BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.34_1
         (208 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|222149645|ref|YP_002550602.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis S4]
 gi|221736627|gb|ACM37590.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium vitis S4]
          Length = 531

 Score =  295 bits (755), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 171/208 (82%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T+KT+ IL KENL+KTK GV IINCARGGLVDE ALAE ++SGHVA AGFDVFEV
Sbjct: 203 LHVPMTDKTRGILGKENLAKTKPGVRIINCARGGLVDEAALAEAIKSGHVAGAGFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL++G VSNA+NM  I+ E
Sbjct: 263 EPAKESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLVNGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAPL+KPF+ LAD LG F+GQ+   +I+EI+I+YDG TA MNT  L SA+LAG++R    
Sbjct: 323 EAPLLKPFIRLADVLGAFVGQVTDGAIKEIEILYDGQTATMNTKALTSALLAGLIRAQVS 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+IKE  I+LS +KRDK+GV
Sbjct: 383 DVNMVSAPIMIKEKGIVLSEVKRDKTGV 410


>gi|327193458|gb|EGE60354.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli
           CNPAF512]
          Length = 531

 Score =  291 bits (746), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 169/208 (81%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T+KT+ ILNKE L+KTK GV IINCARGGLVDE ALAE ++SGHVA A FDVFEV
Sbjct: 203 LHVPMTDKTRGILNKEALAKTKPGVRIINCARGGLVDEAALAEAIKSGHVAGAAFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPAKESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F+GQ+  E I+EI+I+YDG TA MNT  L SAVLAG++R    
Sbjct: 323 EAPILKPFIRLADVLGAFVGQVTEEPIKEIEILYDGITASMNTRALTSAVLAGLIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+IKE  I+LS +KRDK+GV
Sbjct: 383 DVNMVSAPIMIKEKGIVLSEVKRDKTGV 410


>gi|86359045|ref|YP_470937.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli CFN 42]
 gi|86283147|gb|ABC92210.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CFN 42]
          Length = 531

 Score =  291 bits (745), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 169/208 (81%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T+KT+ ILNKE L+KTK GV IINCARGGLVDE ALAE ++SGHVA A FDVFEV
Sbjct: 203 LHVPMTDKTRGILNKEALAKTKPGVRIINCARGGLVDEAALAEAIKSGHVAGAAFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPARESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F+GQ+  E I+EI+I+YDG TA MNT  L SAVLAG++R    
Sbjct: 323 EAPILKPFIRLADVLGAFVGQVTEEPIKEIEILYDGVTANMNTRALTSAVLAGLIRPQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+IKE  I+LS +KRDK+GV
Sbjct: 383 DVNMVSAPIMIKEKGIVLSEVKRDKTGV 410


>gi|227823299|ref|YP_002827271.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium fredii NGR234]
 gi|227342300|gb|ACP26518.1| phosphoglycerate dehydrogenase [Sinorhizobium fredii NGR234]
          Length = 531

 Score =  291 bits (744), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 137/208 (65%), Positives = 170/208 (81%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+NIL+ E L+KTK GV I+NCARGGLVDE ALA+ L+SGHVA AGFDVFEV
Sbjct: 203 LHVPLTDKTRNILSAEALAKTKPGVRIVNCARGGLVDEKALADALKSGHVAGAGFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QM+DYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMADYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KP + LAD LG F+GQ+   +I+EI+I+YDGSTA MNT  L SAVLAG++R    
Sbjct: 323 EAPILKPVIRLADVLGAFVGQVTESAIKEIEILYDGSTATMNTKALTSAVLAGLIRPQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+IKE  IILS +KRDK+GV
Sbjct: 383 DVNMVSAPIMIKEKGIILSEVKRDKTGV 410


>gi|218675485|ref|ZP_03525154.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli GR56]
          Length = 531

 Score =  290 bits (743), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 137/208 (65%), Positives = 169/208 (81%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T++T+ ILNKE L+KTK GV IINCARGGLVDE ALAE ++SGHVA A FDVFEV
Sbjct: 203 LHVPMTDRTRGILNKEALAKTKPGVRIINCARGGLVDEAALAEAIKSGHVAGAAFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPAKESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F+GQ+  E I+EI+I+YDG TA MNT  L SAVLAG++R    
Sbjct: 323 EAPILKPFIRLADVLGAFVGQVTEEPIKEIEILYDGVTANMNTRALTSAVLAGLIRPQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+IKE  I+LS +KRDK+GV
Sbjct: 383 DVNMVSAPIMIKEKGIVLSEVKRDKTGV 410


>gi|190893267|ref|YP_001979809.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT
           652]
 gi|190698546|gb|ACE92631.1| D-3-phosphoglycerate dehydrogenase protein [Rhizobium etli CIAT
           652]
          Length = 531

 Score =  290 bits (741), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 137/208 (65%), Positives = 168/208 (80%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T+KT+ ILNKE L+KTK GV IINCARGGLVDE ALAE ++SGHVA A FDVFEV
Sbjct: 203 LHVPMTDKTRGILNKEALAKTKPGVRIINCARGGLVDEAALAEAIKSGHVAGAAFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPAKESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F+GQ+  E I+EI+I+YDG TA MNT  L SA LAG++R    
Sbjct: 323 EAPILKPFIRLADVLGAFVGQVTEEPIKEIEILYDGVTANMNTRALTSAALAGLIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+IKE  I+LS +KRDK+GV
Sbjct: 383 DVNMVSAPIMIKEKGIVLSEVKRDKTGV 410


>gi|15891242|ref|NP_356914.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str.
           C58]
 gi|15159607|gb|AAK89699.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens str.
           C58]
          Length = 531

 Score =  289 bits (740), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 135/208 (64%), Positives = 169/208 (81%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T+KT+ ILN ENL+KTK GV I+NCARGGLVDE ALAE ++SGHVA AGFDVFEV
Sbjct: 203 LHVPMTDKTRGILNAENLAKTKKGVRIVNCARGGLVDEAALAEAIKSGHVAGAGFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+   + +EI+I+YDG+TA MNT  L SA+LAG++R    
Sbjct: 323 EAPRLKPFIRLADVLGSFVGQVQESATKEIEILYDGATANMNTKALTSALLAGLIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP++IKE  IILS +KRDK+GV
Sbjct: 383 DVNMVSAPVMIKEKGIILSEVKRDKTGV 410


>gi|218663595|ref|ZP_03519525.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli IE4771]
          Length = 535

 Score =  289 bits (740), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 169/208 (81%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T+KT+ ILNKE L+KTK GV IINCARGGLVDE ALAE ++SGHVA A FDVFEV
Sbjct: 207 LHVPMTDKTRGILNKEALAKTKPGVRIINCARGGLVDEAALAEAIKSGHVAGAAFDVFEV 266

