus]
          Length = 223

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 40/90 (44%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G  +  ++   +  + +    + IV+ DI G++  V +IL    INIA   + R  + 
Sbjct: 130 GGGNIQVTELNVFSISLSMNTPTLIIVHQDIPGMIAKVTDILSASDINIAQMTVTRESAG 189

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
           E AI  + +D       +++++    +  V
Sbjct: 190 EKAIMIIEVDSRDCQVAVKQIATIPNLHNV 219


>gi|209695962|ref|YP_002263892.1| D-3-phosphoglycerate dehydrogenase [Aliivibrio salmonicida LFI1238]
 gi|208009915|emb|CAQ80228.1| D-3-phosphoglycerate dehydrogenase [Aliivibrio salmonicida LFI1238]
          Length = 409

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 34/87 (39%), Gaps = 2/87 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +  G   +  ++ +  GI+  + +I  + GINIA  +L  S    +    +
Sbjct: 325 VNFPEVSLPLHTGTSRLLHIHENRPGILTKINSIFADKGINIAAQYLQTSSEMGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQFE 96
            ++ +     L KL         +   
Sbjct: 383 DVEAARSEEALTKLKDIEGTIRARILH 409


>gi|254427684|ref|ZP_05041391.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain,
           putative [Alcanivorax sp. DG881]
 gi|196193853|gb|EDX88812.1| D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain,
           putative [Alcanivorax sp. DG881]
          Length = 409

 Score = 82.0 bits (202), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 30/86 (34%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+          +   + ++ G++  +  +  E GINI   +L  ++   +    +
Sbjct: 325 VNFPEVALPPHPDMHRLLHTHKNVPGVLTQINTVFSENGINICGQYLQTNEEIGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D       LEKL         +  
Sbjct: 383 DVDKGYSQLALEKLRTIDGTIRTRVL 408


>gi|89895422|ref|YP_518909.1| hypothetical protein DSY2676 [Desulfitobacterium hafniense Y51]
 gi|89334870|dbj|BAE84465.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 223

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 34/84 (40%)

Query: 13  QEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCID 72
            +   ++      + ++  D+ G+V  V +++    INIA   + R +   HA+  +  D
Sbjct: 137 DQFKVEIMGDYHTLVVLQNDLPGVVAQVSSLIAATQINIAQMRVSREKKGAHALMIIETD 196

Query: 73  GSILNSVLEKLSVNVTIRFVKQFE 96
            +I  + L  +     +      E
Sbjct: 197 QAIDPAALALIKKLPAVNQAMAIE 220


>gi|18394525|ref|NP_564034.1| PGDH (3-PHOSPHOGLYCERATE DEHYDROGENASE); phosphoglycerate
           dehydrogenase [Arabidopsis thaliana]
 gi|3122858|sp|O04130|SERA_ARATH RecName: Full=D-3-phosphoglycerate dehydrogenase, chloroplastic;
           Short=3-PGDH; Flags: Precursor
 gi|9802747|gb|AAF99816.1|AC034257_8 D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|2189964|dbj|BAA20405.1| Phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|2804258|dbj|BAA24440.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|15215740|gb|AAK91415.1| At1g17740/F11A6_16 [Arabidopsis thaliana]
 gi|20466083|gb|AAM19963.1| At1g17740/F11A6_16 [Arabidopsis thaliana]
 gi|21554130|gb|AAM63210.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|332191509|gb|AEE29630.1| D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 624

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 38/85 (44%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P    +     DV +   +I     D  G++  VGNILGE  +N+    +GR+   + 
Sbjct: 532 GVPHLTCVGSFGVDVSLEGNLILCRQVDQPGMIGQVGNILGEQNVNVNFMSVGRTVLRKQ 591

Query: 65  AISFLCIDGSILNSVLEKLSVNVTI 89
           AI  + +D    N  LE++     I
Sbjct: 592 AIMAIGVDEEPDNKTLERIGGVSAI 616


>gi|222110007|ref|YP_002552271.1| d-isomer specific 2-hydroxyacid dehydrogenase [Acidovorax ebreus
           TPSY]
 gi|221729451|gb|ACM32271.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Acidovorax ebreus TPSY]
          Length = 409

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 37/86 (43%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  V+ ++ G++  + +IL +  INIA  +L  ++   +    +
Sbjct: 325 VNFPEVALPEHAGKHRLLHVHHNVPGVLSQINSILSDNHINIAAQYLQTNEKIGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +  LEKL+        +  
Sbjct: 383 DLDARSSDLALEKLAQVPGTIRSRVL 408


>gi|121997370|ref|YP_001002157.1| D-isomer specific 2-hydroxyacid dehydrogenase [Halorhodospira
           halophila SL1]
 gi|121588775|gb|ABM61355.1| D-3-phosphoglycerate dehydrogenase [Halorhodospira halophila SL1]
          Length = 389

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 14/87 (16%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   ++          +C+VNA++  ++  + ++L ++G+NI           + A + +
Sbjct: 305 VNFPDMGMPRSGKGDRLCVVNANVPNMLGQISSLLAQHGLNIDDM--FNKAQEQLAYTLV 362

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQFE 96
            ++G + ++V E+L     +  V+   
Sbjct: 363 DVEGQVPDAVAEELRAIEGVLKVRVIS 389


>gi|82703309|ref|YP_412875.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Nitrosospira multiformis ATCC 25196]
 gi|82411374|gb|ABB75483.1| D-3-phosphoglycerate dehydrogenase [Nitrosospira multiformis ATCC
           25196]
          Length = 399

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 13/93 (13%), Positives = 37/93 (39%), Gaps = 3/93 (3%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           + G    +    I  + +     + + NA++  +V  +   + + G+NI     G     
Sbjct: 305 NGGITNAVNFPNITMERE-SPYRLAVANANVPNMVGQISTAMAKAGLNIHTM--GNKSRG 361

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           E A + + +D  +    +++++    +  V+  
Sbjct: 362 EMAYTLVDVDSPVPQETIDEIAAIKGVLNVRYL 394


>gi|110832929|ref|YP_691788.1| D-3-phosphoglycerate dehydrogenase [Alcanivorax borkumensis SK2]
 gi|110646040|emb|CAL15516.1| D-3-phosphoglycerate dehydrogenase [Alcanivorax borkumensis SK2]
          Length = 409

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 30/86 (34%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+          +   + ++ G++  +  +  E GINI   +L  ++   +    +
Sbjct: 325 VNFPEVALPPHPDMHRLLHTHKNVPGVLTQINTVFSENGINICGQYLQTNEEIGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D       LEKL         +  
Sbjct: 383 DVDKGYSQLALEKLRTIDGTIRTRVL 408


>gi|307543670|ref|YP_003896149.1| D-3-phosphoglycerate dehydrogenase [Halomonas elongata DSM 2581]
 gi|307215694|emb|CBV40964.1| D-3-phosphoglycerate dehydrogenase [Halomonas elongata DSM 2581]
          Length = 416

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 18/96 (18%), Positives = 37/96 (38%), Gaps = 4/96 (4%)

Query: 2   FSDGKPRF--IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRS 59
           FSD       +   E+      G+  +  ++ ++ G++  +  +L E  INI   +L  +
Sbjct: 315 FSDNGTTITSVNFPEVALPAHPGKHRLLHIHENVPGVLSEINRVLSEEDINILGQYLQTN 374

Query: 60  QSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
           +   +    + +D       LE LS       V+  
Sbjct: 375 ERIGYV--VIDVDKEYGPRALEALSKVTHTLRVRVL 408


>gi|301049303|ref|ZP_07196273.1| 4-phosphoerythronate dehydrogenase [Escherichia coli MS 185-1]
 gi|300298902|gb|EFJ55287.1| 4-phosphoerythronate dehydrogenase [Escherichia coli MS 185-1]
          Length = 208

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 123 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 181

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 182 EADEDVAEKALQAMKAIPGTIRARLL 207


>gi|325003700|ref|ZP_08124812.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia sp. P1]
          Length = 536

 Score = 81.6 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 46/91 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   +FD+     ++ +   D  G++  VG++LGE  +NI    + ++     A+ 
Sbjct: 445 KLVEINGRHFDLRAEGEVVLLEYTDRPGVMGRVGSLLGEAAVNIEAAQISQTTEGTDALM 504

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
            L +D  I  +VLE +  +V  R ++   F+
Sbjct: 505 LLRVDRHIDPAVLEPIGASVGARTIRLISFD 535


>gi|262273692|ref|ZP_06051505.1| D-3-phosphoglycerate dehydrogenase [Grimontia hollisae CIP 101886]
 gi|262222107|gb|EEY73419.1| D-3-phosphoglycerate dehydrogenase [Grimontia hollisae CIP 101886]
          Length = 409

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 32/87 (36%), Gaps = 2/87 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++     G   +  ++ +  GI+  +  I  E GINIA  +L  +    +    +
Sbjct: 325 VNFPEVSLPEHTGSSRLLHIHQNKPGILTKINTIFAEEGINIAGQYLQTNAEYGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQFE 96
            ++       LEKL         +   
Sbjct: 383 DVETEHSEKALEKLKAIEGTLRARILH 409


>gi|120555730|ref|YP_960081.1| D-3-phosphoglycerate dehydrogenase [Marinobacter aquaeolei VT8]
 gi|120325579|gb|ABM19894.1| D-3-phosphoglycerate dehydrogenase [Marinobacter aquaeolei VT8]
          Length = 409

 Score = 81.6 bits (201), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+       +  +  ++ ++ G++  +  +  E GIN+   +L   +   +    +
Sbjct: 325 VNFPEVALPSHPNQHRLLHIHENVPGVMSEINQVFSENGINVCGQYLQTKEDIGYV--VV 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D +     LEKL         +  
Sbjct: 383 DVDKAYGELALEKLRQVKGTIRCRVL 408


>gi|322437164|ref|YP_004219376.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX9]
 gi|321164891|gb|ADW70596.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX9]
          Length = 570

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 47/110 (42%), Gaps = 13/110 (11%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V     PR + +  I+ +  +   ++ I N D+ G+V  +G ILGE+ INIA+F LGR+ 
Sbjct: 458 VLHGTSPRLLTLDGIDIEAPLNGTLVSIRNHDVPGVVGRIGTILGEHKINIANFALGRAS 517

Query: 61  ----------STEHAISFLCIDGSIL---NSVLEKLSVNVTIRFVKQFEF 97
                         A++ + ID          L  L     I  V+  E 
Sbjct: 518 DTPGRSSQRVPQGQALAVVQIDVPDSHAAAPALAALKQIEAIVSVRLIEL 567


>gi|237802243|ref|ZP_04590704.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331025100|gb|EGI05156.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 409

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVLSEINKVFAENGINISGQFLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +    KL         +  
Sbjct: 383 DVDAEYSDLAQAKLQQIKGTIRSRVL 408


>gi|257791620|ref|YP_003182226.1| D-3-phosphoglycerate dehydrogenase [Eggerthella lenta DSM 2243]
 gi|317487964|ref|ZP_07946548.1| phosphoglycerate dehydrogenase [Eggerthella sp. 1_3_56FAA]
 gi|257475517|gb|ACV55837.1| D-3-phosphoglycerate dehydrogenase [Eggerthella lenta DSM 2243]
 gi|316912946|gb|EFV34471.1| phosphoglycerate dehydrogenase [Eggerthella sp. 1_3_56FAA]
          Length = 526

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 34/79 (43%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
            R + +     D+      +     D  G V  +G ILGE GINI    +      + A+
Sbjct: 435 ARLVSLFGYQLDIAPAGQSLVFEYVDAPGRVGTIGTILGEAGINITTMQIATLPGEQCAL 494

Query: 67  SFLCIDGSILNSVLEKLSV 85
            ++ ++G + + VL KL  
Sbjct: 495 VYMNVEGDVDDDVLSKLRA 513


>gi|260889453|ref|ZP_05900716.1| phosphoglycerate dehydrogenase [Leptotrichia hofstadii F0254]
 gi|260860864|gb|EEX75364.1| phosphoglycerate dehydrogenase [Leptotrichia hofstadii F0254]
          Length = 530

