Query 537021.9.peg.330_1 Match_columns 43 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Tue May 24 19:55:56 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_330.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 COG5142 OXR1 Oxidation resista 51.3 4.5 0.00011 21.9 0.1 22 11-32 143-169 (212) 2 cd06234 M14_Nna1_like_1 A bact 31.0 18 0.00045 19.1 0.5 25 6-30 148-173 (263) 3 PHA00212 putative transcriptio 27.3 30 0.00076 18.0 1.2 16 27-42 27-42 (56) 4 PHA02503 putative transcriptio 27.2 29 0.00073 18.1 1.1 16 27-42 29-44 (58) 5 COG3862 Uncharacterized protei 26.4 37 0.00094 17.6 1.5 31 2-32 52-82 (117) 6 TIGR01828 pyru_phos_dikin pyru 26.2 20 0.00052 18.8 0.2 10 21-30 808-817 (920) 7 pfam03198 Glyco_hydro_72 Glyco 19.2 35 0.00089 17.7 0.2 14 17-30 235-249 (313) 8 pfam08196 UL2 UL2 protein. Orf 18.4 93 0.0024 15.7 2.3 23 11-33 8-31 (60) 9 TIGR01772 MDH_euk_gproteo mala 14.5 81 0.0021 16.0 1.1 14 2-15 242-255 (379) 10 pfam04761 Phage_Treg Lactococc 14.4 85 0.0022 15.9 1.2 17 26-42 28-44 (58) No 1 >COG5142 OXR1 Oxidation resistance protein [DNA replication, recombination, and repair] Probab=51.25 E-value=4.5 Score=21.94 Aligned_cols=22 Identities=41% Similarity=0.854 Sum_probs=15.2 Q ss_pred EEEECCCCC-----CHHHHHCCCCHHH Q ss_conf 575227765-----4033213755689 Q 537021.9.peg.3 11 VLDIEGDKS-----IPSFFSFGCSDEF 32 (43) Q Consensus 11 vldiegdks-----ipsffsfgcsdef 32 (43) +..|.|.+. -|+|++|||+++- T Consensus 143 ~yp~~g~~~f~iYCt~~FlafG~g~gr 169 (212) T COG5142 143 VYPISGGKGFGIYCTPDFLAFGCGGGR 169 (212) T ss_pred EEEEECCCCEEEEECHHHHHHCCCCCC T ss_conf 767416773179975478500478971 No 2 >cd06234 M14_Nna1_like_1 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins. The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Nna1-like proteins are active metallopeptidases that are thought to act on cytosolic proteins (such as alpha-tubulin in eukaryotes) to remove a C-terminal tyrosine. Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal domain might act as a folding domain. Probab=30.95 E-value=18 Score=19.13 Aligned_cols=25 Identities=36% Similarity=0.724 Sum_probs=19.9 Q ss_pred CCCCC-EEEECCCCCCHHHHHCCCCH Q ss_conf 03870-57522776540332137556 Q 537021.9.peg.3 6 KAGTD-VLDIEGDKSIPSFFSFGCSD 30 (43) Q Consensus 6 kagtd-vldiegdksipsffsfgcsd 30 (43) +.|-| .+|+.||..+|..|-.||.. T Consensus 148 ~~gvd~~lD~HGde~~p~~F~~G~eg 173 (263) T cd06234 148 ETGVDFFLDVHGDEALPYNFIAGSEG 173 (263) T ss_pred HHCCEEEEECCCCCCCCCEEEEECCC T ss_conf 86917999866776677568860689 No 3 >PHA00212 putative transcription regulator Probab=27.32 E-value=30 Score=18.05 Aligned_cols=16 Identities=44% Similarity=0.596 Sum_probs=14.1 Q ss_pred CCCHHHHHHHHHHHHH Q ss_conf 7556899998777620 Q 537021.9.peg.3 27 GCSDEFILKSLIIQIF 42 (43) Q Consensus 27 gcsdefilksliiqif 42 (43) -||..|+-.|||-|.