RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= 537021.9.peg.33_1
         (100 letters)



>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase,
          serine biosynthesis, structural genomics, PSI, protein
          structure initiative; HET: TAR; 2.30A {Mycobacterium
          tuberculosis} (A:453-529)
          Length = 77

 Score = 47.7 bits (114), Expect = 5e-07
 Identities = 15/76 (19%), Positives = 30/76 (39%)

Query: 23 RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEK 82
           + + I   D  G +  +G +LG  G+NI    L        A   L +D  + + V   
Sbjct: 2  GINLIIHYVDRPGALGKIGTLLGTAGVNIQAAQLSEDAEGPGATILLRLDQDVPDDVRTA 61

Query: 83 LSVNVTIRFVKQFEFN 98
          ++  V    ++  + +
Sbjct: 62 IAAAVDAYKLEVVDLS 77


>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle
          structural genomics center for infectious disease,
          brucellosis; 2.15A {Brucella melitensis biovar abortus}
          (A:333-416)
          Length = 84

 Score = 45.8 bits (109), Expect = 2e-06
 Identities = 12/80 (15%), Positives = 28/80 (35%)

Query: 14 EINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDG 73
          ++             V+ +  GI+  + N+   + INIA   L       + +      G
Sbjct: 2  QVQLPPRPTGTRFMHVHENRPGILNSLMNVFSHHHINIASQFLQTDGEVGYLVMEADGVG 61

Query: 74 SILNSVLEKLSVNVTIRFVK 93
             ++VL+++         +
Sbjct: 62 EASDAVLQEIREIPGTIRAR 81


>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric
          regulation phosphoglycerate dehydrogenase PGDH,
          oxidoreductase; HET: NAD; 2.09A {Escherichia coli}
          (A:322-404)
          Length = 83

 Score = 42.7 bits (101), Expect = 2e-05
 Identities = 12/72 (16%), Positives = 27/72 (37%)

Query: 22 GRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLE 81
          G   +  ++ +  G++  +  I  E G+NIA  +L  S    + +  +  D  +    L+
Sbjct: 9  GGRRLXHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQXGYVVIDIEADEDVAEKALQ 68

Query: 82 KLSVNVTIRFVK 93
                     +
Sbjct: 69 AXKAIPGTIRAR 80


>1zpv_A ACT domain protein; structural genomics, PSI, protein
          structure initiative, midwest center for structural
          genomics, MCSG; 1.90A {Streptococcus pneumoniae TIGR4}
          (A:)
          Length = 91

 Score = 28.9 bits (65), Expect = 0.27
 Identities = 17/85 (20%), Positives = 30/85 (35%), Gaps = 8/85 (9%)

Query: 20 DIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSI---- 75
          +  + +I +V  D  GIV  V   + E G+NI               + +  D       
Sbjct: 2  NAXKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTXXAVVSSDEKQDFTY 61

Query: 76 ----LNSVLEKLSVNVTIRFVKQFE 96
                +  + L+V + I+    FE
Sbjct: 62 LRNEFEAFGQTLNVKINIQSAAIFE 86


>2axo_A Hypothetical protein ATU2684; alpha beta protein.,
           structural genomics, PSI, protein structure initiative;
           1.80A {Agrobacterium tumefaciens str} (A:)
          Length = 270

 Score = 27.3 bits (60), Expect = 0.77
 Identities = 6/42 (14%), Positives = 12/42 (28%), Gaps = 4/42 (9%)

Query: 28  IVNADILGIVVFV--GNILGEYG--INIAHFHLGRSQSTEHA 65
           +      G  V +   N  G+    +  +      +Q   H 
Sbjct: 226 VAKVKKGGCAVLLQTANASGDPAAIVGASILLGNETQLEHHH 267


>3bbo_K Ribosomal protein L11; large ribosomal subunit, spinach
           chloroplast ribosome, ribonucleoprotein particle,
           macromolecular complex; 9.40A {Spinacea oleracea}
           (K:1-144)
          Length = 144

 Score = 26.1 bits (57), Expect = 1.6
 Identities = 15/60 (25%), Positives = 22/60 (36%), Gaps = 13/60 (21%)

