BLAST/PSIBLAST alignment of GI: peg_34 and GI: 327193458 at iteration 1
>gi|327193458|gb|EGE60354.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CNPAF512] Length = 531
 Score =  291 bits (746), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 169/208 (81%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T+KT+ ILNKE L+KTK GV IINCARGGLVDE ALAE ++SGHVA A FDVFEV
Sbjct: 203 LHVPMTDKTRGILNKEALAKTKPGVRIINCARGGLVDEAALAEAIKSGHVAGAAFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPAKESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F+GQ+  E I+EI+I+YDG TA MNT  L SAVLAG++R    
Sbjct: 323 EAPILKPFIRLADVLGAFVGQVTEEPIKEIEILYDGITASMNTRALTSAVLAGLIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+IKE  I+LS +KRDK+GV
Sbjct: 383 DVNMVSAPIMIKEKGIVLSEVKRDKTGV 410