BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 537021.9.peg.33_1
         (100 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>537021.9.peg.33_1 
          Length = 100

 Score =  198 bits (503), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 100/100 (100%), Positives = 100/100 (100%)

Query: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60
           VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ
Sbjct: 1   VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGRSQ 60

Query: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100
           STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD
Sbjct: 61  STEHAISFLCIDGSILNSVLEKLSVNVTIRFVKQFEFNVD 100


>gi|254780146|ref|YP_003064559.1| 50S ribosomal protein L1 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 232

 Score = 25.4 bits (54), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 17/84 (20%)

Query: 10  IKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFHLGR---------SQ 60
           +K  +I+FD        CI   D++ +V  +G ILG  GI + +  +G           +
Sbjct: 105 VKGGQIDFDR-------CIATPDMMPLVGRLGRILGPRGI-MPNLRVGTVTTDVATAVRE 156

Query: 61  STEHAISFLCIDGSILNSVLEKLS 84
           S   A+ F      I+++ + K+S
Sbjct: 157 SKSGAVDFRSEKAGIIHAGIGKVS 180


>gi|254780815|ref|YP_003065228.1| hypothetical protein CLIBASIA_03530 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 232

 Score = 23.1 bits (48), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 17/24 (70%)

Query: 72  DGSILNSVLEKLSVNVTIRFVKQF 95
           D  I+N+ +E+ +V +TIR V QF
Sbjct: 161 DMKIINASIEENTVYITIRIVGQF 184


>gi|254780419|ref|YP_003064832.1| aspartyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 622

 Score = 22.7 bits (47), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 11/60 (18%)

Query: 35 GIVVFVGNILGEYGI-------NIAHFHLGRSQSTEHAISFLCIDGSILNSVLEKLSVNV 87
          G ++F+ +I   YGI       + A F + +S  +E     LCIDG +++   E ++ N+
Sbjct: 34 GGIIFL-DIRDHYGITQVVANPDSACFEIAKSVRSEWV---LCIDGLVMSRSAETINANI 89


>gi|254781053|ref|YP_003065466.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 466

 Score = 20.8 bits (42), Expect = 4.9,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 20/38 (52%)

Query: 45  GEYGINIAHFHLGRSQSTEHAISFLCIDGSILNSVLEK 82
           G+ GINIA  HL   +   +  S +  +   +N +L+K
Sbjct: 67  GDLGINIASCHLDLKKMMSYKKSIVESNTQGINFLLKK 104


>gi|254780936|ref|YP_003065349.1| hypothetical protein CLIBASIA_04175 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 182

 Score = 20.8 bits (42), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 10/55 (18%), Positives = 24/55 (43%)

Query: 1  VFSDGKPRFIKIQEINFDVDIGRLMICIVNADILGIVVFVGNILGEYGINIAHFH 55
          +F DG   +   + + FD+D  +L+    +  I+    +   ++G+     +  H
Sbjct: 10 LFIDGANLYASSKALGFDIDYRKLLKAFRSRAIVIRAYYYTTVVGDPEQQFSPLH 64


>gi|254780666|ref|YP_003065079.1| Fmu (Sun) domain protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 445

 Score = 20.4 bits (41), Expect = 6.6,   Method: Composition-based stats.
 Identities = 8/24 (33%), Positives = 16/24 (66%)

Query: 77  NSVLEKLSVNVTIRFVKQFEFNVD 100
           + +L +  VNVT+RF+ + +  +D
Sbjct: 45  DQILVRAIVNVTLRFLPRIDAVLD 68


>gi|254780663|ref|YP_003065076.1| carbonate dehydratase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 207

 Score = 20.0 bits (40), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 6/20 (30%), Positives = 15/20 (75%)

Query: 78  SVLEKLSVNVTIRFVKQFEF 97
           ++LE+LS+  +++ ++ F F
Sbjct: 149 TILEQLSIRNSLKNIRNFPF 168


>gi|254780337|ref|YP_003064750.1| oxidoreductase protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 257

 Score = 20.0 bits (40), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 13/22 (59%)

Query: 22  GRLMICIVNADILGIVVFVGNI 43
           G+L I I NA ILG +  +  I
Sbjct: 94  GKLDILIANAGILGSISPIWQI 115


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.329    0.147    0.428 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 63,407
Number of Sequences: 1233
Number of extensions: 2380
Number of successful extensions: 11
Number of sequences better than 100.0: 11
Number of HSP's better than 100.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of query: 100
length of database: 328,796
effective HSP length: 61
effective length of query: 39
effective length of database: 253,583
effective search space:  9889737
effective search space used:  9889737
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 32 (16.9 bits)