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 2/96 (2%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I I+  + D+ I   MI + N D+ G++  VG  LG+  INIA  ++GR ++  
Sbjct: 437 NNEERIISIKNHDVDMAISDNMIYLGNEDVPGVIGAVGATLGKGNINIATMNVGRREN-- 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            AI  L +D  +    L++L     I++    +  +
Sbjct: 495 SAIMLLTVDSEVGRRSLKELRGLSQIKWAHYLDLTI 530


>gi|254784624|ref|YP_003072052.1| D-3-phosphoglycerate dehydrogenase [Teredinibacter turnerae T7901]
 gi|237686760|gb|ACR14024.1| D-3-phosphoglycerate dehydrogenase [Teredinibacter turnerae T7901]
          Length = 411

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+          +  V+ ++ G++  +  I  E  INIA  +L   +S  +    +
Sbjct: 327 VNFPEVALPAHREVHRLLHVHQNVPGVMTAINRIFSENNINIAGQYLQTKESVGYV--VI 384

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D +  +  L++L         +  
Sbjct: 385 DVDSAYSDLALKQLREVEGTVRCRVL 410


>gi|120612294|ref|YP_971972.1| D-3-phosphoglycerate dehydrogenase [Acidovorax citrulli AAC00-1]
 gi|120590758|gb|ABM34198.1| D-3-phosphoglycerate dehydrogenase [Acidovorax citrulli AAC00-1]
          Length = 409

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  I  ++ ++ G++  +  +  +  INIA  +L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRILHIHRNVPGVLSAINQVFADNQINIAAQYLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            ID        +KL+        +  
Sbjct: 383 DIDAQSSELAQDKLASVPGTIRSRVL 408


>gi|326318362|ref|YP_004236034.1| phosphoglycerate dehydrogenase [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323375198|gb|ADX47467.1| Phosphoglycerate dehydrogenase [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 409

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  I  ++ ++ G++  +  +  +  INIA  +L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRILHIHRNVPGVLSAINQVFADNQINIAAQYLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            ID        +KL+        +  
Sbjct: 383 DIDAQSSELAQDKLASVPGTIRSRVL 408


>gi|298526466|ref|ZP_07013875.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           94_M4241A]
 gi|298496260|gb|EFI31554.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           94_M4241A]
          Length = 424

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 33/78 (42%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   +FD+    + + I   D  G +  +G +LG  G+NI    L        A  
Sbjct: 334 KIVQINGRHFDLRAQGINLIIHYVDRPGALGKIGTLLGTAGVNIQAAQLSEDAEGPGATI 393

Query: 68  FLCIDGSILNSVLEKLSV 85
            L +D  + + V   ++ 
Sbjct: 394 LLRLDQDVPDDVRTAIAA 411


>gi|257483777|ref|ZP_05637818.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289626080|ref|ZP_06459034.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289651108|ref|ZP_06482451.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|289672288|ref|ZP_06493178.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           syringae FF5]
 gi|298489284|ref|ZP_07007300.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|302187840|ref|ZP_07264513.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           syringae 642]
 gi|298156183|gb|EFH97287.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320326268|gb|EFW82321.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331732|gb|EFW87670.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330868960|gb|EGH03669.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330872494|gb|EGH06643.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330891631|gb|EGH24292.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330899116|gb|EGH30535.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330944687|gb|EGH46626.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330954761|gb|EGH55021.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae Cit 7]
 gi|330982248|gb|EGH80351.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 409

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVLSEINKVFAENGINISGQFLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +    KL         +  
Sbjct: 383 DVDAEYSDLAQAKLQQIKGTIRSRVL 408


>gi|330974548|gb|EGH74614.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 409

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVLSEINKVFAENGINISGQFLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +    KL         +  
Sbjct: 383 DVDAEYSDLAQAKLQQIKGTIRSRVL 408


>gi|66048076|ref|YP_237917.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           syringae B728a]
 gi|63258783|gb|AAY39879.1| Amino acid-binding ACT:D-isomer specific 2-hydroxyacid
           dehydrogenase, catalytic region:D-isomer specific
           2-hydroxyacid dehydrogenase, NAD-binding [Pseudomonas
           syringae pv. syringae B728a]
          Length = 409

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVLSEINKVFAENGINISGQFLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +    KL         +  
Sbjct: 383 DVDAEYSDLAQAKLQQIKGTIRSRVL 408


>gi|257125820|ref|YP_003163934.1| D-3-phosphoglycerate dehydrogenase [Leptotrichia buccalis C-1013-b]
 gi|257049759|gb|ACV38943.1| D-3-phosphoglycerate dehydrogenase [Leptotrichia buccalis C-1013-b]
          Length = 530

 Score = 81.2 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           + + R I I+  + D+ I   MI + N D+ G++  VG  LG+  INIA  ++GR ++  
Sbjct: 437 NNEERIISIKNHDVDMAISDNMIYLGNDDVPGVIGAVGATLGKENINIATMNVGRREN-- 494

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            AI  L +D  +    L KL     I++    +  +
Sbjct: 495 SAIMLLTVDSEVGRKSLNKLKGLSQIKWAHYLDLTI 530


>gi|119475434|ref|ZP_01615787.1| D-3-phosphoglycerate dehydrogenase [marine gamma proteobacterium
           HTCC2143]
 gi|119451637|gb|EAW32870.1| D-3-phosphoglycerate dehydrogenase [marine gamma proteobacterium
           HTCC2143]
          Length = 409

 Score = 81.2 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 29/86 (33%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+          +   + +  G++  +  +  E  INI   +L  +Q   +    +
Sbjct: 325 VNFPEVALPAHTDMHRLLHTHRNTPGVMSAINKVFAENNINIRAQYLQTTQDIGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            ID       L+KLS        +  
Sbjct: 383 DIDAEYSELALKKLSAIEGTIRCRVL 408


>gi|194014916|ref|ZP_03053533.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           pumilus ATCC 7061]
 gi|194013942|gb|EDW23507.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit [Bacillus
           pumilus ATCC 7061]
          Length = 220

 Score = 81.2 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 20/86 (23%), Positives = 37/86 (43%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
            ++      +      I +V+ D  G +  V N+L ++ INI H  + R    + A+  +
Sbjct: 133 TELNGFELRLSGNHPAILVVHNDRYGTIAAVANVLAKFAINIGHMEVARKDVGQEALMTI 192

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D +I  + L +L     I  V Q 
Sbjct: 193 EVDQNIDPAALSELETLPNIIQVTQI 218


>gi|297844730|ref|XP_002890246.1| 3-phosphoglycerate dehydrogenase [Arabidopsis lyrata subsp. lyrata]
 gi|297336088|gb|EFH66505.1| 3-phosphoglycerate dehydrogenase [Arabidopsis lyrata subsp. lyrata]
          Length = 613

 Score = 81.2 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 38/85 (44%)

Query: 5   GKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEH 64
           G P    +     DV +   +I     D  G++  VG+ILGE  +N+    +GR+   + 
Sbjct: 521 GVPHLTCVGSFGVDVSLEGNLILCRQVDQPGMIGQVGHILGEQNVNVNFMSVGRTVLRKQ 580

Query: 65  AISFLCIDGSILNSVLEKLSVNVTI 89
           AI  + +D    N  LE++     I
Sbjct: 581 AIMAIGVDEEPDNKTLERIGGVSAI 605


>gi|325274123|ref|ZP_08140261.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas sp. TJI-51]
 gi|324100740|gb|EGB98448.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas sp. TJI-51]
          Length = 409

 Score = 81.2 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVLSEINKVFAENGINISGQFLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +   EKL         +  
Sbjct: 383 DVDAEYSDLAQEKLQQVKGTIRSRVL 408


>gi|291532213|emb|CBL05326.1| L-serine ammonia-lyase [Megamonas hypermegale ART12/1]
          Length = 220

 Score = 81.2 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 39/90 (43%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G      +      +      I IV+ D+ G+V  V   L  Y INIA+  + RS+  
Sbjct: 125 GGGNIIISAVNNYEVQLSGKYPSIIIVHQDMPGVVNGVTAALARYNINIAYMKVSRSERG 184

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFV 92
             A+  + +D +I +  ++  S  + ++ V
Sbjct: 185 AEALMNIEVDDTISDEAVKACSRVIGVKKV 214


>gi|296104575|ref|YP_003614721.1| D-3-phosphoglycerate dehydrogenase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295059034|gb|ADF63772.1| D-3-phosphoglycerate dehydrogenase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 410

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 10/86 (11%), Positives = 31/86 (36%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E  +NIA  +L  +    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLLHIHENRPGVLTAINQIFAEQSVNIAAQYLQTNSQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQSMKAIPGTIRARLL 409


>gi|114320086|ref|YP_741769.1| D-3-phosphoglycerate dehydrogenase [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226480|gb|ABI56279.1| D-3-phosphoglycerate dehydrogenase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 389

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 42/93 (45%), Gaps = 3/93 (3%)

Query: 5   GKPR-FIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
           G  R  +   E+          +C+VNA++  ++  +   L E G+NI   +       E
Sbjct: 299 GNIRNAVNFPEVVMPRGGKGNRLCVVNANVPNMLGRISTALAEAGLNIDDMY--NKSHEE 356

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
            A + + ++G+I  SV++ ++    +  V+  E
Sbjct: 357 LAYTVVDVEGAIPESVVQAIAEVEGVLRVRVIE 389


>gi|319795436|ref|YP_004157076.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Variovorax paradoxus EPS]
 gi|315597899|gb|ADU38965.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Variovorax paradoxus EPS]
          Length = 410

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 35/86 (40%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  V+ ++ G++  +  I  +  INI+   L  ++   +    +
Sbjct: 326 VNFPEVALPAHPGKHRLLHVHKNVPGVLSEINKIFSDNHINISSQFLQTNEKIGYV--VM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            ID +  +  LEKL+        +  
Sbjct: 384 DIDAASSDLALEKLAKVGGTIRSRVL 409


>gi|146309246|ref|YP_001189711.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas mendocina ymp]
 gi|145577447|gb|ABP86979.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas mendocina ymp]
          Length = 409

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 34/86 (39%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++A++ G++  +  +  + GINI+   L  +    +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHANVPGVMSEINKVFADNGINISGQFLQTNDKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +  LEKL         +  
Sbjct: 383 DVDAEYSDLALEKLQRVNGTIRSRVL 408


>gi|42527015|ref|NP_972113.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Treponema denticola ATCC 35405]
 gi|41817439|gb|AAS12024.1| L-serine dehydratase, iron-sulfur-dependent, beta subunit
           [Treponema denticola ATCC 35405]
          Length = 220

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 37/95 (38%), Gaps = 1/95 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     KI     ++      + +   DI G +  + ++  ++ INI+  H+GR    
Sbjct: 124 GGGNILITKINGKPVELSGKNPTLVVEYQDIPGRIAAITSVTAKHKINISQIHIGRDYRG 183

Query: 63  EHAISFLCIDG-SILNSVLEKLSVNVTIRFVKQFE 96
             A   L +DG S+   + E +     I  V   +
Sbjct: 184 GTATMCLQMDGLSVGPELKEDILQIDHIYNVILIQ 218


>gi|92112231|ref|YP_572159.1| D-3-phosphoglycerate dehydrogenase [Chromohalobacter salexigens DSM
           3043]
 gi|91795321|gb|ABE57460.1| D-3-phosphoglycerate dehydrogenase [Chromohalobacter salexigens DSM
           3043]
          Length = 416

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 12/93 (12%), Positives = 34/93 (36%), Gaps = 2/93 (2%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +      +   E+       +  +  ++ ++ G++  +  +L + GINI+  +L  +   
Sbjct: 318 NGTTITSVNFPEVALPAHPDKHRLLHIHENVPGVMSEINKVLSDEGINISAQYLQTNS-- 375

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
                 + +D +     LE L        ++  
Sbjct: 376 GVGYVVIDVDKAYGPKALEALKRVNHTLRLRVL 408