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 267 EPAKESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 326

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F+GQ+  E I+EI+I+YDG TA MNT  L SAVLAG++R    
Sbjct: 327 EAPILKPFIRLADVLGAFVGQVTEEPIKEIEILYDGLTANMNTRALTSAVLAGLIRPQVA 386

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+IKE  I+LS +KRDK+GV
Sbjct: 387 DVNMVSAPIMIKEKGIVLSEVKRDKTGV 414


>gi|116253700|ref|YP_769538.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258348|emb|CAK09450.1| putative D-3-phosphoglycerate dehydrogenase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 531

 Score =  288 bits (738), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 170/208 (81%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T+KT+ ILNKE L+KTK GV IINCARGGLVDE ALAE ++SGHVA A FDVFEV
Sbjct: 203 LHVPMTDKTRGILNKEALAKTKPGVRIINCARGGLVDEAALAEAIKSGHVAGAAFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QM+DYL++G VSNA+NM  I+ E
Sbjct: 263 EPAKESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMADYLVNGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F+GQ+  E I+EI+I+YDG TA MNT  L SAVLAG++R    
Sbjct: 323 EAPILKPFIRLADVLGAFVGQVTEEPIKEIEILYDGLTANMNTRALTSAVLAGLIRPQVS 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+IKE  ++LS +KRDK+GV
Sbjct: 383 DVNMVSAPIMIKEKGVVLSEVKRDKTGV 410


>gi|307300480|ref|ZP_07580260.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C]
 gi|306904646|gb|EFN35230.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti BL225C]
          Length = 531

 Score =  288 bits (738), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 133/208 (63%), Positives = 169/208 (81%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+NILN E ++K K GV IINCARGGLVDE ALAE L++GHVA AGFDVFEV
Sbjct: 203 LHVPLTDKTRNILNAEAITKAKPGVRIINCARGGLVDEKALAEALKAGHVAGAGFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMS+YL+ G V+NA+NM  I+ E
Sbjct: 263 EPATESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSEYLVKGAVTNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F+GQ+   +I+EI+I+YDGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPILKPFIRLADVLGAFVGQVTESAIKEIEILYDGSTAAMNTKALTSAALAGLIRPQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP+++KE  +ILS +KRDK+GV
Sbjct: 383 DVNMVSAPVMVKEKGVILSEVKRDKTGV 410


>gi|241206175|ref|YP_002977271.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860065|gb|ACS57732.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 531

 Score =  288 bits (738), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 169/208 (81%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T+KT+ ILNKE L+KTK GV IINCARGGLVDE ALAE ++SGHVA A FDVFEV
Sbjct: 203 LHVPMTDKTRGILNKEALAKTKPGVRIINCARGGLVDEAALAEAIKSGHVAGAAFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QM+DYL++G VSNA+NM  I+ E
Sbjct: 263 EPAKESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMADYLVNGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F+GQ+  E I+EI+I+YDG TA MNT  L SA LAG++R    
Sbjct: 323 EAPILKPFIRLADVLGAFVGQVTEEPIKEIEILYDGITANMNTRALTSAALAGLIRPQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+IKE  I+LS +KRDK+GV
Sbjct: 383 DVNMVSAPIMIKEKGIVLSEVKRDKTGV 410


>gi|15966483|ref|NP_386836.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti 1021]
 gi|15075754|emb|CAC47309.1| Putative D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti
           1021]
          Length = 531

 Score =  288 bits (737), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 133/208 (63%), Positives = 169/208 (81%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+NILN E ++K K GV IINCARGGLVDE ALAE L++GHVA AGFDVFEV
Sbjct: 203 LHVPLTDKTRNILNAEAIAKAKPGVRIINCARGGLVDEKALAEALKAGHVAGAGFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMS+YL+ G V+NA+NM  I+ E
Sbjct: 263 EPATESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSEYLVKGAVTNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F+GQ+   +I+EI+I+YDGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPILKPFIRLADVLGAFVGQVTESAIKEIEILYDGSTAAMNTKALTSAALAGLIRPQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP+++KE  +ILS +KRDK+GV
Sbjct: 383 DVNMVSAPVMVKEKGVILSEVKRDKTGV 410


>gi|209550768|ref|YP_002282685.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536524|gb|ACI56459.1| D-3-phosphoglycerate dehydrogenase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 531

 Score =  288 bits (737), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 135/208 (64%), Positives = 169/208 (81%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T+KT+ ILNKE L+KTK GV IINCARGGLVDE ALAE ++SGHVA A FDVFEV
Sbjct: 203 LHVPMTDKTRGILNKEALAKTKPGVRIINCARGGLVDEAALAEAIKSGHVAGAAFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QM+DYL+ G VSNA+NM  I+ E
Sbjct: 263 EPAKESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMADYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F+GQ+  E I+EI+I+YDG TA MNT  L SAVLAG++R    
Sbjct: 323 EAPILKPFIRLADVLGAFVGQVTEEPIKEIEILYDGITANMNTRALTSAVLAGLIRPQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  ++LS +KRDK+GV
Sbjct: 383 DVNMVSAPIMVKEKGVVLSEVKRDKTGV 410


>gi|325063120|gb|ADY66810.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium sp. H13-3]
          Length = 531

 Score =  287 bits (734), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 133/208 (63%), Positives = 169/208 (81%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T+KT+ ILN ENL+KTK GV I+NCARGGLVDE ALA+ ++SGHVA AGFDVFEV
Sbjct: 203 LHVPMTDKTRGILNAENLAKTKKGVRIVNCARGGLVDEAALADAIKSGHVAGAGFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+   + +EI+I+YDG+TA MNT  L SA+LAG++R    
Sbjct: 323 EAPRLKPFIRLADVLGSFVGQVQESATKEIEILYDGATANMNTKALTSALLAGLIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP++IKE  +ILS +KRDK+GV
Sbjct: 383 DVNMVSAPVMIKEKGVILSEVKRDKTGV 410


>gi|150397816|ref|YP_001328283.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium medicae WSM419]
 gi|150029331|gb|ABR61448.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium medicae WSM419]
          Length = 531

 Score =  286 bits (733), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 133/208 (63%), Positives = 168/208 (80%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT++ILN E ++K K GV IINCARGGLVDE ALAE ++SGHVA AGFDVFEV
Sbjct: 203 LHVPLTDKTRSILNAEAIAKAKPGVRIINCARGGLVDEKALAEAIKSGHVAGAGFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PLFGLPNV C P+LGAST E+QE VA+Q+A QMS+YL+ G V+NA+NM  I+ E
Sbjct: 263 EPATDSPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSEYLVKGAVTNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F+GQ+   +I+EI+I+YDGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPMLKPFIRLADVLGAFVGQVTESAIKEIEILYDGSTAAMNTKALTSAALAGLIRPQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP++IKE  +ILS +KRDK+GV
Sbjct: 383 DVNMVSAPVMIKEKGVILSEVKRDKTGV 410