| T Consensus 27 ~~s~~flq~slipql~ 42 (56) T PHA00212 27 DFSVQFIKDSLLPQLF 42 (56) T ss_pred HHHHHHHHHHHHHHHH T ss_conf 9889999972669999 No 4 >PHA02503 putative transcription regulator; Provisional Probab=27.20 E-value=29 Score=18.14 Aligned_cols=16 Identities=38% Similarity=0.600 Sum_probs=14.0 Q ss_pred CCCHHHHHHHHHHHHH Q ss_conf 7556899998777620 Q 537021.9.peg.3 27 GCSDEFILKSLIIQIF 42 (43) Q Consensus 27 gcsdefilksliiqif 42 (43) -||..|+-.|||-|.| T Consensus 29 ~~s~~flq~slipql~ 44 (58) T PHA02503 29 VYSKDFLQNSLIPQLY 44 (58) T ss_pred HHHHHHHHHHHHHHHH T ss_conf 9899999961559999 No 5 >COG3862 Uncharacterized protein with conserved CXXC pairs [Function unknown] Probab=26.35 E-value=37 Score=17.63 Aligned_cols=31 Identities=26% Similarity=0.347 Sum_probs=26.3 Q ss_pred EEEECCCCCEEEECCCCCCHHHHHCCCCHHH Q ss_conf 1341038705752277654033213755689 Q 537021.9.peg.3 2 VRVQKAGTDVLDIEGDKSIPSFFSFGCSDEF 32 (43) Q Consensus 2 vrvqkagtdvldiegdksipsffsfgcsdef 32 (43) |||.++-..+.....+|+||.-+-++|+++. T Consensus 52 VrV~ng~~~~vpVKT~kPIpKel~~elmk~l 82 (117) T COG3862 52 VRVKNGELPVVPVKTEKPIPKELIPELMKEL 82 (117) T ss_pred EEECCCCCCEEECCCCCCCCHHHHHHHHHHH T ss_conf 9972784424651468988877849999998 No 6 >TIGR01828 pyru_phos_dikin pyruvate, phosphate dikinase; InterPro: IPR010121 Pyruvate phosphate dikinase (PPDK, or pyruvate orthophosphate dikinase) is found in plants, bacteria and archaea. The amino acid sequence identity between bacterial and plant enzymes is high, and they are similar in sequence to other PEP-utilizing enzymes. PPDK catalyses the reversible conversion of ATP and pyruvate to AMP and PEP (phosphoenolpyruvate). In bacteria such as Clostridium symbiosum, PPDK uses Mg2+ and NH4+ ions as cofactors . The enzyme has three domains: the N- and C-terminal domains each have an active site centre that catalyses a different step in the reaction, and the middle domain has a carrier histidine residue that moves between the two active centres. In plants, PPDK is localised predominantly in chloroplast stroma where it catalyses the rate-limiting step in the C4 photosynthetic pathway, namely the synthesis of PEP, which acts as the primary CO2 acceptor in C4 photosynthesis . PPDK activity in C4 plants is strictly regulated by light, its activity decreasing in darkness. This response is regulated by phosphorylation and dephosphorylation of the enzyme using ADP; such regulation is not seen in the bacterial form of the enzyme. PPDK is also found in C3 plants, but it is not known to have a photosynthetic role .; GO: 0050242 pyruvate phosphate dikinase activity. Probab=26.20 E-value=20 Score=18.84 Aligned_cols=10 Identities=60% Similarity=1.188 Sum_probs=7.9 Q ss_pred HHHHHCCCCH Q ss_conf 0332137556 Q 537021.9.peg.3 21 PSFFSFGCSD 30 (43) Q Consensus 21 psffsfgcsd 30 (43) -.|||||-.