>gi|26991831|ref|NP_747256.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas putida KT2440]
 gi|148550262|ref|YP_001270364.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas putida F1]
 gi|24986946|gb|AAN70720.1|AE016715_9 D-3-phosphoglycerate dehydrogenase [Pseudomonas putida KT2440]
 gi|148514320|gb|ABQ81180.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas putida F1]
          Length = 409

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVLSEINKVFAENGINISGQFLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +   EKL         +  
Sbjct: 383 DVDAEYSDLAQEKLQQVKGTIRSRVL 408


>gi|315039759|ref|XP_003169257.1| D-3-phosphoglycerate dehydrogenase [Arthroderma gypseum CBS 118893]
 gi|311337678|gb|EFQ96880.1| D-3-phosphoglycerate dehydrogenase [Arthroderma gypseum CBS 118893]
          Length = 562

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 18/104 (17%), Positives = 35/104 (33%), Gaps = 9/104 (8%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           S  +P   +I            ++   N D  G +  VG+I+G  G+NI    +      
Sbjct: 459 SGTQPLISRIDRFATSFVPEGNLLICHNFDSPGKIGVVGSIVGRNGVNINFMSVAPISKG 518

Query: 63  ---------EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                    + A+  L +D ++   V++ L     +        
Sbjct: 519 KPQKETNSVDEALMILGVDRAVDECVVKDLVKEGGVLSASVVSL 562


>gi|296127708|ref|YP_003634960.1| D-3-phosphoglycerate dehydrogenase [Brachyspira murdochii DSM
           12563]
 gi|296019524|gb|ADG72761.1| D-3-phosphoglycerate dehydrogenase [Brachyspira murdochii DSM
           12563]
          Length = 534

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 17/96 (17%), Positives = 39/96 (40%), Gaps = 1/96 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +    R +K+ + +  +     ++ + + +   ++  V  +L   GINI    +  +   
Sbjct: 433 AKNIARIVKLNDYDVIIKPQPHILVVPHINQPAMIAKVATLLSADGINIGSMSVSENIKG 492

Query: 63  -EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +I  + +D SI N V+ K+S    +   K    
Sbjct: 493 SNMSIMAINVDRSIGNDVITKISNIEGVHEPKYVRL 528


>gi|192360714|ref|YP_001980756.1| D-3-phosphoglycerate dehydrogenase [Cellvibrio japonicus Ueda107]
 gi|190686879|gb|ACE84557.1| D-3-phosphoglycerate dehydrogenase [Cellvibrio japonicus Ueda107]
          Length = 409

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+          +  V+A++ G++  +  I  +  INI+  +L  +    +    +
Sbjct: 325 VNFPEVALPGHPDAHRLLHVHANVPGVLSAINKIFSDNKINISSQYLQTNDKVGYV--VV 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            I+     + LE+L         +  
Sbjct: 383 DINSPYSEAALEQLKKIDGTIRCRVL 408


>gi|167036195|ref|YP_001671426.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas putida GB-1]
 gi|166862683|gb|ABZ01091.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Pseudomonas putida GB-1]
          Length = 409

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVLSEINKVFAENGINISGQFLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +   EKL         +  
Sbjct: 383 DVDAEYSDLAQEKLQQVKGTIRSRVL 408


>gi|313501130|gb|ADR62496.1| SerA [Pseudomonas putida BIRD-1]
          Length = 409

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVLSEINKVFAENGINISGQFLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +   EKL         +  
Sbjct: 383 DVDAEYSDLAQEKLQQVKGTIRSRVL 408


>gi|283788431|ref|YP_003368296.1| D-3-phosphoglycerate dehydrogenase [Citrobacter rodentium ICC168]
 gi|282951885|emb|CBG91601.1| D-3-phosphoglycerate dehydrogenase [Citrobacter rodentium ICC168]
          Length = 410

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNQIFAEQGVNIAAQYLQTSAQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQAMKAIPGTIRARLL 409


>gi|226946838|ref|YP_002801911.1| D-3-phosphoglycerate dehydrogenase [Azotobacter vinelandii DJ]
 gi|226721765|gb|ACO80936.1| D-3-phosphoglycerate dehydrogenase [Azotobacter vinelandii DJ]
          Length = 409

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 34/86 (39%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  +++  +    +
Sbjct: 325 VNFPEVALPSHPGKHRLLHIHKNIPGVMSEINKVFAENGINISGQFLQTNETVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D       LEKL         +  
Sbjct: 383 DVDAEYSEMALEKLQQVNGTIRSRVL 408


>gi|300925103|ref|ZP_07141018.1| phosphoglycerate dehydrogenase [Escherichia coli MS 182-1]
 gi|300418765|gb|EFK02076.1| phosphoglycerate dehydrogenase [Escherichia coli MS 182-1]
          Length = 410

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQAMKAIPGTIRARLL 409


>gi|325474078|gb|EGC77266.1| L-serine dehydratase [Treponema denticola F0402]
          Length = 220

 Score = 80.9 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 37/95 (38%), Gaps = 1/95 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
             G     KI     ++      + +   DI G +  + ++  ++ INI+  H+GR    
Sbjct: 124 GGGNILITKINGKPVELSGKNPTLVVEYQDIPGRIAAITSVTAKHKINISQIHIGRDYRG 183

Query: 63  EHAISFLCIDG-SILNSVLEKLSVNVTIRFVKQFE 96
             A   L +DG S+   + E +     I  V   +
Sbjct: 184 GTATMCLQMDGLSVGPELKEDILQIDHIYNVILIQ 218


>gi|70733196|ref|YP_262969.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas fluorescens Pf-5]
 gi|68347495|gb|AAY95101.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas fluorescens Pf-5]
          Length = 409

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVMSEINKVFAENGINISGQFLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +   EKL         +  
Sbjct: 383 DVDAEYSDLAQEKLQHINGTIRCRVL 408


>gi|187730934|ref|YP_001881682.1| D-3-phosphoglycerate dehydrogenase [Shigella boydii CDC 3083-94]
 gi|187427926|gb|ACD07200.1| phosphoglycerate dehydrogenase [Shigella boydii CDC 3083-94]
          Length = 410

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQAMKAIPGTIRARLL 409


>gi|301327319|ref|ZP_07220572.1| phosphoglycerate dehydrogenase [Escherichia coli MS 78-1]
 gi|300846051|gb|EFK73811.1| phosphoglycerate dehydrogenase [Escherichia coli MS 78-1]
          Length = 410

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQAMKAIPGTIRARLL 409


>gi|302503639|ref|XP_003013779.1| hypothetical protein ARB_07891 [Arthroderma benhamiae CBS 112371]
 gi|291177345|gb|EFE33139.1| hypothetical protein ARB_07891 [Arthroderma benhamiae CBS 112371]
          Length = 575

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 37/105 (35%), Gaps = 10/105 (9%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           S+ +P   +I            ++   N D  G +  VG+ILG+ G+NI    +      
Sbjct: 471 SESQPLISRIDRFATSFVPEGTLLICHNFDSPGKIGVVGSILGKRGVNINFMSVAPISKG 530

Query: 63  ----------EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                     + A+  L +D ++   V++ L     +        
Sbjct: 531 KKQQKEIDSSDEALMILGVDRAVDECVVKALVNEGGVLSASVVSL 575


>gi|320182184|gb|EFW57087.1| D-3-phosphoglycerate dehydrogenase [Shigella boydii ATCC 9905]
          Length = 410

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQAMKAIPGTIRARLL 409


>gi|110643060|ref|YP_670790.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 536]
 gi|191171888|ref|ZP_03033434.1| phosphoglycerate dehydrogenase [Escherichia coli F11]
 gi|215488211|ref|YP_002330642.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|300995655|ref|ZP_07181183.1| phosphoglycerate dehydrogenase [Escherichia coli MS 200-1]
 gi|312964827|ref|ZP_07779067.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 2362-75]
 gi|110344652|gb|ABG70889.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 536]
 gi|190907923|gb|EDV67516.1| phosphoglycerate dehydrogenase [Escherichia coli F11]
 gi|215266283|emb|CAS10712.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|222034606|emb|CAP77348.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli LF82]
 gi|300304763|gb|EFJ59283.1| phosphoglycerate dehydrogenase [Escherichia coli MS 200-1]
 gi|312290383|gb|EFR18263.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 2362-75]
 gi|312947444|gb|ADR28271.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|323188689|gb|EFZ73974.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli RN587/1]
 gi|324011737|gb|EGB80956.1| phosphoglycerate dehydrogenase [Escherichia coli MS 60-1]
          Length = 410

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQAMKAIPGTIRARLL 409


>gi|320175898|gb|EFW50976.1| D-3-phosphoglycerate dehydrogenase [Shigella dysenteriae CDC
           74-1112]
          Length = 410

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQAMKAIPGTIRARLL 409


>gi|262377366|ref|ZP_06070590.1| phosphoglycerate dehydrogenase [Acinetobacter lwoffii SH145]
 gi|262307819|gb|EEY88958.1| phosphoglycerate dehydrogenase [Acinetobacter lwoffii SH145]
          Length = 410

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 35/86 (40%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   EI   +  G+  +  ++ +I G++  + N+  E GINI+   L      +     +
Sbjct: 326 VNFPEIALPLTEGKHRLLHIHQNIPGVLSKINNLFAEQGINISGQSLMT--KGDVGYLVM 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D +  +  L+ LS        +  
Sbjct: 384 DVDAAASHEALDMLSNVEGTIRARVL 409


>gi|218696508|ref|YP_002404175.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 55989]
 gi|218353240|emb|CAU99172.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 55989]
          Length = 410