>gi|307318345|ref|ZP_07597780.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti AK83]
 gi|306896027|gb|EFN26778.1| D-3-phosphoglycerate dehydrogenase [Sinorhizobium meliloti AK83]
          Length = 531

 Score =  284 bits (726), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 168/208 (80%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+NILN E ++K K GV IINCARGGLVDE ALAE L++GHVA AGFDVFEV
Sbjct: 203 LHVPLTDKTRNILNAEAIAKAKPGVRIINCARGGLVDEKALAEALKAGHVAGAGFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMS+ L+ G V+NA+NM  I+ E
Sbjct: 263 EPATESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSECLVKGAVTNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F+GQ+   +I+EI+I+YDGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPILKPFIRLADVLGAFVGQVTESAIKEIEILYDGSTAAMNTKALTSAALAGLIRPQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP+++KE  +ILS +KRDK+GV
Sbjct: 383 DVNMVSAPVMVKEKGVILSEVKRDKTGV 410


>gi|163758780|ref|ZP_02165867.1| D-3-phosphoglycerate dehydrogenase [Hoeflea phototrophica DFL-43]
 gi|162284070|gb|EDQ34354.1| D-3-phosphoglycerate dehydrogenase [Hoeflea phototrophica DFL-43]
          Length = 531

 Score =  282 bits (722), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 133/208 (63%), Positives = 166/208 (79%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T+KT+ ILN E L+KTK GV I+NCARGGLVDE ALAE ++SGHVA AGFDVFE 
Sbjct: 203 LHVPMTDKTRGILNAEALAKTKPGVRIVNCARGGLVDEAALAEAIKSGHVAGAGFDVFET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLVRGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KPF+ LAD LG F GQ+    I++I+I+YDG TA MNT  L SA+LAG++R    
Sbjct: 323 EAPILKPFIRLADVLGAFAGQVTESPIKQIEILYDGVTAGMNTKALTSALLAGLIRNQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  IILS +KRDK+GV
Sbjct: 383 DVNMVSAPIMVKEKGIILSEVKRDKTGV 410


>gi|222086960|ref|YP_002545494.1| D-3-phosphoglycerate dehydrogenase protein [Agrobacterium
           radiobacter K84]
 gi|221724408|gb|ACM27564.1| D-3-phosphoglycerate dehydrogenase protein [Agrobacterium
           radiobacter K84]
          Length = 531

 Score =  280 bits (715), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 167/208 (80%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+NI++ + L+K K GV IINCARGGLVDE ALA  ++SGHVA A FDVFEV
Sbjct: 203 LHVPLTDKTRNIIDADALAKIKPGVRIINCARGGLVDEAALAAAIKSGHVAGAAFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPAKESPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAPL+KPF+ LAD LG F+GQ+  + I+EI+I+YDG TA MNT  L SA+LAG++R    
Sbjct: 323 EAPLLKPFIKLADVLGAFVGQVTDDPIKEIEILYDGVTAGMNTKALTSALLAGLIRNQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+IKE  I+L+ +KRDK+GV
Sbjct: 383 DVNMVSAPIMIKEKGIVLAEVKRDKTGV 410


>gi|149202983|ref|ZP_01879954.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. TM1035]
 gi|149143529|gb|EDM31565.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. TM1035]
          Length = 531

 Score =  267 bits (683), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 162/207 (78%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+N+L++ENL KTK GV IINCARGGLVDE ALA+LL+SGHVA AGFDVF  
Sbjct: 203 LHVPLTDQTRNVLSRENLEKTKKGVRIINCARGGLVDEQALADLLKSGHVAGAGFDVFTE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA++NPLFGLPNV C P+LGA+T E+QE VA+Q+A QMSDYL+ G V+NALNM  ++ E
Sbjct: 263 EPAVENPLFGLPNVVCTPHLGAATTEAQENVALQVAEQMSDYLLTGAVTNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LADHLG FIGQ+  E I+ I I+YDG  + MN   L SA +AGI++    
Sbjct: 323 EAKVMGPWIKLADHLGNFIGQMTDEPIKAINILYDGVVSEMNLGALTSAAVAGIMKSVNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  + +ST K+DKSG
Sbjct: 383 EVNMVSAPVVAKERGVKISTTKQDKSG 409


>gi|85705886|ref|ZP_01036982.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. 217]
 gi|85669474|gb|EAQ24339.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. 217]
          Length = 531

 Score =  266 bits (680), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 161/207 (77%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL++ENL KTK GV +INCARGGLVDE ALA+LL+SGHVA AGFDVF  
Sbjct: 203 LHVPLTDQTRNILSRENLEKTKKGVRVINCARGGLVDEQALADLLKSGHVAGAGFDVFTE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA+ NPLFGLPNV C P+LGA+T E+QE VA+Q+A QMSDYL+ G V+NALNM  ++ E
Sbjct: 263 EPAVDNPLFGLPNVVCTPHLGAATTEAQENVALQVAEQMSDYLLTGAVTNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LADHLG FIGQ+  E I+ I I+YDG  + MN   L SA +AGI++    
Sbjct: 323 EAKVMGPWIKLADHLGNFIGQMTDEPIKAINILYDGVVSEMNLGALTSAAVAGIMKCVNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  + +ST K+DKSG
Sbjct: 383 EVNMVSAPVVAKERGVKISTTKQDKSG 409


>gi|56698179|ref|YP_168551.1| D-3-phosphoglycerate dehydrogenase [Ruegeria pomeroyi DSS-3]
 gi|56679916|gb|AAV96582.1| D-3-phosphoglycerate dehydrogenase [Ruegeria pomeroyi DSS-3]
          Length = 531

 Score =  265 bits (678), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 124/207 (59%), Positives = 159/207 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL +ENL+KTK GV IINCARGGLVDE ALAE+LQSGHVA A FDVF V
Sbjct: 203 LHVPLTDQTRNILGRENLAKTKKGVRIINCARGGLVDEEALAEMLQSGHVAGAAFDVFSV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFGLPNV C P+LGA+T E+QE VA+Q+A QMS+YL+ G V NALNM  ++ E
Sbjct: 263 EPAKENPLFGLPNVVCTPHLGAATTEAQENVALQVAEQMSNYLLTGAVENALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA HLG F+GQ+  E I+ I I+YDG+ + MN   LN A +AGI++    
Sbjct: 323 EAKVMGPWIALAGHLGSFVGQMTDEPIKAINILYDGTASTMNLAALNCATVAGIMKKANP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  I +ST  +DKSG
Sbjct: 383 EVNMVSAPVVAKERGIQISTTNQDKSG 409