| T Consensus 808 A~FFSFGTND 817 (920) T TIGR01828 808 ADFFSFGTND 817 (920) T ss_pred CCCCCCCCCC T ss_conf 3534367752 No 7 >pfam03198 Glyco_hydro_72 Glycolipid anchored surface protein (GAS1). Probab=19.25 E-value=35 Score=17.75 Aligned_cols=14 Identities=57% Similarity=1.258 Sum_probs=10.1 Q ss_pred CCCCHHHHH-CCCCH Q ss_conf 765403321-37556 Q 537021.9.peg.3 17 DKSIPSFFS-FGCSD 30 (43) Q Consensus 17 dksipsffs-fgcsd 30 (43) +-+||-||| |||.. T Consensus 235 ~y~vPvffSEyGCn~ 249 (313) T pfam03198 235 NYSIPIFFSEYGCNK 249 (313) T ss_pred CCCCCEEECCCCCCC T ss_conf 898484876669899 No 8 >pfam08196 UL2 UL2 protein. Orf UL2 of Human cytomegalovirus (HCMV) which is a short protein of unknown function. Probab=18.45 E-value=93 Score=15.72 Aligned_cols=23 Identities=39% Similarity=0.583 Sum_probs=16.4 Q ss_pred EEEECC-CCCCHHHHHCCCCHHHH Q ss_conf 575227-76540332137556899 Q 537021.9.peg.3 11 VLDIEG-DKSIPSFFSFGCSDEFI 33 (43) Q Consensus 11 vldieg-dksipsffsfgcsdefi 33 (43) .|-.|. |...|||=||..|.... T Consensus 8 ilivedddda~psfgs~~ashaqy 31 (60) T pfam08196 8 ILIVEDDDDALPSFGSFNASHAQY 31 (60) T ss_pred EEEEECCCCCCCCCCCCCHHHHHH T ss_conf 999954887777777746278788 No 9 >TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent; InterPro: IPR010097 This entry represents the NAD-dependent malate dehydrogenase found in eukaryotes and certain gamma proteobacteria. The enzyme is involved in the citric acid cycle as well as the glyoxalate cycle. Several isoforms exist in eukaryotes. In Saccharomyces cereviseae, for example, there are cytoplasmic, mitochondrial and peroxisomal forms. Although malate dehydrogenases have in some cases been mistaken for lactate dehydrogenases due to the similarity of these two substrates and the apparent ease with which evolution can toggle these activities, critical residues have been identified which can discriminate between the two activities.; GO: 0030060 L-malate dehydrogenase activity, 0006108 malate metabolic process. Probab=14.51 E-value=81 Score=16.02 Aligned_cols=14 Identities=43% Similarity=0.608 Sum_probs=10.9 Q ss_pred EEEECCCCCEEEEC Q ss_conf 13410387057522 Q 537021.9.peg.3 2 VRVQKAGTDVLDIE 15 (43) Q Consensus 2 vrvqkagtdvldie 15 (43) -|||-|||.|..-. T Consensus 242 ~RiQ~aGtEVVkAK 255 (379) T TIGR01772 242 HRIQFAGTEVVKAK 255 (379) T ss_pred CEEECCCCEEEEEE T ss_conf 00530483688701 No 10 >pfam04761 Phage_Treg Lactococcus bacteriophage putative transcription regulator. This family represents a number of putative transcription repressor proteins found in several Lactococcus bacteriophages. Horizontal transfer may account for the presence of similar proteins in Lactococcus. Probab=14.38 E-value=85 Score=15.91 Aligned_cols=17 Identities=47% Similarity=0.593 Sum_probs=13.6 Q ss_pred CCCCHHHHHHHHHHHHH Q ss_conf 37556899998777620 Q 537021.9.peg.3 26 FGCSDEFILKSLIIQIF 42 (43) Q Consensus 26 fgcsdefilksliiqif 42 (43) -.-|..||-.|||-|.| T Consensus 28 ~~ls~~fik~slipql~ 44 (58) T pfam04761 28 KDLSKDFIKDSLIPQLF 44 (58) T ss_pred HHHHHHHHHHHHHHHHH T ss_conf 99899999861569999 Done!