RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.330_1 (43 letters) >gnl|CDD|133092 cd06234, M14_Nna1_like_1, A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins. The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Nna1-like proteins are active metallopeptidases that are thought to act on cytosolic proteins (such as alpha-tubulin in eukaryotes) to remove a C-terminal tyrosine. Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal domain might act as a folding domain. Length = 263 Score = 25.7 bits (57), Expect = 2.8 Identities = 10/28 (35%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Query: 3 RVQKAGTD-VLDIEGDKSIPSFFSFGCS 29 R+++ G D LD+ GD+++P F G Sbjct: 145 RMEETGVDFFLDVHGDEALPYNFIAGSE 172 >gnl|CDD|33652 COG3862, COG3862, Uncharacterized protein with conserved CXXC pairs [Function unknown]. Length = 117 Score = 24.5 bits (53), Expect = 6.9 Identities = 8/30 (26%), Positives = 13/30 (43%) Query: 2 VRVQKAGTDVLDIEGDKSIPSFFSFGCSDE 31 VRV+ V+ ++ +K IP E Sbjct: 52 VRVKNGELPVVPVKTEKPIPKELIPELMKE 81 >gnl|CDD|34743 COG5142, OXR1, Oxidation resistance protein [DNA replication, recombination, and repair]. Length = 212 Score = 23.8 bits (51), Expect = 9.3 Identities = 5/11 (45%), Positives = 6/11 (54%) Query: 21 PSFFSFGCSDE 31 P F +FGC Sbjct: 158 PDFLAFGCGGG 168 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.329 0.146 0.416 Gapped Lambda K H 0.267 0.0737 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 501,116 Number of extensions: 15139 Number of successful extensions: 51 Number of sequences better than 10.0: 1 Number of HSP's gapped: 51 Number of HSP's successfully gapped: 5 Length of query: 43 Length of database: 6,263,737 Length adjustment: 17 Effective length of query: 26 Effective length of database: 5,896,384 Effective search space: 153305984 Effective search space used: 153305984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (23.4 bits)