>gi|225628254|ref|ZP_03786288.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti str. Cudo]
 gi|225616100|gb|EEH13148.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti str. Cudo]
          Length = 538

 Score =  265 bits (677), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 159/208 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI+N + L+K K GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 208 LHTPLTDKTRNIINAQTLAKMKPGVRIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 267

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA++N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 268 EPAMENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 327

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG +R    
Sbjct: 328 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGFIRSQVA 387

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 388 DVNMVSAPIMVKERGIIVSEVKRDKSGI 415


>gi|260167901|ref|ZP_05754712.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
 gi|261757340|ref|ZP_06001049.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
 gi|261737324|gb|EEY25320.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. F5/99]
          Length = 533

 Score =  265 bits (677), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 159/208 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI+N + L+K K GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 203 LHTPLTDKTRNIINAQTLAKMKPGVRIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA++N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPAMENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG +R    
Sbjct: 323 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGFIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 383 DVNMVSAPIMVKERGIIVSEVKRDKSGI 410


>gi|149912706|ref|ZP_01901240.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. AzwK-3b]
 gi|149813112|gb|EDM72938.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. AzwK-3b]
          Length = 531

 Score =  265 bits (676), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 124/207 (59%), Positives = 160/207 (77%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL++ENL KTK GV +INCARGGLVDE ALA+LL SGHVA AGFDVF V
Sbjct: 203 LHVPLTDQTRNILSRENLEKTKKGVRVINCARGGLVDEQALADLLTSGHVAGAGFDVFAV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFGLPNV C P+LGA+T E+QE VA+Q+A QMSDYL+ G VSNALNM  ++ E
Sbjct: 263 EPATENPLFGLPNVVCTPHLGAATTEAQENVALQVAEQMSDYLLTGAVSNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ L+DHLG FIGQ+  E I+ I I+YDG  + MN   L  + +AGI++    
Sbjct: 323 EAKVMGPWIKLSDHLGNFIGQMTDEPIKAINILYDGVVSNMNLEALTCSAIAGIMKSVNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  + +ST K+DKSG
Sbjct: 383 EVNMVSAPVVAKERGVKISTTKQDKSG 409


>gi|114763689|ref|ZP_01443083.1| D-3-phosphoglycerate dehydrogenase [Pelagibaca bermudensis
           HTCC2601]
 gi|114543690|gb|EAU46703.1| D-3-phosphoglycerate dehydrogenase [Roseovarius sp. HTCC2601]
          Length = 531

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 161/208 (77%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+ T+NIL+KENL KTK GV IINCARGGLVDE ALAEL++SGHVA A FDVF  
Sbjct: 203 LHVPLTDGTRNILSKENLEKTKKGVRIINCARGGLVDEAALAELIKSGHVAGAAFDVFAE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNALNM  ++ E
Sbjct: 263 EPAKENPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLLTGAVSNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ +A+HLG FIGQ+  E+++ I I YDG  A MN   LN A++AGI++    
Sbjct: 323 EAKVMGPWIKVAEHLGGFIGQMTEEAVKAINITYDGEAATMNLEALNCALIAGIMKASSP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP+I KE  I ++T ++++SGV
Sbjct: 383 EVNMVSAPVIAKERGIQIATTRQEQSGV 410


>gi|256160401|ref|ZP_05458090.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
 gi|265998770|ref|ZP_06111327.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
 gi|262553459|gb|EEZ09228.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M490/95/1]
          Length = 533

 Score =  263 bits (673), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 158/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI+N + L+K K GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 203 LHTPLTDKTRNIINAQTLAKMKPGVRIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG +R    
Sbjct: 323 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGFIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 383 DVNMVSAPIMVKERGIIVSEVKRDKSGI 410


>gi|256255607|ref|ZP_05461143.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti B1/94]
 gi|261222811|ref|ZP_05937092.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti B1/94]
 gi|260921395|gb|EEX88048.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti B1/94]
          Length = 478

 Score =  263 bits (673), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 158/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI+N + L+K K GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 203 LHTPLTDKTRNIINAQTLAKMKPGVRIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG +R    
Sbjct: 323 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGFIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 383 DVNMVSAPIMVKERGIIVSEVKRDKSGI 410


>gi|254477808|ref|ZP_05091194.1| phosphoglycerate dehydrogenase [Ruegeria sp. R11]
 gi|214032051|gb|EEB72886.1| phosphoglycerate dehydrogenase [Ruegeria sp. R11]
          Length = 531

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 158/207 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL+KENL KTK GV IINCARGGLVDE ALAELL SGHVA A FDVF V
Sbjct: 203 LHVPLTDQTRNILSKENLEKTKKGVRIINCARGGLVDEAALAELLTSGHVAGAAFDVFSV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFGLPNV C P+LGA+T E+QE VA+Q+A QMS+YL+DG V NALNM  ++ E
Sbjct: 263 EPAKENPLFGLPNVVCTPHLGAATTEAQENVALQVAEQMSNYLLDGAVENALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LADHLG F GQ+  E I  I ++YDG  + MN   LN AV+AGI++    
Sbjct: 323 EAKVMGPWIKLADHLGSFAGQMSDEPIVAINVLYDGVVSGMNLDALNCAVIAGIMKNVNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  I +ST  +DKSG
Sbjct: 383 DVNMVSAPVVAKERGIQISTTNQDKSG 409


>gi|159045858|ref|YP_001534652.1| D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shibae DFL 12]
 gi|157913618|gb|ABV95051.1| D-3-phosphoglycerate dehydrogenase [Dinoroseobacter shibae DFL 12]
          Length = 531

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 158/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL++E L KTK GV IINCARGGLVDE ALA+LL+SGHVA A FDVF  
Sbjct: 203 LHVPLTDQTRNILSREALEKTKKGVRIINCARGGLVDEQALADLLKSGHVAGAAFDVFAE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFGLPNV C P+LGAST E+QE VA+Q+A QMS+YL+ G V NALNM  ++ E
Sbjct: 263 EPATENPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSNYLLSGAVENALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA  + P++ LA HLG F+GQL  E I  I+I+Y+G+ A MN   LN AV+AGI++    
Sbjct: 323 EAKTMGPWVKLAGHLGTFVGQLTDEPIDSIEILYNGTVAKMNLEALNCAVIAGIMQATNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP+I KE  I LST  +DKSGV
Sbjct: 383 DVNMVSAPVIAKERGIGLSTTTQDKSGV 410


>gi|83855133|ref|ZP_00948663.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. NAS-14.1]
 gi|83842976|gb|EAP82143.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. NAS-14.1]
          Length = 531