Query: 40  VGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNV 99
           VG  LG  G+NI  F    +  T          G ++        V +T+   K F F +
Sbjct: 95  VGPALGSKGVNIMAFCKDYNARTAD------KPGFVIP-------VEITVFDDKSFTFIL 141


>2nyi_A Unknown protein; protein structure initiative, PSI, center
          for eukaryotic structural genomics, CESG, structural
          genomics; 1.80A {Galdieria sulphuraria} (A:85-195)
          Length = 111

 Score = 25.9 bits (57), Expect = 1.8
 Identities = 15/87 (17%), Positives = 28/87 (32%), Gaps = 13/87 (14%)

Query: 23 RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSI------- 75
             + +   D  GIV  V  +L + G NI         +     +       +       
Sbjct: 9  EYELYVEGPDSEGIVEAVTAVLAKKGANIVELETETLPAPFAGFTLFRXGSRVAFPFPLY 68

Query: 76 ------LNSVLEKLSVNVTIRFVKQFE 96
                L+ V E+  V++ +  V + E
Sbjct: 69 QEVVTALSRVEEEFGVDIDLEEVVEGE 95


>3bbo_D Ribosomal protein L1; large ribosomal subunit, spinach
          chloroplast ribosome, ribonucleoprotein particle,
          macromolecular complex; 9.40A {Spinacea oleracea}
          (D:184-271)
          Length = 88

 Score = 25.8 bits (57), Expect = 2.0
 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 7/36 (19%)

Query: 10 IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILG 45
          IK   ++FD         I  +D++  V  +G ILG
Sbjct: 35 IKGGFMDFDK-------LIATSDMMAKVASLGRILG 63


>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface
          receptor complex LIFR LIF, cytokine receptor/cytokine
          complex; HET: NAG FUC MAN; 4.00A {Mus musculus}
          (A:206-287)
          Length = 82

 Score = 25.1 bits (55), Expect = 3.4
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 10 IKIQEINFDVDIGRLMICIVNADILGIVVFVG 41
          I I  I    + G  +I I + D+ G VVF G
Sbjct: 48 IHILNIPVSENSGTNIIFITDDDVYGTVVFAG 79


>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine
          binding homology region (CHR), alternative splicing,
          cell membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens}
          (A:201-282)
          Length = 82

 Score = 25.1 bits (55), Expect = 3.6
 Identities = 10/32 (31%), Positives = 16/32 (50%)

Query: 10 IKIQEINFDVDIGRLMICIVNADILGIVVFVG 41
          IKI+ I+     G  ++     +I G V+F G
Sbjct: 48 IKIRNISVSASSGTNVVFTTEDNIFGTVIFAG 79


>3ks3_A Carbonic anhydrase 2; high resolution, short hydrogen bond;
           0.90A {Homo sapiens} PDB: 1ca3_A* 1cnw_A* 1cny_A*
           1eou_A* 1g6v_A 1hca_A 1kwq_A* 1kwr_A* 1t9n_A 1tb0_X
           1tbt_X 1te3_X 1teq_X 1teu_X 1cnx_A 1xev_A 1xeg_A 2ax2_A*
           2eu3_A* 2ez7_A* ... (A:)
          Length = 260

 Score = 24.9 bits (53), Expect = 4.1
 Identities = 11/50 (22%), Positives = 18/50 (36%), Gaps = 2/50 (4%)

Query: 19  VDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST--EHAI 66
           ++ G       +      V+  G + G Y +   HFH G       EH +
Sbjct: 60  LNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTV 109


>2foy_A Carbonic anhydrase 1; lyase, zinc, inhibitor, copper; HET:
           B30; 1.55A {Homo sapiens} (A:)
          Length = 260

 Score = 25.0 bits (53), Expect = 4.2
 Identities = 10/57 (17%), Positives = 19/57 (33%), Gaps = 2/57 (3%)

Query: 19  VDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQST--EHAISFLCIDG 73
           +++G         +    V+  G     Y +   HFH G +     EH +  +    
Sbjct: 60  INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSA 116


>2nyi_A Unknown protein; protein structure initiative, PSI, center
          for eukaryotic structural genomics, CESG, structural
          genomics; 1.80A {Galdieria sulphuraria} (A:1-84)
          Length = 84

 Score = 24.6 bits (54), Expect = 5.0
 Identities = 10/76 (13%), Positives = 21/76 (27%), Gaps = 7/76 (9%)

