RPSBLAST alignment of GI: peg_33 and MMDB domain: 1sc6_A_322-404

>1sc6_A (A:322-404) PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli}Length = 83
 Score = 42.7 bits (101), Expect = 2e-05
 Identities = 12/72 (16%), Positives = 27/72 (37%)

Query: 22 GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLE 81
          G   +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +  D  +    L+
Sbjct: 9  GGRRLXHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQXGYVVIDIEADEDVAEKALQ 68

Query: 82 KLSVNVTIRFVK 93
                     +
Sbjct: 69 AXKAIPGTIRAR 80