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQAMKAIPGTIRARLL 409


>gi|15803448|ref|NP_289481.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7
           EDL933]
 gi|15833038|ref|NP_311811.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           Sakai]
 gi|16130814|ref|NP_417388.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli str. K-12
           substr. MG1655]
 gi|24114165|ref|NP_708675.1| D-3-phosphoglycerate dehydrogenase [Shigella flexneri 2a str. 301]
 gi|26249329|ref|NP_755369.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli CFT073]
 gi|30064223|ref|NP_838394.1| D-3-phosphoglycerate dehydrogenase [Shigella flexneri 2a str.
           2457T]
 gi|74313470|ref|YP_311889.1| D-3-phosphoglycerate dehydrogenase [Shigella sonnei Ss046]
 gi|82545466|ref|YP_409413.1| D-3-phosphoglycerate dehydrogenase [Shigella boydii Sb227]
 gi|89109691|ref|AP_003471.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli str. K-12
           substr. W3110]
 gi|91212292|ref|YP_542278.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli UTI89]
 gi|110806814|ref|YP_690334.1| D-3-phosphoglycerate dehydrogenase [Shigella flexneri 5 str. 8401]
 gi|117625142|ref|YP_854130.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli APEC O1]
 gi|157156494|ref|YP_001464251.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli E24377A]
 gi|157162372|ref|YP_001459690.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli HS]
 gi|168747604|ref|ZP_02772626.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168753855|ref|ZP_02778862.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168760045|ref|ZP_02785052.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4501]
 gi|168766910|ref|ZP_02791917.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773457|ref|ZP_02798464.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168781762|ref|ZP_02806769.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168785763|ref|ZP_02810770.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC869]
 gi|168797478|ref|ZP_02822485.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC508]
 gi|170018842|ref|YP_001723796.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli ATCC 8739]
 gi|170082472|ref|YP_001731792.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170683573|ref|YP_001745066.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli SMS-3-5]
 gi|188492574|ref|ZP_02999844.1| phosphoglycerate dehydrogenase [Escherichia coli 53638]
 gi|191168219|ref|ZP_03030014.1| phosphoglycerate dehydrogenase [Escherichia coli B7A]
 gi|193063512|ref|ZP_03044601.1| phosphoglycerate dehydrogenase [Escherichia coli E22]
 gi|193067273|ref|ZP_03048241.1| phosphoglycerate dehydrogenase [Escherichia coli E110019]
 gi|194426244|ref|ZP_03058799.1| phosphoglycerate dehydrogenase [Escherichia coli B171]
 gi|194431787|ref|ZP_03064078.1| phosphoglycerate dehydrogenase [Shigella dysenteriae 1012]
 gi|195936531|ref|ZP_03081913.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4024]
 gi|208806478|ref|ZP_03248815.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208811833|ref|ZP_03253162.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208819354|ref|ZP_03259674.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209398529|ref|YP_002272388.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209920366|ref|YP_002294450.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli SE11]
 gi|217326934|ref|ZP_03443017.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218555461|ref|YP_002388374.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli IAI1]
 gi|218559904|ref|YP_002392817.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli S88]
 gi|218691036|ref|YP_002399248.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli ED1a]
 gi|218701620|ref|YP_002409249.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli IAI39]
 gi|218706417|ref|YP_002413936.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli UMN026]
 gi|227888462|ref|ZP_04006267.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 83972]
 gi|237706440|ref|ZP_04536921.1| D-3-phosphoglycerate dehydrogenase [Escherichia sp. 3_2_53FAA]
 gi|238902037|ref|YP_002927833.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli BW2952]
 gi|253772247|ref|YP_003035078.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162824|ref|YP_003045932.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli B str. REL606]
 gi|254794862|ref|YP_003079699.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           TW14359]
 gi|256019289|ref|ZP_05433154.1| D-3-phosphoglycerate dehydrogenase [Shigella sp. D9]
 gi|256024577|ref|ZP_05438442.1| D-3-phosphoglycerate dehydrogenase [Escherichia sp. 4_1_40B]
 gi|260845581|ref|YP_003223359.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O103:H2 str.
           12009]
 gi|260857035|ref|YP_003230926.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O26:H11 str.
           11368]
 gi|260869589|ref|YP_003235991.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O111:H- str.
           11128]
 gi|261226224|ref|ZP_05940505.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261256521|ref|ZP_05949054.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291284231|ref|YP_003501049.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O55:H7 str.
           CB9615]
 gi|293406411|ref|ZP_06650337.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli FVEC1412]
 gi|293412271|ref|ZP_06654994.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293416166|ref|ZP_06658806.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli B185]
 gi|293449235|ref|ZP_06663656.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli B088]
 gi|298382147|ref|ZP_06991744.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli FVEC1302]
 gi|300815635|ref|ZP_07095859.1| phosphoglycerate dehydrogenase [Escherichia coli MS 107-1]
 gi|300820717|ref|ZP_07100868.1| phosphoglycerate dehydrogenase [Escherichia coli MS 119-7]
 gi|300896191|ref|ZP_07114740.1| phosphoglycerate dehydrogenase [Escherichia coli MS 198-1]
 gi|300906534|ref|ZP_07124227.1| phosphoglycerate dehydrogenase [Escherichia coli MS 84-1]
 gi|300921246|ref|ZP_07137618.1| phosphoglycerate dehydrogenase [Escherichia coli MS 115-1]
 gi|300928150|ref|ZP_07143693.1| phosphoglycerate dehydrogenase [Escherichia coli MS 187-1]
 gi|300936020|ref|ZP_07150968.1| phosphoglycerate dehydrogenase [Escherichia coli MS 21-1]
 gi|300947638|ref|ZP_07161808.1| phosphoglycerate dehydrogenase [Escherichia coli MS 116-1]
 gi|300954244|ref|ZP_07166709.1| phosphoglycerate dehydrogenase [Escherichia coli MS 175-1]
 gi|300980293|ref|ZP_07174947.1| phosphoglycerate dehydrogenase [Escherichia coli MS 45-1]
 gi|301027372|ref|ZP_07190712.1| phosphoglycerate dehydrogenase [Escherichia coli MS 69-1]
 gi|301027786|ref|ZP_07191092.1| phosphoglycerate dehydrogenase [Escherichia coli MS 196-1]
 gi|301303072|ref|ZP_07209199.1| phosphoglycerate dehydrogenase [Escherichia coli MS 124-1]
 gi|301643735|ref|ZP_07243774.1| phosphoglycerate dehydrogenase [Escherichia coli MS 146-1]
 gi|306812186|ref|ZP_07446384.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli NC101]
 gi|307139600|ref|ZP_07498956.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli H736]
 gi|307310469|ref|ZP_07590117.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Escherichia coli W]
 gi|309793986|ref|ZP_07688411.1| phosphoglycerate dehydrogenase [Escherichia coli MS 145-7]
 gi|312972846|ref|ZP_07787019.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 1827-70]
 gi|331643604|ref|ZP_08344735.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli H736]
 gi|331648659|ref|ZP_08349747.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli M605]
 gi|331654412|ref|ZP_08355412.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli M718]
 gi|331659041|ref|ZP_08359983.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli TA206]
 gi|331664486|ref|ZP_08365392.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli TA143]
 gi|331669648|ref|ZP_08370494.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli TA271]
 gi|331674397|ref|ZP_08375157.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli TA280]
 gi|331678900|ref|ZP_08379574.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli H591]
 gi|331684538|ref|ZP_08385130.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli H299]
 gi|71162364|sp|P0A9T2|SERA_ECO57 RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|71162365|sp|P0A9T1|SERA_ECOL6 RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|71162366|sp|P0A9T0|SERA_ECOLI RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|71162367|sp|P0A9T3|SERA_SHIFL RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|12517443|gb|AAG58040.1|AE005521_8 D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EDL933]
 gi|26109737|gb|AAN81942.1|AE016766_30 D-3-phosphoglycerate dehydrogenase [Escherichia coli CFT073]
 gi|459755|gb|AAA24625.1| phosphoglycerate dehydrogenase [Escherichia coli]
 gi|882442|gb|AAA69080.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli str. K-12
           substr. MG1655]
 gi|1789279|gb|AAC75950.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli str. K-12
           substr. MG1655]
 gi|13363256|dbj|BAB37207.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           Sakai]
 gi|24053306|gb|AAN44382.1| D-3-phosphoglycerate dehydrogenase [Shigella flexneri 2a str. 301]
 gi|30042480|gb|AAP18204.1| D-3-phosphoglycerate dehydrogenase [Shigella flexneri 2a str.
           2457T]
 gi|73856947|gb|AAZ89654.1| D-3-phosphoglycerate dehydrogenase [Shigella sonnei Ss046]
 gi|81246877|gb|ABB67585.1| D-3-phosphoglycerate dehydrogenase [Shigella boydii Sb227]
 gi|85675724|dbj|BAE76977.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli str. K12
           substr. W3110]
 gi|91073866|gb|ABE08747.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli UTI89]
 gi|110616362|gb|ABF05029.1| D-3-phosphoglycerate dehydrogenase [Shigella flexneri 5 str. 8401]
 gi|115514266|gb|ABJ02341.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli APEC O1]
 gi|157068052|gb|ABV07307.1| phosphoglycerate dehydrogenase [Escherichia coli HS]
 gi|157078524|gb|ABV18232.1| phosphoglycerate dehydrogenase [Escherichia coli E24377A]
 gi|169753770|gb|ACA76469.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Escherichia coli ATCC 8739]
 gi|169890307|gb|ACB04014.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170521291|gb|ACB19469.1| phosphoglycerate dehydrogenase [Escherichia coli SMS-3-5]
 gi|187770872|gb|EDU34716.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017939|gb|EDU56061.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4113]
 gi|188487773|gb|EDU62876.1| phosphoglycerate dehydrogenase [Escherichia coli 53638]
 gi|189000621|gb|EDU69607.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189358531|gb|EDU76950.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189363684|gb|EDU82103.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189369216|gb|EDU87632.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189373809|gb|EDU92225.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC869]
 gi|189379849|gb|EDU98265.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC508]
 gi|190901761|gb|EDV61515.1| phosphoglycerate dehydrogenase [Escherichia coli B7A]
 gi|192930789|gb|EDV83394.1| phosphoglycerate dehydrogenase [Escherichia coli E22]
 gi|192959230|gb|EDV89665.1| phosphoglycerate dehydrogenase [Escherichia coli E110019]
 gi|194415552|gb|EDX31819.1| phosphoglycerate dehydrogenase [Escherichia coli B171]
 gi|194420143|gb|EDX36221.1| phosphoglycerate dehydrogenase [Shigella dysenteriae 1012]
 gi|208726279|gb|EDZ75880.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208733110|gb|EDZ81797.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739477|gb|EDZ87159.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209159929|gb|ACI37362.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209760408|gb|ACI78516.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli]
 gi|209760410|gb|ACI78517.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli]
 gi|209760412|gb|ACI78518.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli]
 gi|209760414|gb|ACI78519.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli]
 gi|209760416|gb|ACI78520.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli]
 gi|209913625|dbj|BAG78699.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli SE11]
 gi|217319301|gb|EEC27726.1| phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218362229|emb|CAQ99847.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli IAI1]
 gi|218366673|emb|CAR04427.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli S88]
 gi|218371606|emb|CAR19445.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli IAI39]
 gi|218428600|emb|CAR09527.2| D-3-phosphoglycerate dehydrogenase [Escherichia coli ED1a]
 gi|218433514|emb|CAR14417.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli UMN026]
 gi|226899480|gb|EEH85739.1| D-3-phosphoglycerate dehydrogenase [Escherichia sp. 3_2_53FAA]
 gi|227834731|gb|EEJ45197.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 83972]
 gi|238860718|gb|ACR62716.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli BW2952]
 gi|242378443|emb|CAQ33224.1| D-3-phosphoglycerate dehydrogenase / alpha-ketoglutarate reductase
           [Escherichia coli BL21(DE3)]
 gi|253323291|gb|ACT27893.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253974725|gb|ACT40396.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli B str. REL606]
 gi|253978891|gb|ACT44561.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli BL21(DE3)]
 gi|254594262|gb|ACT73623.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           TW14359]
 gi|257755684|dbj|BAI27186.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O26:H11 str.
           11368]
 gi|257760728|dbj|BAI32225.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O103:H2 str.
           12009]
 gi|257765945|dbj|BAI37440.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O111:H- str.
           11128]
 gi|260448042|gb|ACX38464.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Escherichia coli DH1]
 gi|281179916|dbj|BAI56246.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli SE15]
 gi|281602245|gb|ADA75229.1| D-3-phosphoglycerate dehydrogenase [Shigella flexneri 2002017]
 gi|284922859|emb|CBG35948.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 042]
 gi|290764104|gb|ADD58065.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O55:H7 str.
           CB9615]
 gi|291322325|gb|EFE61754.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli B088]
 gi|291426417|gb|EFE99449.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli FVEC1412]
 gi|291432355|gb|EFF05337.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli B185]
 gi|291469042|gb|EFF11533.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294490637|gb|ADE89393.1| phosphoglycerate dehydrogenase [Escherichia coli IHE3034]
 gi|298277287|gb|EFI18803.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli FVEC1302]
 gi|299879120|gb|EFI87331.1| phosphoglycerate dehydrogenase [Escherichia coli MS 196-1]
 gi|300318828|gb|EFJ68612.1| phosphoglycerate dehydrogenase [Escherichia coli MS 175-1]
 gi|300359925|gb|EFJ75795.1| phosphoglycerate dehydrogenase [Escherichia coli MS 198-1]
 gi|300395072|gb|EFJ78610.1| phosphoglycerate dehydrogenase [Escherichia coli MS 69-1]
 gi|300401710|gb|EFJ85248.1| phosphoglycerate dehydrogenase [Escherichia coli MS 84-1]
 gi|300409301|gb|EFJ92839.1| phosphoglycerate dehydrogenase [Escherichia coli MS 45-1]
 gi|300411788|gb|EFJ95098.1| phosphoglycerate dehydrogenase [Escherichia coli MS 115-1]
 gi|300452753|gb|EFK16373.1| phosphoglycerate dehydrogenase [Escherichia coli MS 116-1]
 gi|300458812|gb|EFK22305.1| phosphoglycerate dehydrogenase [Escherichia coli MS 21-1]
 gi|300463841|gb|EFK27334.1| phosphoglycerate dehydrogenase [Escherichia coli MS 187-1]
 gi|300526981|gb|EFK48050.1| phosphoglycerate dehydrogenase [Escherichia coli MS 119-7]
 gi|300531564|gb|EFK52626.1| phosphoglycerate dehydrogenase [Escherichia coli MS 107-1]
 gi|300841736|gb|EFK69496.1| phosphoglycerate dehydrogenase [Escherichia coli MS 124-1]
 gi|301077937|gb|EFK92743.1| phosphoglycerate dehydrogenase [Escherichia coli MS 146-1]
 gi|305854224|gb|EFM54662.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli NC101]
 gi|306909364|gb|EFN39859.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Escherichia coli W]
 gi|307554891|gb|ADN47666.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli ABU 83972]
 gi|307625516|gb|ADN69820.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli UM146]
 gi|308122393|gb|EFO59655.1| phosphoglycerate dehydrogenase [Escherichia coli MS 145-7]
 gi|309703272|emb|CBJ02607.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli ETEC H10407]
 gi|310332788|gb|EFQ00002.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 1827-70]
 gi|313647953|gb|EFS12399.1| D-3-phosphoglycerate dehydrogenase [Shigella flexneri 2a str.
           2457T]
 gi|315062216|gb|ADT76543.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli W]
 gi|315137511|dbj|BAJ44670.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli DH1]
 gi|315256797|gb|EFU36765.1| phosphoglycerate dehydrogenase [Escherichia coli MS 85-1]
 gi|315289477|gb|EFU48872.1| phosphoglycerate dehydrogenase [Escherichia coli MS 110-3]
 gi|315293907|gb|EFU53259.1| phosphoglycerate dehydrogenase [Escherichia coli MS 153-1]
 gi|315295701|gb|EFU55021.1| phosphoglycerate dehydrogenase [Escherichia coli MS 16-3]
 gi|315614930|gb|EFU95568.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 3431]
 gi|320184542|gb|EFW59343.1| D-3-phosphoglycerate dehydrogenase [Shigella flexneri CDC 796-83]
 gi|320189256|gb|EFW63915.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320195031|gb|EFW69660.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli WV_060327]
 gi|320202574|gb|EFW77144.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli EC4100B]
 gi|320640555|gb|EFX10094.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           G5101]
 gi|320645802|gb|EFX14787.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H- str.
           493-89]
 gi|320651102|gb|EFX19542.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H- str. H
           2687]
 gi|320656598|gb|EFX24494.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662117|gb|EFX29518.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320667192|gb|EFX34155.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323154606|gb|EFZ40805.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli EPECa14]
 gi|323162494|gb|EFZ48344.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli E128010]
 gi|323168044|gb|EFZ53733.1| D-3-phosphoglycerate dehydrogenase [Shigella sonnei 53G]
 gi|323173911|gb|EFZ59540.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli LT-68]
 gi|323180359|gb|EFZ65911.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 1180]
 gi|323183468|gb|EFZ68865.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli 1357]
 gi|323377200|gb|ADX49468.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Escherichia coli KO11]
 gi|323936081|gb|EGB32376.1| D-isomer specific 2-hydroxyacid dehydrogenase [Escherichia coli
           E1520]
 gi|323941997|gb|EGB38176.1| D-isomer specific 2-hydroxyacid dehydrogenase [Escherichia coli
           E482]
 gi|323946602|gb|EGB42625.1| D-isomer specific 2-hydroxyacid dehydrogenase [Escherichia coli
           H120]
 gi|323951650|gb|EGB47525.1| D-isomer specific 2-hydroxyacid dehydrogenase [Escherichia coli
           H252]
 gi|323957367|gb|EGB53089.1| D-isomer specific 2-hydroxyacid dehydrogenase [Escherichia coli
           H263]
 gi|323960791|gb|EGB56412.1| D-isomer specific 2-hydroxyacid dehydrogenase [Escherichia coli
           H489]
 gi|323971738|gb|EGB66966.1| D-isomer specific 2-hydroxyacid dehydrogenase [Escherichia coli
           TA007]
 gi|323978795|gb|EGB73876.1| D-isomer specific 2-hydroxyacid dehydrogenase [Escherichia coli
           TW10509]
 gi|324005565|gb|EGB74784.1| phosphoglycerate dehydrogenase [Escherichia coli MS 57-2]
 gi|324017232|gb|EGB86451.1| phosphoglycerate dehydrogenase [Escherichia coli MS 117-3]
 gi|324119705|gb|EGC13585.1| D-isomer specific 2-hydroxyacid dehydrogenase [Escherichia coli
           E1167]
 gi|326339003|gb|EGD62818.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           1044]
 gi|326343114|gb|EGD66882.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli O157:H7 str.
           1125]
 gi|330908944|gb|EGH37458.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli AA86]
 gi|331037075|gb|EGI09299.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli H736]
 gi|331042406|gb|EGI14548.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli M605]
 gi|331047794|gb|EGI19871.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli M718]
 gi|331053623|gb|EGI25652.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli TA206]
 gi|331058417|gb|EGI30398.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli TA143]
 gi|331063316|gb|EGI35229.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli TA271]
 gi|331068491|gb|EGI39886.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli TA280]
 gi|331073730|gb|EGI45051.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli H591]
 gi|331078153|gb|EGI49359.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli H299]
 gi|332086838|gb|EGI91974.1| D-3-phosphoglycerate dehydrogenase [Shigella boydii 5216-82]
 gi|332087673|gb|EGI92800.1| D-3-phosphoglycerate dehydrogenase [Shigella dysenteriae 155-74]
 gi|332090963|gb|EGI96054.1| D-3-phosphoglycerate dehydrogenase [Shigella boydii 3594-74]
 gi|332102751|gb|EGJ06097.1| D-3-phosphoglycerate dehydrogenase [Shigella sp. D9]
          Length = 410

