BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.330_1 (43 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.330_1 Length = 43 Score = 85.9 bits (211), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 43/43 (100%), Positives = 43/43 (100%) Query: 1 MVRVQKAGTDVLDIEGDKSIPSFFSFGCSDEFILKSLIIQIFL 43 MVRVQKAGTDVLDIEGDKSIPSFFSFGCSDEFILKSLIIQIFL Sbjct: 1 MVRVQKAGTDVLDIEGDKSIPSFFSFGCSDEFILKSLIIQIFL 43 >gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Score = 20.4 bits (41), Expect = 5.6, Method: Composition-based stats. Identities = 7/23 (30%), Positives = 14/23 (60%) Query: 13 DIEGDKSIPSFFSFGCSDEFILK 35 DI+ DKS+ S+ + D +++ Sbjct: 358 DIDPDKSLASYLTGSSGDSLMVR 380 >gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 20.4 bits (41), Expect = 6.8, Method: Composition-based stats. Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 10 DVLDIEGDKSIP 21 D L+ EG+KSIP Sbjct: 792 DPLESEGNKSIP 803 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.329 0.146 0.416 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,896 Number of Sequences: 1233 Number of extensions: 616 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 43 length of database: 328,796 effective HSP length: 16 effective length of query: 27 effective length of database: 309,068 effective search space: 8344836 effective search space used: 8344836 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 31 (16.5 bits)