 Score =  262 bits (669), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 160/208 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T++T NIL+KE L+KTK GV IINCARGGLVDE ALAE L+SGHVA A FDVF+ 
Sbjct: 203 LHVPYTDQTANILSKEALAKTKKGVRIINCARGGLVDEEALAEALKSGHVAGAAFDVFKE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFGLPNV C P+LGA+T E+QE VA+Q+A QMSDYL+ G V+NALNM  ++ E
Sbjct: 263 EPATENPLFGLPNVVCTPHLGAATTEAQENVALQVAEQMSDYLLTGAVTNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++TLA HLG FIGQ+  E+++ I I+YDG  + MN   LN AV+AGI++    
Sbjct: 323 EAKVMGPWITLAGHLGAFIGQMTDEAVKAINILYDGQVSEMNLNALNCAVVAGIMKRANP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP++ +E  I +ST  +DKSGV
Sbjct: 383 DVNMVSAPVVAREKGIQISTTNQDKSGV 410


>gi|83941656|ref|ZP_00954118.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. EE-36]
 gi|83847476|gb|EAP85351.1| D-3-phosphoglycerate dehydrogenase [Sulfitobacter sp. EE-36]
          Length = 531

 Score =  262 bits (669), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 160/208 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T++T NIL+KE L+KTK GV IINCARGGLVDE ALAE L+SGHVA A FDVF+ 
Sbjct: 203 LHVPYTDQTANILSKEALAKTKKGVRIINCARGGLVDEEALAEALKSGHVAGAAFDVFKE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFGLPNV C P+LGA+T E+QE VA+Q+A QMSDYL+ G V+NALNM  ++ E
Sbjct: 263 EPATENPLFGLPNVVCTPHLGAATTEAQENVALQVAEQMSDYLLTGAVTNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++TLA HLG FIGQ+  E+++ I I+YDG  + MN   LN AV+AGI++    
Sbjct: 323 EAKVMGPWITLAGHLGAFIGQMTDEAVKAINILYDGQVSEMNLNALNCAVVAGIMKRANP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP++ +E  I +ST  +DKSGV
Sbjct: 383 DVNMVSAPVVAREKGIQISTTNQDKSGV 410


>gi|254486096|ref|ZP_05099301.1| phosphoglycerate dehydrogenase [Roseobacter sp. GAI101]
 gi|214042965|gb|EEB83603.1| phosphoglycerate dehydrogenase [Roseobacter sp. GAI101]
          Length = 531

 Score =  261 bits (667), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 159/208 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T++T NIL+KE L+KTK GV IINCARGGLVDE ALAE L+SGHVA A FDVF+ 
Sbjct: 203 LHVPYTDQTANILSKEALAKTKKGVRIINCARGGLVDEEALAEALKSGHVAGAAFDVFKE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFGLPNV C P+LGA+T E+QE VA+Q+A QMSDYL+ G VSNALNM  ++ E
Sbjct: 263 EPATENPLFGLPNVVCTPHLGAATTEAQENVALQVAEQMSDYLLTGAVSNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++TL+ HLG FIGQ+  E I+ I I+YDG  + MN   LN AV+AGI++    
Sbjct: 323 EAKVMGPWITLSGHLGAFIGQMTDEPIKAINILYDGQVSEMNLNALNCAVVAGIMKRANP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP++ +E  I +ST  +DKSGV
Sbjct: 383 DVNMVSAPVVAREKGIQISTTNQDKSGV 410


>gi|163745024|ref|ZP_02152384.1| D-3-phosphoglycerate dehydrogenase [Oceanibulbus indolifex HEL-45]
 gi|161381842|gb|EDQ06251.1| D-3-phosphoglycerate dehydrogenase [Oceanibulbus indolifex HEL-45]
          Length = 531

 Score =  260 bits (665), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 156/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T++T NIL +ENL+KTK GV IINCARGGLVDE ALAE+L+SGHVA AGFDVF  
Sbjct: 203 LHVPYTDQTANILGRENLAKTKPGVRIINCARGGLVDEEALAEMLKSGHVAGAGFDVFAE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPLF LPNV C P+LGA+T E+QE VA+Q+A QMSDYL+ G V+NALNM  ++ E
Sbjct: 263 EPATDNPLFNLPNVVCTPHLGAATTEAQENVALQVAEQMSDYLLTGAVTNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA HLG FIGQ+  E I+ I I+YDGS   MN   LN  V+AGI++    
Sbjct: 323 EAKVMGPWVKLAGHLGAFIGQMTDEPIKAINILYDGSVGQMNLKALNCGVVAGIMKRANP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP++ +E  I +ST  +DKSGV
Sbjct: 383 DVNMVSAPVVAREKGIQISTTNQDKSGV 410


>gi|260432240|ref|ZP_05786211.1| phosphoglycerate dehydrogenase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416068|gb|EEX09327.1| phosphoglycerate dehydrogenase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 531

 Score =  260 bits (664), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 124/207 (59%), Positives = 159/207 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL++ENL+KTK GV IINCARGGLVDE ALAEL++SGHVA AGFDVF  
Sbjct: 203 LHVPLTDQTRNILSRENLAKTKKGVRIINCARGGLVDEEALAELIKSGHVAGAGFDVFSE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFGLPNV C P+LGA+T E+QE VA+Q+A Q+S+YL+ G V NALNM  ++ E
Sbjct: 263 EPAKENPLFGLPNVVCTPHLGAATTEAQENVALQVAEQISNYLLTGAVENALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA HLG FIGQ+  E I+ I I+YDG  A MN   LN AV+AGI++    
Sbjct: 323 EAKVMGPWIKLAGHLGSFIGQMTDEPIKAINILYDGVAAQMNLAALNCAVVAGIMKRSNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  I +S   +DKSG
Sbjct: 383 EVNMVSAPVVAKERGIKISATNQDKSG 409


>gi|254466037|ref|ZP_05079448.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium Y4I]
 gi|206686945|gb|EDZ47427.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium Y4I]
          Length = 531

 Score =  259 bits (662), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 157/207 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT +T+NIL+KENL KTK GV IINCARGGLVDE ALAELL SGHVA A FDVF  
Sbjct: 203 LHVPLTEQTRNILSKENLEKTKKGVRIINCARGGLVDEAALAELLTSGHVAGAAFDVFSE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFGLPNV C P+LGA+T E+QE VA+Q+A QMS+YL+ G V NALNM  ++ E
Sbjct: 263 EPAKENALFGLPNVVCTPHLGAATTEAQENVALQVAEQMSNYLLTGAVENALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LADHLG F+GQ+  E I+ I I+YDG+ A +N   LN AV+AGI++    
Sbjct: 323 EAKVMGPWIKLADHLGSFVGQMTDEPIKAINILYDGAAAGLNLDALNCAVIAGIMKRSNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  I +ST  +DKSG
Sbjct: 383 EVNLVSAPVVAKERGIQISTTNQDKSG 409