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQAMKAIPGTIRARLL 409


>gi|157879670|pdb|1PSD|A Chain A, The Allosteric Ligand Site In The Vmax-Type Cooperative
           Enzyme Phosphoglycerate Dehydrogenase
 gi|157879671|pdb|1PSD|B Chain B, The Allosteric Ligand Site In The Vmax-Type Cooperative
           Enzyme Phosphoglycerate Dehydrogenase
          Length = 406

 Score = 80.9 bits (199), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 319 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 377

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 378 EADEDVAEKALQAMKAIPGTIRARLL 403


>gi|300870001|ref|YP_003784872.1| D-3-phosphoglycerate dehydrogenase [Brachyspira pilosicoli 95/1000]
 gi|300687700|gb|ADK30371.1| D-3-phosphoglycerate dehydrogenase [Brachyspira pilosicoli 95/1000]
          Length = 534

 Score = 80.5 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 14/96 (14%), Positives = 40/96 (41%), Gaps = 1/96 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +    R +K+ + +  +     ++ + + +   ++  V   L   GINI   ++  +   
Sbjct: 433 AKNIARIVKLNDYDVIIKPQPHILIVPHINQPAMIAKVATTLSSDGINIGSMNVSENIKG 492

Query: 63  -EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +I  + +D  I + +++K+S    +   K  + 
Sbjct: 493 SNMSIMAINVDRIIESDMIDKISQIDGVHQPKYIKL 528


>gi|118617543|ref|YP_905875.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium ulcerans Agy99]
 gi|118569653|gb|ABL04404.1| D-3-phosphoglycerate dehydrogenase SerA1 [Mycobacterium ulcerans
           Agy99]
          Length = 528

 Score = 80.5 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 35/90 (38%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   +FD+      + +   D  G +  +G +LG  G+NI    L        A  
Sbjct: 438 KIVQINGRHFDLRAEGTNLIVNYVDQPGALGKIGTLLGAAGVNIHAAQLSEDVEGPGATV 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  +   V   ++  V    ++  + 
Sbjct: 498 LLRLDQDVPEDVRSAIAAAVGANRLEVVDL 527


>gi|82778323|ref|YP_404672.1| D-3-phosphoglycerate dehydrogenase [Shigella dysenteriae Sd197]
 gi|309785277|ref|ZP_07679908.1| D-3-phosphoglycerate dehydrogenase [Shigella dysenteriae 1617]
 gi|81242471|gb|ABB63181.1| D-3-phosphoglycerate dehydrogenase [Shigella dysenteriae Sd197]
 gi|308926397|gb|EFP71873.1| D-3-phosphoglycerate dehydrogenase [Shigella dysenteriae 1617]
          Length = 410

 Score = 80.5 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQAMKAIPGTIRARLL 409


>gi|194436762|ref|ZP_03068862.1| phosphoglycerate dehydrogenase [Escherichia coli 101-1]
 gi|254037959|ref|ZP_04872017.1| phosphoglycerate dehydrogenase [Escherichia sp. 1_1_43]
 gi|194424244|gb|EDX40231.1| phosphoglycerate dehydrogenase [Escherichia coli 101-1]
 gi|226839583|gb|EEH71604.1| phosphoglycerate dehydrogenase [Escherichia sp. 1_1_43]
          Length = 410

 Score = 80.5 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQAMKAIPGTIRARLL 409


>gi|218550161|ref|YP_002383952.1| D-3-phosphoglycerate dehydrogenase [Escherichia fergusonii ATCC
           35469]
 gi|218357702|emb|CAQ90344.1| D-3-phosphoglycerate dehydrogenase [Escherichia fergusonii ATCC
           35469]
 gi|324115069|gb|EGC09034.1| D-isomer specific 2-hydroxyacid dehydrogenase [Escherichia
           fergusonii B253]
 gi|325498473|gb|EGC96332.1| D-3-phosphoglycerate dehydrogenase [Escherichia fergusonii ECD227]
          Length = 410

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 384 EADEDVAEKALQAMKAIPGTIRARLL 409


>gi|183981728|ref|YP_001850019.1| D-3-phosphoglycerate dehydrogenase SerA1 [Mycobacterium marinum M]
 gi|183175054|gb|ACC40164.1| D-3-phosphoglycerate dehydrogenase SerA1 [Mycobacterium marinum M]
          Length = 528

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 35/90 (38%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   +FD+      + +   D  G +  +G +LG  G+NI    L        A  
Sbjct: 438 KIVQINGRHFDLRAEGTNLIVNYVDQPGALGKIGTLLGAAGVNIHAAQLSEDVEGPGATV 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
            L +D  +   V   ++  V    ++  + 
Sbjct: 498 LLRLDQDVPEDVRSAIAAAVGANRLEVVDL 527


>gi|146280793|ref|YP_001170946.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas stutzeri A1501]
 gi|145568998|gb|ABP78104.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas stutzeri A1501]
          Length = 468

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  + GINI    L  ++   +    +
Sbjct: 384 VNFPEVALPSHPGKHRLLHIHQNIPGVMSEINKVFADNGINICGQFLQTNEKVGYV--VI 441

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +  LEKL         +  
Sbjct: 442 DVDKEYSDLALEKLQHVNGTIRSRVL 467


>gi|213964733|ref|ZP_03392933.1| phosphoglycerate dehydrogenase [Corynebacterium amycolatum SK46]
 gi|213952926|gb|EEB64308.1| phosphoglycerate dehydrogenase [Corynebacterium amycolatum SK46]
          Length = 531

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 39/93 (41%), Gaps = 2/93 (2%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I     D+      + ++  D+ G +  V   LGE GINI    L   ++ + AI 
Sbjct: 441 KIVRINGRGIDMRAQGRNLFLLYKDVPGALGRVATTLGESGINIEAAALSPQEADQTAIL 500

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
            L +   +   ++EK+     I      +  +D
Sbjct: 501 VLRVSKEVPEELVEKI--TEEISATHALQLELD 531


>gi|145224813|ref|YP_001135491.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium gilvum PYR-GCK]
 gi|315445143|ref|YP_004078022.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. Spyr1]
 gi|145217299|gb|ABP46703.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium gilvum PYR-GCK]
 gi|315263446|gb|ADU00188.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. Spyr1]
          Length = 528