Query: 23 RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGS-------I 75
            ++ +  +D +GIV      L     N+              I  + ++          
Sbjct: 5  SFVVSVAGSDRVGIVHDFSWALKNISANVESSRXACLGGDFAXIVLVSLNAKDGKLIQSA 64

Query: 76 LNSVLEKLSVNVTIRF 91
          L S L    ++     
Sbjct: 65 LESALPGFQISTRRAS 80


>3lou_A Formyltetrahydrofolate deformylase; structural genomics,
          joint center for structural genomics, JCSG, protein
          structure initiative, PSI-2; HET: MSE; 1.90A
          {Burkholderia mallei} (A:1-93)
          Length = 93

 Score = 24.4 bits (53), Expect = 5.1
 Identities = 4/53 (7%), Positives = 14/53 (26%)

Query: 23 RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHAISFLCIDGSI 75
          + ++ +      G V  V  +L  +   +    +     +           + 
Sbjct: 10 QFVLTLSCPSAAGQVAAVVGLLDRHRCYVDELTVFDDDLSARFFVRCVFHATD 62


>3i1n_I 50S ribosomal protein L11; ribosome structure, protein-RNA
          complex, acetylation, ribonucleoprotein, ribosomal
          protein, RNA-binding, rRNA- binding, methylation; 3.19A
          {Escherichia coli k-12} PDB: 1vs8_I 3e1b_5 3e1d_5
          1vs6_I 3i1p_I 3i1r_I 3i1t_I 3i20_I 3i22_I 2qam_I*
          1p85_G 1p86_G 2awb_I 2aw4_I 2i2v_I 2j28_I 2i2t_I*
          2qao_I* 2qba_I* 2qbc_I* ... (I:1-84)
          Length = 84

 Score = 23.9 bits (52), Expect = 8.1
 Identities = 8/15 (53%), Positives = 10/15 (66%)

Query: 40 VGNILGEYGINIAHF 54
          VG  LG+ G+NI  F
Sbjct: 24 VGPALGQQGVNIMEF 38


>1u8s_A Glycine cleavage system transcriptional repressor,
          putative; structural genomics, protein structure
          initiative (PSI), domain swapping; 2.45A {Vibrio
          cholerae} (A:87-192)
          Length = 106

 Score = 24.0 bits (52), Expect = 8.1
 Identities = 7/43 (16%), Positives = 14/43 (32%), Gaps = 4/43 (9%)

Query: 23 RLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQSTEHA 65
           + + + + D LG+         +  I +A      S  T   
Sbjct: 7  TVEVYVESDDKLGLTEKFTQFFAQRQIGMASL----SAQTISK 45


>3fik_5 50S ribosomal protein L1; ribosome, decoding, tRNA, EF-TU,
          ternary complex, acetylation, ribonucleoprotein,
          ribosomal protein, RNA-binding; 6.70A {Escherichia
          coli} PDB: 2rdo_9 2gya_2 2gyc_2 (5:72-133)
          Length = 62

 Score = 23.8 bits (52), Expect = 8.1
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 7/36 (19%)

Query: 10 IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILG 45
          IK  E+NFDV        I + D + +V  +G +LG
Sbjct: 33 IKKGEMNFDV-------VIASPDAMRVVGQLGQVLG 61


>1mms_A Protein (ribosomal protein L11); RNA-protein complex, RNA,
          ribosome, translocation, thiostrepton; 2.57A
          {Thermotoga maritima} (A:1-72)
          Length = 72

 Score = 23.5 bits (51), Expect = 9.8
 Identities = 8/15 (53%), Positives = 11/15 (73%)

Query: 40 VGNILGEYGINIAHF 54
          VG  LG++G+NI  F
Sbjct: 23 VGPALGQHGVNIMEF 37


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.329    0.147    0.428 

Gapped
Lambda     K      H
   0.267   0.0643    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 772,627
Number of extensions: 30218
Number of successful extensions: 130
Number of sequences better than 10.0: 1
Number of HSP's gapped: 130
Number of HSP's successfully gapped: 25
Length of query: 100
Length of database: 4,956,049
Length adjustment: 59
Effective length of query: 41
Effective length of database: 2,961,554
Effective search space: 121423714
Effective search space used: 121423714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 50 (23.2 bits)