>gi|84502815|ref|ZP_01000928.1| D-3-phosphoglycerate dehydrogenase [Oceanicola batsensis HTCC2597]
 gi|84388798|gb|EAQ01668.1| D-3-phosphoglycerate dehydrogenase [Oceanicola batsensis HTCC2597]
          Length = 531

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 158/207 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL+KENL+KTK GV I+NCARGGLVDE ALAELL+SGHVA AGFDVF  
Sbjct: 203 LHVPLTDQTRNILSKENLAKTKKGVRIVNCARGGLVDEAALAELLKSGHVAGAGFDVFAE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N LF LPNV C P+LGAST E+QE VA+Q+A QMS+YLIDG V NALNM  ++ E
Sbjct: 263 EPATDNVLFNLPNVVCTPHLGASTSEAQENVALQVAEQMSNYLIDGAVENALNMPSMTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA HLG F+GQ+  E I+ I I+YDG  + MN   LN +V+AGI++    
Sbjct: 323 EAKVMGPWVKLAGHLGAFVGQMTDEPIKAINILYDGVVSDMNLAALNCSVIAGIMKRANP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  I +ST  +DKSG
Sbjct: 383 DVNLVSAPVVAKERGIQISTTNQDKSG 409


>gi|239832773|ref|ZP_04681102.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum intermedium LMG
           3301]
 gi|239825040|gb|EEQ96608.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum intermedium LMG
           3301]
          Length = 538

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 161/208 (77%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI+N ENL+KTK GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 208 LHTPLTDKTRNIINAENLAKTKPGVRIVNCARGGLIVEKDLVAALKSGHVAGAGIDVYET 267

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 268 EPATENELFSLPNVVCTPHLGASTAEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 327

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG++R    
Sbjct: 328 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTATMNTRALLSAALAGLIRPQVA 387

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 388 DVNMVSAPIMVKERGIIVSEVKRDKSGI 415


>gi|163742511|ref|ZP_02149897.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis 2.10]
 gi|161384096|gb|EDQ08479.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis 2.10]
          Length = 531

 Score =  259 bits (662), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 157/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL+KENL KTK GV IINCARGGLVDE ALAELL SGHVA A FDVF  
Sbjct: 203 LHVPLTDQTRNILSKENLEKTKKGVRIINCARGGLVDEAALAELLTSGHVAGAAFDVFSE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPLFGLPNV C P+LGA+T E+QE VA+Q+A QMS+YL+DG V NALNM  ++ E
Sbjct: 263 EPAKTNPLFGLPNVVCTPHLGAATSEAQENVALQVAEQMSNYLLDGAVENALNMPSMTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ L+ HLG FIGQ+  E IQ I I+YDG  + MN   LN +V+AGI++    
Sbjct: 323 EARVMGPWVALSGHLGGFIGQMTDEPIQAINILYDGVASEMNLAALNCSVVAGIMKKLNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP++ +E  I +ST  +DKSG 
Sbjct: 383 DVNMVSAPVVARERGIQISTTNQDKSGT 410


>gi|163738093|ref|ZP_02145509.1| flagellar L-ring protein precursor H [Phaeobacter gallaeciensis
           BS107]
 gi|161388709|gb|EDQ13062.1| D-3-phosphoglycerate dehydrogenase [Phaeobacter gallaeciensis
           BS107]
          Length = 531

 Score =  259 bits (661), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 157/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL+KENL KTK GV IINCARGGLVDE ALAELL SGHVA A FDVF  
Sbjct: 203 LHVPLTDQTRNILSKENLEKTKKGVRIINCARGGLVDEAALAELLTSGHVAGAAFDVFSE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPLFGLPNV C P+LGA+T E+QE VA+Q+A QMS+YL+DG V NALNM  ++ E
Sbjct: 263 EPAKTNPLFGLPNVVCTPHLGAATSEAQENVALQVAEQMSNYLLDGAVENALNMPSMTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ L+ HLG FIGQ+  E IQ I I+YDG  + MN   LN +V+AGI++    
Sbjct: 323 EARVMGPWVALSGHLGGFIGQMTDEPIQAINILYDGVASEMNLAALNCSVVAGIMKKLNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP++ +E  I +ST  +DKSG 
Sbjct: 383 DVNMVSAPVVARERGIQISTTNQDKSGT 410


>gi|153008560|ref|YP_001369775.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560448|gb|ABS13946.1| D-3-phosphoglycerate dehydrogenase [Ochrobactrum anthropi ATCC
           49188]
          Length = 533

 Score =  259 bits (661), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 161/208 (77%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI+N ENL+KTK GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 203 LHTPLTDKTRNIINAENLAKTKPGVRIVNCARGGLIVEKDLVAALKSGHVAGAGIDVYET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTATMNTRALLSAALAGLIRPQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 383 DVNMVSAPIMVKERGIIVSEVKRDKSGI 410


>gi|84687790|ref|ZP_01015661.1| D-3-phosphoglycerate dehydrogenase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84664226|gb|EAQ10719.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2654]
          Length = 532

 Score =  258 bits (660), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 158/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+ ILN ENL+KTK GV IINCARGGLVDE ALAE ++SGHVA A FDVFEV
Sbjct: 205 LHVPLTDKTRGILNAENLAKTKKGVRIINCARGGLVDEAALAEAIKSGHVAGAAFDVFEV 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PLFGLPNV C P+LGAST E+QE VA+Q+A Q+SDYL+ G V+NALNM  ++ E
Sbjct: 265 EPAKDSPLFGLPNVVCTPHLGASTTEAQENVALQVAEQISDYLLTGAVTNALNMPSVTAE 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA+HLG F+GQ+  E I+EI +  DG  + MN   L+ AVLAG+++    
Sbjct: 325 EAKVMGPWIKLAEHLGAFVGQMTEEPIKEINVTLDGVASKMNVKALDCAVLAGLMKPQNA 384

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+ K+  I  ST  +DK+GV
Sbjct: 385 EINMVSAPIVAKDRGIKSSTTTQDKTGV 412


>gi|259417745|ref|ZP_05741664.1| phosphoglycerate dehydrogenase [Silicibacter sp. TrichCH4B]
 gi|259346651|gb|EEW58465.1| phosphoglycerate dehydrogenase [Silicibacter sp. TrichCH4B]
          Length = 531