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 35/92 (38%), Gaps = 5/92 (5%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   N D+    + + I   D  G +  +G +LG   +NI    L +    E A  
Sbjct: 438 KIVQINGRNLDLRAEGVNVIINYHDQPGALGKIGTLLGGANVNILAAQLSQDADGEGATI 497

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            L +D  +   VL  +      R V      V
Sbjct: 498 MLRVDREVPADVLAGIG-----RDVNALTLEV 524


>gi|169619920|ref|XP_001803372.1| hypothetical protein SNOG_13160 [Phaeosphaeria nodorum SN15]
 gi|111058367|gb|EAT79487.1| hypothetical protein SNOG_13160 [Phaeosphaeria nodorum SN15]
          Length = 571

 Score = 80.5 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 39/101 (38%), Gaps = 6/101 (5%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS- 61
           S  KP   ++     +      ++   N D  G + FVGN+LG+ G+NI   ++   +  
Sbjct: 471 SGNKPFISRLDRFKGEFVPKGTLLICRNFDSCGKIGFVGNLLGKAGVNIKFMNVAPLEEE 530

Query: 62  -----TEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                   A+  L +D ++   V + L     +       F
Sbjct: 531 VEGEGKNEALMILGVDRAVGEDVKKALIGPEGVLEASVVNF 571


>gi|330505478|ref|YP_004382347.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas mendocina NK-01]
 gi|328919764|gb|AEB60595.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas mendocina NK-01]
          Length = 409

 Score = 80.5 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ ++ G++  +  +  + GINI+   L  +    +    +
Sbjct: 325 VNFPEVALPAHAGKHRLLHIHENVPGVMSEINKVFADNGINISGQFLQTNDKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +  LEKL         +  
Sbjct: 383 DVDAEYSDLALEKLQQVHGTIRSRVL 408


>gi|225619505|ref|YP_002720762.1| D-3-phosphoglycerate dehydrogenase [Brachyspira hyodysenteriae WA1]
 gi|225214324|gb|ACN83058.1| D-3-phosphoglycerate dehydrogenase [Brachyspira hyodysenteriae WA1]
          Length = 534

 Score = 80.5 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 16/96 (16%), Positives = 38/96 (39%), Gaps = 1/96 (1%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +    R +K  + +  +     ++ + + +   ++  V  +L   GINI    +  +   
Sbjct: 433 AKNIARIVKFNDYDVIIKPQPHILIVPHINQPAMIAKVATVLSGDGINIGSMSVSENIKG 492

Query: 63  -EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
              +I  + +D  I N V+ K+S    ++  K    
Sbjct: 493 SSTSIMAINVDRVIGNDVITKISNIEGVQDPKYVRL 528


>gi|225571915|ref|ZP_03780785.1| hypothetical protein CLOHYLEM_07889 [Clostridium hylemonae DSM
          15053]
 gi|225159428|gb|EEG72047.1| hypothetical protein CLOHYLEM_07889 [Clostridium hylemonae DSM
          15053]
          Length = 94

 Score = 80.5 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 32/88 (36%)

Query: 11 KIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLC 70
          K+  I+         + + N D  G +  V   L E  I+IA   + R +    A+  + 
Sbjct: 1  KLDGIDVSFSGESNTLIVRNIDQPGCITEVAASLSEEDIDIATMQVFRDKKGGCAVMVVE 60

Query: 71 IDGSILNSVLEKLSVNVTIRFVKQFEFN 98
           D  +    L++L     I  V     N
Sbjct: 61 TDQVVSRDALDRLEGKEGIVNVTFLNVN 88


>gi|310826350|ref|YP_003958707.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding-protein
           [Eubacterium limosum KIST612]
 gi|308738084|gb|ADO35744.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding-protein
           [Eubacterium limosum KIST612]
          Length = 389

 Score = 80.5 bits (198), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 14/94 (14%), Positives = 35/94 (37%), Gaps = 2/94 (2%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +      +     +  V      I + + +I  ++  +  +L  + INI+          
Sbjct: 298 NGNIVNSVNYPNCSMGVCNSVHRITVNHRNIPNMIGQITAVLAGHNINISDMT--NKNRG 355

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E A + + +D  + ++V E L     +  V+  +
Sbjct: 356 EWAYTMIDVDSEVGDNVKEALKTIEGVTRVRVLK 389


>gi|330806932|ref|YP_004351394.1| Phosphoglycerate dehydrogenase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375040|gb|AEA66390.1| Phosphoglycerate dehydrogenase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 409

 Score = 80.1 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVMSEINKVFAENGINISGQFLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +   EKL         +  
Sbjct: 383 DVDAEYSDLAQEKLQHINGTIRCRVL 408


>gi|86146378|ref|ZP_01064702.1| Phosphoglycerate dehydrogenase [Vibrio sp. MED222]
 gi|85835857|gb|EAQ53991.1| Phosphoglycerate dehydrogenase [Vibrio sp. MED222]
          Length = 235

 Score = 80.1 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 33/87 (37%), Gaps = 2/87 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +  G   +  ++ +  GI+  +  I  E GINIA  +L  +    +    +
Sbjct: 151 VNFPEVSLPLHTGTSRLLHIHENRPGILTQINTIFAEEGINIAGQYLQTAADMGYV--VI 208

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQFE 96
            ++ +     L KL         +   
Sbjct: 209 DVEANRSEEALLKLKEIEGTIRARLLH 235


>gi|311742093|ref|ZP_07715903.1| D-3-phosphoglycerate dehydrogenase [Aeromicrobium marinum DSM
           15272]
 gi|311314586|gb|EFQ84493.1| D-3-phosphoglycerate dehydrogenase [Aeromicrobium marinum DSM
           15272]
          Length = 418

 Score = 80.1 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 37/93 (39%), Gaps = 2/93 (2%)

Query: 4   DGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTE 63
                 + + E+N  VD  +  +  V+ +  G++  V  +LGE G+NI    L      E
Sbjct: 328 GSTAMSVNLPELNLPVDPEKHRLAHVHRNAPGVLASVNTLLGERGVNIEGQQLAT--RGE 385

Query: 64  HAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
                  +   +  SVL +L+       ++Q  
Sbjct: 386 LGYVVTDVGAEVQPSVLAELAELPETVRLRQLS 418


>gi|296112486|ref|YP_003626424.1| D-3-phosphoglycerate dehydrogenase [Moraxella catarrhalis RH4]
 gi|295920180|gb|ADG60531.1| D-3-phosphoglycerate dehydrogenase [Moraxella catarrhalis RH4]
 gi|326561526|gb|EGE11869.1| D-3-phosphoglycerate dehydrogenase [Moraxella catarrhalis 7169]
 gi|326566157|gb|EGE16312.1| D-3-phosphoglycerate dehydrogenase [Moraxella catarrhalis 12P80B1]
 gi|326567996|gb|EGE18088.1| D-3-phosphoglycerate dehydrogenase [Moraxella catarrhalis BC7]
 gi|326570702|gb|EGE20736.1| D-3-phosphoglycerate dehydrogenase [Moraxella catarrhalis BC1]
 gi|326571257|gb|EGE21280.1| D-3-phosphoglycerate dehydrogenase [Moraxella catarrhalis BC8]
 gi|326573061|gb|EGE23034.1| D-3-phosphoglycerate dehydrogenase [Moraxella catarrhalis CO72]
 gi|326577820|gb|EGE27688.1| D-3-phosphoglycerate dehydrogenase [Moraxella catarrhalis O35E]
          Length = 408

 Score = 80.1 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 11/86 (12%), Positives = 31/86 (36%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +    ++     G   +  ++ ++ G++  +     + GINI    L      +     +
Sbjct: 324 VNFPNVSIPFTDGTHRLLHIHRNVPGVLSQINASFADAGINIIAQSLMT--KGDVGYLVM 381

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D +  +  L++L        V+  
Sbjct: 382 DVDDNDSDRALKRLRAVPETIRVRVL 407


>gi|326564347|gb|EGE14576.1| D-3-phosphoglycerate dehydrogenase [Moraxella catarrhalis 46P47B1]
          Length = 408

 Score = 80.1 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 11/86 (12%), Positives = 31/86 (36%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +    ++     G   +  ++ ++ G++  +     + GINI    L      +     +
Sbjct: 324 VNFPNVSIPFTDGTHRLLHIHRNVPGVLSQINASFADAGINIIAQSLMT--KGDVGYLVM 381

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D +  +  L++L        V+  
Sbjct: 382 DVDDNDSDRALKRLRAVPETIRVRVL 407


>gi|166030919|ref|ZP_02233748.1| hypothetical protein DORFOR_00600 [Dorea formicigenerans ATCC
           27755]
 gi|166029186|gb|EDR47943.1| hypothetical protein DORFOR_00600 [Dorea formicigenerans ATCC
           27755]
          Length = 387

 Score = 80.1 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 38/94 (40%), Gaps = 2/94 (2%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +      +   + +  V      I +++ ++  ++     IL +  +NIA          
Sbjct: 296 NGNIQHSVNYPDCDMGVKGENTRITLLHHNVPNMIGQFTKILADDNMNIADMT--NKSKG 353

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           E+A + + ID  + +SV+E L+    +  V+   
Sbjct: 354 EYAYTMIDIDSDVTDSVIEDLTKVKDVLRVRVIR 387


>gi|148652381|ref|YP_001279474.1| D-3-phosphoglycerate dehydrogenase [Psychrobacter sp. PRwf-1]
 gi|148571465|gb|ABQ93524.1| D-3-phosphoglycerate dehydrogenase [Psychrobacter sp. PRwf-1]
          Length = 408

 Score = 80.1 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 31/86 (36%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  V  G   +  ++ ++ G++  + +     GINI    L      +     +
Sbjct: 324 VNFPEVSIPVKEGSHRLLHIHKNVPGVLSQINSSFASAGINILAQSLMT--EGDVGYLVM 381

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D       L+KL        V+  
Sbjct: 382 DVDNRNSQEALDKLRDIEETIRVRVL 407


>gi|28872406|ref|NP_795025.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213971995|ref|ZP_03400092.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           T1]
 gi|301384886|ref|ZP_07233304.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063032|ref|ZP_07254573.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           K40]
 gi|302133847|ref|ZP_07259837.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28855661|gb|AAO58720.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213923257|gb|EEB56855.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv. tomato
           T1]
 gi|330874161|gb|EGH08310.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330967066|gb|EGH67326.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331017037|gb|EGH97093.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 409

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVLSEINKVFAENGINISGQFLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +    KL         +  
Sbjct: 383 DVDAEYSDLAQAKLQHIKGTIRSRVL 408


>gi|83644490|ref|YP_432925.1| D-3-phosphoglycerate dehydrogenase [Hahella chejuensis KCTC 2396]
 gi|83632533|gb|ABC28500.1| Phosphoglycerate dehydrogenase and related dehydrogenase [Hahella
           chejuensis KCTC 2396]
          Length = 436

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 10/86 (11%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++         +  ++ ++ G++  + ++  + GINI   +L  +    +    +
Sbjct: 352 VNFPEVSLPSHPQNHRLLHIHENVPGVLSEINSVFSDNGINICGQYLQTNDKVGYV--VV 409

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            ++    +  L+KL         +  
Sbjct: 410 DVNKDYSDLALQKLKSVKGTIRCRVL 435


>gi|326566146|gb|EGE16302.1| D-3-phosphoglycerate dehydrogenase [Moraxella catarrhalis 103P14B1]
 gi|326577241|gb|EGE27134.1| D-3-phosphoglycerate dehydrogenase [Moraxella catarrhalis 101P30B1]
          Length = 408

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 11/86 (12%), Positives = 31/86 (36%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +    ++     G   +  ++ ++ G++  +     + GINI    L      +     +
Sbjct: 324 VNFPNVSIPFTDGTHRLLHIHRNVPGVLSQINASFADAGINIIAQSLMT--KGDVGYLVM 381

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D +  +  L++L        V+  
Sbjct: 382 DVDDNDSDRALKRLRAVPETIRVRVL 407