 Score =  257 bits (657), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 156/207 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT +TKNIL++EN+SKTK GV IINCARGGLVDE+ALAE L SGHVA A FDVF V
Sbjct: 203 LHVPLTEQTKNILSRENISKTKKGVRIINCARGGLVDEDALAEALTSGHVAGAAFDVFSV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLF LPNV C P+LGA+T E+QE VA+Q+A QM++YL+ G V NALNM  ++ E
Sbjct: 263 EPAKENPLFNLPNVVCTPHLGAATTEAQENVALQVADQMANYLLTGAVENALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LADHLG F GQ+  E I  I ++YDG  A MN   LN +V+AGI++    
Sbjct: 323 EAKVMGPWIKLADHLGAFAGQMTDEPITAINVLYDGVAADMNLDALNCSVVAGIMKKVNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  I +ST  +DKSG
Sbjct: 383 DVNMVSAPVVAKERGIQISTTNQDKSG 409


>gi|260429359|ref|ZP_05783336.1| phosphoserine aminotransferase [Citreicella sp. SE45]
 gi|260419982|gb|EEX13235.1| phosphoserine aminotransferase [Citreicella sp. SE45]
          Length = 918

 Score =  257 bits (656), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 159/207 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+ T+NIL+ ENL+KTK GV IINCARGGLVDE ALAELL+SGHVA A FDVF  
Sbjct: 590 LHVPLTDGTRNILSAENLAKTKKGVRIINCARGGLVDEAALAELLKSGHVAGAAFDVFSE 649

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNALNM  ++ E
Sbjct: 650 EPAKENPLFGLPNVVCTPHLGASTTEAQENVALQVAEQMSDYLLTGAVSNALNMPSVTAE 709

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ +A HLG FIGQ+  E I+ I I+YDG  + MN   LN +++AGI++    
Sbjct: 710 EAKVMGPWIKVAGHLGNFIGQMTEEPIKAINILYDGEASTMNLEALNCSLIAGIMKPISP 769

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP+I +E  I +ST ++++SG
Sbjct: 770 EVNMVSAPVIARERGIQISTTRQEQSG 796


>gi|294678963|ref|YP_003579578.1| phosphoglycerate dehydrogenase [Rhodobacter capsulatus SB 1003]
 gi|294477783|gb|ADE87171.1| phosphoglycerate dehydrogenase [Rhodobacter capsulatus SB 1003]
          Length = 531

 Score =  257 bits (656), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 157/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+ T+NIL++ENL+KTK GV IINCARGGLVDE ALAE+L+SGHVA A FDVF V
Sbjct: 203 LHVPLTDSTRNILSRENLAKTKPGVRIINCARGGLVDEEALAEMLKSGHVAGAAFDVFSV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPLF LPNV C P+LGAST E+QE VA+Q+A QM++YL+DG V NALNM  ++ +
Sbjct: 263 EPAETNPLFNLPNVVCTPHLGASTSEAQENVALQVAEQMANYLLDGAVENALNMPSMTAD 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA++LG FIGQ+  E I  I + YDG+ + MN   L  AV+AGI+     
Sbjct: 323 EARVMGPWVKLAEYLGAFIGQMTDEPITAINVTYDGTASTMNLRALECAVIAGIMSRVNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP+I KE  I LST  +DKSGV
Sbjct: 383 DVNMVSAPVIAKERGIQLSTTTQDKSGV 410


>gi|89070040|ref|ZP_01157371.1| D-3-phosphoglycerate dehydrogenase [Oceanicola granulosus HTCC2516]
 gi|89044377|gb|EAR50515.1| D-3-phosphoglycerate dehydrogenase [Oceanicola granulosus HTCC2516]
          Length = 530

 Score =  257 bits (656), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 157/207 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT +TKNIL++ENL+KTK GV IINCARGGLVDE ALA+ L+ GHVA A FDVF  
Sbjct: 203 LHVPLTEQTKNILSRENLAKTKKGVRIINCARGGLVDEQALADALKDGHVAGAAFDVFAE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFGLPNV   P+LGA+T E+QE VA+Q+A QM+DYLI G V NALNM  ++ E
Sbjct: 263 EPAKENPLFGLPNVVVTPHLGAATTEAQENVALQVAEQMADYLITGAVQNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ L+ HLG FIGQ+  E I+ I I+YDG+ + MN   L SAV+AGI++    
Sbjct: 323 EAKIMGPWIKLSGHLGNFIGQMTDEPIKAINILYDGAASQMNLSALTSAVVAGIMKAGNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP+I KE  I +ST K+D+SG
Sbjct: 383 DVNMVSAPVIAKERGIQISTTKQDQSG 409


>gi|99082861|ref|YP_615015.1| D-3-phosphoglycerate dehydrogenase [Ruegeria sp. TM1040]
 gi|99039141|gb|ABF65753.1| D-3-phosphoglycerate dehydrogenase [Ruegeria sp. TM1040]
          Length = 531

 Score =  256 bits (655), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 155/207 (74%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT +TKNIL++EN+SKTK GV IINCARGGLVDE ALAE L SGHVA A FDVF V
Sbjct: 203 LHVPLTEQTKNILSRENISKTKKGVRIINCARGGLVDEEALAEALTSGHVAGAAFDVFSV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLF LPNV C P+LGA+T E+QE VA+Q+A QM++YL+ G V NALNM  ++ E
Sbjct: 263 EPAKENPLFNLPNVVCTPHLGAATTEAQENVALQVADQMANYLLTGAVENALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LADHLG F GQ+  E I  I ++YDG  A MN   LN +V+AGI++    
Sbjct: 323 EAKIMGPWIKLADHLGAFAGQMTDEPITAINVLYDGVAADMNLDALNCSVVAGIMKKVNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  I +ST  +DKSG
Sbjct: 383 DVNMVSAPVVAKERGIQISTTNQDKSG 409


>gi|146276068|ref|YP_001166227.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554309|gb|ABP68922.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 531

 Score =  256 bits (654), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 157/207 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+NIL+ EN++KTK GV IINCARGGLVDE ALAE L+SGHVA A FDVFEV
Sbjct: 203 LHVPLTDKTRNILSAENIAKTKKGVRIINCARGGLVDEAALAEALKSGHVAGAAFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFGLPNV   P+LGAST E+QE VA+Q+A QMSD+L+ G V NALNM  ++ E
Sbjct: 263 EPATESPLFGLPNVVVTPHLGASTTEAQENVALQVAEQMSDFLLTGAVQNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA HLG F+GQ+  E I+ I ++YDG+   MN   LN A +AGI++    
Sbjct: 323 EAAVMGPWVKLAGHLGAFVGQMTDEPIKAINVLYDGAVGEMNLAALNCATIAGIMKATNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  I +ST  ++KSG
Sbjct: 383 DVNLVSAPVVAKERGIQISTTTQEKSG 409