>gi|313608154|gb|EFR84205.1| probable L-serine dehydratase, beta chain [Listeria monocytogenes
          FSL F2-208]
          Length = 87

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 15/82 (18%), Positives = 37/82 (45%)

Query: 11 KIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLC 70
          ++ E   +       I I++ D  G +  V +++ ++ INI    + R    + A+  + 
Sbjct: 1  RLNEFELEFTGTAPAILILHQDKFGAIAAVSSVIADHKINIGQMKVSRKVKGDEALMVIE 60

Query: 71 IDGSILNSVLEKLSVNVTIRFV 92
          +D  +  +++ K++    I  V
Sbjct: 61 VDQHVEQALISKIAELPGIYQV 82


>gi|86211233|gb|ABC87292.1| putative phosphoglycerate dehydrogenase [Ceratopteris richardii]
          Length = 262

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 40/91 (43%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
           P   K+ E + D  +   +I     D  G++  VGNILG+  IN+    +GR    + A+
Sbjct: 172 PHLCKVGEFDVDASLEGSVILTRQQDQPGMIGIVGNILGDENINVNFMSVGRIAPRKEAL 231

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
             + +D     + L+++     ++     + 
Sbjct: 232 MAIGLDDEPTQAALKRIGSIPELQEYVYLKL 262


>gi|104784158|ref|YP_610656.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas entomophila L48]
 gi|95113145|emb|CAK17873.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas entomophila L48]
          Length = 409

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L   +   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVLSEINKVFAENGINISGQFLQTDEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +   EKL         +  
Sbjct: 383 DVDAEYSDLAQEKLQHVKGTIRSRVL 408


>gi|84390084|ref|ZP_00991346.1| Phosphoglycerate dehydrogenase [Vibrio splendidus 12B01]
 gi|84376738|gb|EAP93613.1| Phosphoglycerate dehydrogenase [Vibrio splendidus 12B01]
          Length = 409

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 33/87 (37%), Gaps = 2/87 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +  G   +  ++ +  GI+  +  I  E GINIA  +L  +    +    +
Sbjct: 325 VNFPEVSLPLHTGASRLLHIHENRPGILTQINTIFAEEGINIAGQYLQTAADMGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQFE 96
            ++ +     L KL         +   
Sbjct: 383 DVEANRSEEALLKLKEIEGTIRARLLH 409


>gi|218710589|ref|YP_002418210.1| D-3-phosphoglycerate dehydrogenase [Vibrio splendidus LGP32]
 gi|218323608|emb|CAV19866.1| D-3-phosphoglycerate dehydrogenase [Vibrio splendidus LGP32]
          Length = 409

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 15/87 (17%), Positives = 33/87 (37%), Gaps = 2/87 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +  G   +  ++ +  GI+  +  I  E GINIA  +L  +    +    +
Sbjct: 325 VNFPEVSLPLHTGTSRLLHIHENRPGILTQINTIFAEEGINIAGQYLQTAADMGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQFE 96
            ++ +     L KL         +   
Sbjct: 383 DVEANRSEEALLKLKEIEGTIRARLLH 409


>gi|163784160|ref|ZP_02179098.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880568|gb|EDP74134.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 288

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 39/76 (51%)

Query: 2   FSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQS 61
           F    PR + I +   D++   +++   N D+ G++  VG +L  + INIA F LGR + 
Sbjct: 193 FYGKIPRIMLIDKYWIDIEPEGVILVFENKDVPGVIAKVGEVLARHSINIAGFRLGRIEK 252

Query: 62  TEHAISFLCIDGSILN 77
            + A+  L +D  +  
Sbjct: 253 GKIALGALQLDDKLNK 268


>gi|170719497|ref|YP_001747185.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas putida W619]
 gi|169757500|gb|ACA70816.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Pseudomonas putida W619]
          Length = 409

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVLSEINKVFAENGINISGQFLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +   EKL         +  
Sbjct: 383 DVDAEYSDLAQEKLQHVKGTIRSRVL 408


>gi|330961905|gb|EGH62165.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 409

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  E GINI+   L  ++   +    +
Sbjct: 325 VNFPEVALPAHPGKHRLLHIHENIPGVLSEINKVFAENGINISGQFLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +    KL         +  
Sbjct: 383 DVDAEYSDLAQAKLQHIKGTIRSRVL 408


>gi|269965767|ref|ZP_06179864.1| D-3-phosphoglycerate dehydrogenase [Vibrio alginolyticus 40B]
 gi|269829635|gb|EEZ83872.1| D-3-phosphoglycerate dehydrogenase [Vibrio alginolyticus 40B]
          Length = 410

 Score = 80.1 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 14/88 (15%), Positives = 31/88 (35%), Gaps = 3/88 (3%)

Query: 10  IKIQEINF-DVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISF 68
           +   E++  +       +  ++ +  GI+  +  I  E GINIA  +L  +    +    
Sbjct: 325 VNFPEVSLPEHSGECSRLLHIHKNRPGILTQINTIFAEEGINIAAQYLQTAAEIGYV--V 382

Query: 69  LCIDGSILNSVLEKLSVNVTIRFVKQFE 96
           + ++       L KL         +   
Sbjct: 383 IDVETERSEEALTKLKNIEGTIRARILH 410


>gi|326797229|ref|YP_004315049.1| phosphoglycerate dehydrogenase [Marinomonas mediterranea MMB-1]
 gi|326547993|gb|ADZ93213.1| Phosphoglycerate dehydrogenase [Marinomonas mediterranea MMB-1]
          Length = 409

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+          I  ++ +  G++  + ++  +  INI+  +L  ++S       +
Sbjct: 325 VNFPEVALPAQADMHRILHIHENRPGVLSKINSVFSDNNINISGQYLRTTESLG--YMVM 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D  +    LEK+         +  
Sbjct: 383 DVDAEMGELALEKVKEVDGTIRARVL 408


>gi|322710973|gb|EFZ02547.1| d-3-phosphoglycerate dehydrogenase [Metarhizium anisopliae ARSEF
           23]
          Length = 572

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/108 (23%), Positives = 42/108 (38%), Gaps = 13/108 (12%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR---- 58
           SD +    K+   N        +I + N D  G +  VG +LG +GINI +  +      
Sbjct: 465 SDKRVYISKLDCFNATFSPEGTLIILHNYDEPGKIGGVGMVLGSHGINIRYMQVASLDAE 524

Query: 59  ---------SQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                    +Q    A+  L +DG +   V+E L  +  +  V   + 
Sbjct: 525 ARQGHNTPPTQKDNEALMILGVDGEVDAKVMEGLRKSEGVLDVSLIQL 572


>gi|227548065|ref|ZP_03978114.1| phosphoglycerate dehydrogenase [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227079863|gb|EEI17826.1| phosphoglycerate dehydrogenase [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 554

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 37/92 (40%), Gaps = 3/92 (3%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + + I     D+      + +   D  G +  VG+ LGE GINI    L ++   + A+ 
Sbjct: 465 KIVNINGRGVDMRAEGRNLFLRYTDAPGALGKVGSTLGEAGINIEAAALTQAAKGDGAVL 524

Query: 68  FLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
            L ++  +   +   ++ +         + ++
Sbjct: 525 ILRVEREVPEELEAAIASS---IDASSIQIDL 553


>gi|301629882|ref|XP_002944061.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Xenopus
           (Silurana) tropicalis]
          Length = 410

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 14/93 (15%), Positives = 29/93 (31%), Gaps = 2/93 (2%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           +      +   E+      G+  I  V+ +  G++  +        +NIA  +L      
Sbjct: 319 NGTTITSVNFPEVALPAHPGKHRILHVHHNQPGVLSAINQTFAALHVNIAGQYLQTDDKL 378

Query: 63  EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
            +    + +D       LEKL         +  
Sbjct: 379 GYV--VIDLDAQSSELALEKLWQVEGTIRCRVL 409


>gi|157692265|ref|YP_001486727.1| L-serine ammonia-lyase beta chain [Bacillus pumilus SAFR-032]
 gi|157681023|gb|ABV62167.1| L-serine ammonia-lyase beta chain [Bacillus pumilus SAFR-032]
          Length = 220

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 38/86 (44%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
            ++      +      I +V+ D  G +  V N+L ++ INI H  + R    + A+  +
Sbjct: 133 TELNGFELRLSGNHPAILVVHNDRYGTIAAVANVLAKFAINIGHMEVARKDVGQEALMTI 192

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D +I  +VL +L     I  V Q 
Sbjct: 193 EVDQNIDPAVLLELETLPNIIQVTQI 218


>gi|258651703|ref|YP_003200859.1| D-3-phosphoglycerate dehydrogenase [Nakamurella multipartita DSM
           44233]
 gi|258554928|gb|ACV77870.1| D-3-phosphoglycerate dehydrogenase [Nakamurella multipartita DSM
           44233]
          Length = 530

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 39/89 (43%)

Query: 7   PRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAI 66
            + I+I   +FD+     ++     D  G++  +G +LGE G NI    L +      AI
Sbjct: 439 AKLIEINGRHFDLRAEGNLLVFAYGDRPGVMGTIGALLGEQGTNIEAAQLSQELDGHAAI 498

Query: 67  SFLCIDGSILNSVLEKLSVNVTIRFVKQF 95
             L +D     ++L+++   +    V+  
Sbjct: 499 MVLRVDRLPDQALLDRIGAAIEAIQVRGI 527


>gi|297518490|ref|ZP_06936876.1| D-3-phosphoglycerate dehydrogenase [Escherichia coli OP50]
          Length = 122

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 37  VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDI 95

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L+ +         +  
Sbjct: 96  EADEDVAEKALQAMKAIPGTIRARLL 121


>gi|161506391|ref|YP_001573503.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867738|gb|ABX24361.1| hypothetical protein SARI_04588 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 427

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 11/86 (12%), Positives = 31/86 (36%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  + G+NIA  +L  S    + +  +
Sbjct: 342 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNQIFADQGVNIAAQYLQTSARMGYVVIDI 400

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L  +         +  
Sbjct: 401 EADSDVAEKALLAMKAIPGTIRARLL 426


>gi|326474476|gb|EGD98485.1| D-3-phosphoglycerate dehydrogenase [Trichophyton tonsurans CBS
           112818]
          Length = 570

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 36/105 (34%), Gaps = 10/105 (9%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           S+ +P   +I            ++   N D  G +  VG+ILG+ G+NI    +      
Sbjct: 466 SESQPLISRIDRFAASFVPEGTLLICHNFDSPGKIGVVGSILGKRGVNINFMSVAPISKG 525

Query: 63  ----------EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                     + A+  L +D ++   V+  L     +        
Sbjct: 526 KKQQKEIHSSDEALMILGVDRAVDECVVRALVNEGGVLSASVVSL 570


>gi|146312971|ref|YP_001178045.1| D-3-phosphoglycerate dehydrogenase [Enterobacter sp. 638]
 gi|145319847|gb|ABP61994.1| D-3-phosphoglycerate dehydrogenase [Enterobacter sp. 638]
          Length = 410

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 11/86 (12%), Positives = 31/86 (36%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  +    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLLHIHENRPGVLTAINQIFAEQGVNIAAQYLQTNAQMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             D  +    L  +         +  
Sbjct: 384 EADDDVAEKALLSMKAIPGTIRARLL 409


>gi|194707240|gb|ACF87704.1| unknown [Zea mays]
          Length = 589

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 39/89 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V   G      +  ++ DV +   +I     D  GI+  VG+ILG+  +N++   + R+ 
Sbjct: 493 VRDGGASHLTLVGSLSVDVSLEGNLILCGQLDHPGIIGRVGSILGKMNVNVSFMSVSRTA 552

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTI 89
             + AI  + +D       L+ +    ++
Sbjct: 553 PGKQAIMAIGVDEEPGKEALKLIGDTPSV 581


>gi|16766363|ref|NP_461978.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56415008|ref|YP_152083.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|161616015|ref|YP_001589980.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167553250|ref|ZP_02347000.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167990423|ref|ZP_02571523.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168236126|ref|ZP_02661184.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168242854|ref|ZP_02667786.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168264505|ref|ZP_02686478.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168463763|ref|ZP_02697680.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194446775|ref|YP_002042315.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194451247|ref|YP_002047048.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194734978|ref|YP_002116011.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197249451|ref|YP_002147977.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197264705|ref|ZP_03164779.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197363937|ref|YP_002143574.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|200388423|ref|ZP_03215035.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204928115|ref|ZP_03219315.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|207858325|ref|YP_002244976.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|238909862|ref|ZP_04653699.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|16421614|gb|AAL21937.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|56129265|gb|AAV78771.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|161365379|gb|ABX69147.1| hypothetical protein SPAB_03816 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194405438|gb|ACF65660.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194409551|gb|ACF69770.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194710480|gb|ACF89701.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195633189|gb|EDX51603.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197095414|emb|CAR60973.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197213154|gb|ACH50551.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197242960|gb|EDY25580.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197290763|gb|EDY30117.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|199605521|gb|EDZ04066.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204322437|gb|EDZ07634.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205322277|gb|EDZ10116.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205331102|gb|EDZ17866.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205338092|gb|EDZ24856.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205347061|gb|EDZ33692.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206710128|emb|CAR34483.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261248194|emb|CBG26030.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267995221|gb|ACY90106.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159618|emb|CBW19137.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312914084|dbj|BAJ38058.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320087494|emb|CBY97259.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322613461|gb|EFY10402.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322621053|gb|EFY17911.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322624117|gb|EFY20951.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322628144|gb|EFY24933.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322633263|gb|EFY30005.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636159|gb|EFY32867.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322639497|gb|EFY36185.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647570|gb|EFY44059.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648754|gb|EFY45201.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653809|gb|EFY50135.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657915|gb|EFY54183.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664018|gb|EFY60217.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668971|gb|EFY65122.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673035|gb|EFY69142.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322677974|gb|EFY74037.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322681150|gb|EFY77183.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687920|gb|EFY83887.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323131418|gb|ADX18848.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323194884|gb|EFZ80071.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323196635|gb|EFZ81783.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323202665|gb|EFZ87705.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207848|gb|EFZ92794.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323212600|gb|EFZ97417.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323214917|gb|EFZ99665.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222647|gb|EGA07012.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225073|gb|EGA09325.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230595|gb|EGA14713.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235054|gb|EGA19140.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323239093|gb|EGA23143.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244549|gb|EGA28555.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323247164|gb|EGA31130.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253353|gb|EGA37182.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323256340|gb|EGA40076.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262484|gb|EGA46040.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323267420|gb|EGA50904.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269176|gb|EGA52631.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 410

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNQIFAEQGVNIAAQYLQTSARMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             DG +    L  +         +  
Sbjct: 384 EADGDVAEKALLAMKAIPGTIRARLL 409


>gi|194472963|ref|ZP_03078947.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205358819|ref|ZP_03224148.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194459327|gb|EDX48166.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205331748|gb|EDZ18512.1| phosphoglycerate dehydrogenase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 427

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 342 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNQIFAEQGVNIAAQYLQTSARMGYVVIDI 400

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             DG +    L  +         +  
Sbjct: 401 EADGDVAEKALLAMKAIPGTIRARLL 426


>gi|146338824|ref|YP_001203872.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. ORS278]
 gi|146191630|emb|CAL75635.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Bradyrhizobium sp.
           ORS278]
          Length = 415

 Score = 79.7 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 11/86 (12%), Positives = 28/86 (32%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   ++             V+ ++ G++  V   +  + INI   +L       + +   
Sbjct: 324 VNFPQVQLPARPTGTRFIHVHRNVPGVLRQVNEAVSRHNINILAQYLQTDPEVGYVVLET 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            + G     +L +L        V+  
Sbjct: 384 DVVGGEGEELLSELRAVDGTIRVRVL 409


>gi|226502750|ref|NP_001148319.1| LOC100281928 [Zea mays]
 gi|195616328|gb|ACG29994.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
 gi|195617508|gb|ACG30584.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 590

 Score = 79.3 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 39/89 (43%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           V   G      +  ++ DV +   +I     D  GI+  VG+ILG+  +N++   + R+ 
Sbjct: 494 VRDGGASHLTLVGSLSVDVSLEGNLILCGQLDHPGIIGRVGSILGKMNVNVSFMSVSRTA 553

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTI 89
             + AI  + +D       L+ +    ++
Sbjct: 554 PGKQAIMAIGVDEEPGKEALKLIGDTPSV 582


>gi|148253581|ref|YP_001238166.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. BTAi1]
 gi|146405754|gb|ABQ34260.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Bradyrhizobium sp.
           BTAi1]
          Length = 415

 Score = 79.3 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 11/86 (12%), Positives = 28/86 (32%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   ++             V+ ++ G++  V   +  + INI   +L       + +   
Sbjct: 324 VNFPQVQLPARPTGTRFIHVHRNVPGVLRQVNEAVSRHNINILAQYLQTDPEVGYVVLET 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            + G     +L +L        V+  
Sbjct: 384 DVVGGEGEELLSELRAVEGTIRVRVL 409


>gi|16761843|ref|NP_457460.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29143330|ref|NP_806672.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213162873|ref|ZP_03348583.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213417999|ref|ZP_03351079.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213584198|ref|ZP_03366024.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213646129|ref|ZP_03376182.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289830214|ref|ZP_06547598.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25283926|pir||AD0874 D-3-phosphoglycerate dehydrogenase [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16504145|emb|CAD02892.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29138964|gb|AAO70532.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 410

 Score = 79.3 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNQIFAEQGVNIAAQYLQTSARMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             DG +    L  +         +  
Sbjct: 384 EADGDVAEKALLAMKAIPGTIRARLL 409


>gi|46135935|ref|XP_389659.1| hypothetical protein FG09483.1 [Gibberella zeae PH-1]
          Length = 591

 Score = 79.3 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 25/109 (22%), Positives = 43/109 (39%), Gaps = 13/109 (11%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR---- 58
           SD +    K+   N        +I + N D  G +  VG +LG++GINI    +      
Sbjct: 462 SDERVFISKLDRFNGVFTPEGTLIILHNYDEPGKIGGVGMVLGKHGINIKFMQVASLDPE 521

Query: 59  ---------SQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFN 98
                      +   A+  L + G + + VLE L+ +  +  V + E  
Sbjct: 522 ATKGADTPPDPNGNEALMILGVLGPVSDEVLEGLNNSEGVLDVVEIEIE 570


>gi|326481542|gb|EGE05552.1| phosphoglycerate dehydrogenase [Trichophyton equinum CBS 127.97]
          Length = 571

 Score = 79.3 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 19/105 (18%), Positives = 36/105 (34%), Gaps = 10/105 (9%)

Query: 3   SDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST 62
           S+ +P   +I            ++   N D  G +  VG+ILG+ G+NI    +      
Sbjct: 467 SESQPLISRIDRFAASFVPEGTLLICHNFDSPGKIGVVGSILGKRGVNINFMSVAPISKG 526

Query: 63  ----------EHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEF 97
                     + A+  L +D ++   V+  L     +        
Sbjct: 527 KKQQKEIHSSDEALMILGVDRAVDECVVRALVNEGGVLSASVVSL 571


>gi|62181573|ref|YP_217990.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|62129206|gb|AAX66909.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|322716054|gb|EFZ07625.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 410

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNQIFAEQGVNIAAQYLQTSARMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             DG +    L  +         +  
Sbjct: 384 EADGDVAEKALLAMKAIPGTIRARLL 409


>gi|224584853|ref|YP_002638651.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224469380|gb|ACN47210.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
          Length = 427

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 342 VNFPEVSLPLHG-GRRLMHIHENRPGVLTALNQIFAEQGVNIAAQYLQTSARMGYVVIDI 400

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             DG +    L  +         +  
Sbjct: 401 EADGDVAEKALLAMKAIPGTIRARLL 426


>gi|327479061|gb|AEA82371.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas stutzeri DSM 4166]
          Length = 411

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++ +I G++  +  +  + GINI    L  ++   +    +
Sbjct: 327 VNFPEVALPSHPGKHRLLHIHQNIPGVMSEINKVFADNGINICGQFLQTNEKVGYV--VI 384

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +  LEKL         +  
Sbjct: 385 DVDKEYSDLALEKLQHVNGTIRSRVL 410


>gi|225022672|ref|ZP_03711864.1| hypothetical protein CORMATOL_02717 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224944580|gb|EEG25789.1| hypothetical protein CORMATOL_02717 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 558

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 36/78 (46%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I     D+      +    +D  G +  VG+ LG+ GINI    L +    E A+ 
Sbjct: 469 KIVRINGRGIDLRASGHNLFFNYSDAPGALGIVGSALGDAGINIVAAALTQESGGEFAVL 528

Query: 68  FLCIDGSILNSVLEKLSV 85
            L ++  + + +LE ++ 
Sbjct: 529 ILRVEREVPDELLESIAE 546


>gi|169630385|ref|YP_001704034.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium abscessus ATCC
           19977]
 gi|169242352|emb|CAM63380.1| D-3-phosphoglycerate dehydrogenase (SerA) [Mycobacterium abscessus]
          Length = 523

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 21/78 (26%), Positives = 39/78 (50%)

Query: 8   RFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAIS 67
           + ++I   NFD+    + + I  AD+ G +  +G +LG   +NI    L +  S   A  
Sbjct: 433 KIVQINGRNFDLRAEGVNLVINYADVPGALGKIGTVLGGAEVNIQAAQLSQDASGAAATI 492

Query: 68  FLCIDGSILNSVLEKLSV 85
            L ID +  ++VL+++  
Sbjct: 493 ILRIDRTAPDAVLDEIRA 510


>gi|213427299|ref|ZP_03360049.1| D-3-phosphoglycerate dehydrogenase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
          Length = 410

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 32/86 (37%), Gaps = 1/86 (1%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E++  +      +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +
Sbjct: 325 VNFPEVSLPLYG-GRRLMHIHENRPGVLTALNQIFAEQGVNIAAQYLQTSARMGYVVIDI 383

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
             DG +    L  +         +  
Sbjct: 384 EADGDVAEKALLAMKAIPGTIRARLL 409


>gi|15595513|ref|NP_249007.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas aeruginosa PAO1]
 gi|107099298|ref|ZP_01363216.1| hypothetical protein PaerPA_01000310 [Pseudomonas aeruginosa PACS2]
 gi|152988887|ref|YP_001345804.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas aeruginosa PA7]
 gi|218889056|ref|YP_002437920.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas aeruginosa LESB58]
 gi|254237450|ref|ZP_04930773.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas aeruginosa C3719]
 gi|254243414|ref|ZP_04936736.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas aeruginosa 2192]
 gi|9946162|gb|AAG03705.1|AE004469_10 D-3-phosphoglycerate dehydrogenase [Pseudomonas aeruginosa PAO1]
 gi|126169381|gb|EAZ54892.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas aeruginosa C3719]
 gi|126196792|gb|EAZ60855.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas aeruginosa 2192]
 gi|150964045|gb|ABR86070.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas aeruginosa PA7]
 gi|218769279|emb|CAW25039.1| D-3-phosphoglycerate dehydrogenase [Pseudomonas aeruginosa LESB58]
          Length = 409

 Score = 79.3 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 36/86 (41%), Gaps = 2/86 (2%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFL 69
           +   E+      G+  +  ++A+I G++  +  +  + GIN++  +L  ++   +    +
Sbjct: 325 VNFPEVALPSHPGKHRLLHIHANIPGVMSEINKVFADNGINVSGQYLQTNEKVGYV--VI 382

Query: 70  CIDGSILNSVLEKLSVNVTIRFVKQF 95
            +D    +  LEKL         +  
Sbjct: 383 DVDAEYSDLALEKLQQVNGTIRSRVL 408


>gi|262089724|gb|ACY24818.1| D-3-phosphogl