>gi|163845265|ref|YP_001622920.1| D-3-phosphoglycerate dehydrogenase [Brucella suis ATCC 23445]
 gi|163675988|gb|ABY40098.1| D-3-phosphoglycerate dehydrogenase [Brucella suis ATCC 23445]
          Length = 533

 Score =  256 bits (654), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 160/208 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI+N + L+K K GVCI+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 203 LHTPLTDKTRNIINAQTLAKMKPGVCIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGLIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 383 DVNMVSAPIMVKERGIIVSEVKRDKSGI 410


>gi|126738641|ref|ZP_01754346.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. SK209-2-6]
 gi|126720440|gb|EBA17146.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. SK209-2-6]
          Length = 531

 Score =  256 bits (653), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 156/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL+KENL+KTK GV IINCARGGLVDE ALAE L SGHVA A FDVF  
Sbjct: 203 LHVPLTDQTRNILSKENLAKTKKGVRIINCARGGLVDEGALAEALTSGHVAGAAFDVFSE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGA+T E+QE VA+Q+A QMS+YL+ G V NALNM  ++ E
Sbjct: 263 EPAKENALFNLPNVVCTPHLGAATTEAQENVALQVAEQMSNYLLTGAVENALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LADHLG F+GQ+  E I+ I I+YDG  + MN   LN AV+AGI++    
Sbjct: 323 EAKIMGPWIKLADHLGAFVGQMTDEPIKAINILYDGVASEMNLDALNCAVVAGIMKKVNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP++ KE  I +ST  +DKSG 
Sbjct: 383 DVNMVSAPVVAKERGIQISTTNQDKSGT 410


>gi|126732689|ref|ZP_01748485.1| D-3-phosphoglycerate dehydrogenase [Sagittula stellata E-37]
 gi|126706819|gb|EBA05889.1| D-3-phosphoglycerate dehydrogenase [Sagittula stellata E-37]
          Length = 532

 Score =  255 bits (651), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 158/207 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+ T+NIL+KENL+KTK GV IINCARGGLVDE ALAELL+SGHVA A FDVF  
Sbjct: 204 LHVPLTDGTRNILSKENLAKTKKGVRIINCARGGLVDEEALAELLKSGHVAGAAFDVFAQ 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G V+NALNM  ++ E
Sbjct: 264 EPAKENPLFNLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLLTGAVTNALNMPNVTAE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LADHLG FIGQ+  E I+ I I+YDG  A MN   LN +++AGI++    
Sbjct: 324 EAKVMGPWIKLADHLGNFIGQMTDEPIKAINILYDGYAAEMNLAALNCSLIAGIMKSVNP 383

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ K+  I +ST  + ++G
Sbjct: 384 EVNMVSAPLVAKDRGIKISTTNQAQTG 410


>gi|254509701|ref|ZP_05121768.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium KLH11]
 gi|221533412|gb|EEE36400.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium KLH11]
          Length = 531

 Score =  255 bits (651), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 158/207 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL++ENL+KTKSGV I+NCARGGLVDE AL+E+LQSGHVA A FDVF V
Sbjct: 203 LHVPLTDQTRNILSRENLAKTKSGVRIVNCARGGLVDEEALSEMLQSGHVAGAAFDVFSV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPLF LPNV C P+LGA+T E+QE VA+Q+A Q+S+YL+ G V NALNM  ++ E
Sbjct: 263 EPAKDNPLFNLPNVVCTPHLGAATTEAQENVALQVAEQISNYLLTGAVENALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA HLG FIGQ+  E I+ I I+YDG    MN   LN +V+AGI++    
Sbjct: 323 EAKVMGPWIKLACHLGSFIGQMTDEPIKAINILYDGVAGEMNLAALNCSVVAGIMKKSNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ +E  I +ST  +DKSG
Sbjct: 383 EVNMVSAPVVARERGIQISTTNQDKSG 409


>gi|86139432|ref|ZP_01058001.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. MED193]
 gi|85823935|gb|EAQ44141.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. MED193]
          Length = 531

 Score =  254 bits (650), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 154/207 (74%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T+ T NIL++ENL+KTK GV IINCARGGLVDE ALAE LQSGHVA A FDVF  
Sbjct: 203 LHVPFTDATANILSRENLAKTKKGVRIINCARGGLVDEEALAEALQSGHVAGAAFDVFSE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGA+T E+QE VA+Q+A QMS+YL+ G V NALNM  ++ E
Sbjct: 263 EPAKENALFNLPNVVCTPHLGAATTEAQENVALQVAEQMSNYLLTGAVENALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LADHLG F+GQ+  E I+ I I+YDG  A MN   LN AV+AGI++    
Sbjct: 323 EAKVMGPWIKLADHLGAFVGQMTDEPIKAINILYDGVAAEMNLDALNCAVVAGIMKKVNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  I +ST  +DKSG
Sbjct: 383 DVNMVSAPVVAKERGIQISTTNQDKSG 409


>gi|260574246|ref|ZP_05842251.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sp. SW2]
 gi|259023712|gb|EEW27003.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sp. SW2]
          Length = 531

 Score =  254 bits (649), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 120/207 (57%), Positives = 157/207 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+NIL++ENL+KTK GV IINCARGGL+DE AL + L+SG VA A  DVFE 
Sbjct: 203 LHVPLTDKTRNILSRENLAKTKKGVRIINCARGGLIDEAALVDALKSGQVAAAALDVFET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLF +PNV C P+LGAST E+QE VA+Q+A QMSD+L+ G V NALNM  ++ E
Sbjct: 263 EPATESPLFNMPNVVCTPHLGASTSEAQENVALQVAEQMSDFLLTGAVQNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA HLG FIGQ+  E I+ I I+YDGS A MN   LN AV+AG+++    
Sbjct: 323 EAAVMGPWIKLAAHLGAFIGQMTEEPIKAINILYDGSVAEMNLAALNCAVIAGVMKASNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAPII KE  I +ST +++K+G
Sbjct: 383 DVNLVSAPIIAKERGIQISTTRQEKTG 409


>gi|83952581|ref|ZP_00961312.1| D-3-phosphoglycerate dehydrogenase [Roseovarius nubinhibens ISM]
 gi|83836254|gb|EAP75552.1| D-3-phosphoglycerate dehydrogenase [Roseovarius nubinhibens ISM]
          Length = 531

 Score =  253 bits (646), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 122/208 (58%), Positives = 157/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL+ E L++TK GV IINCARGGLVDE ALAELL+SGHVA AGFDVF  
Sbjct: 203 LHVPLTDQTRNILSAERLAQTKKGVRIINCARGGLVDEAALAELLKSGHVAGAGFDVFSQ 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLF LPNV C P+LGA+T E+QE VA+Q+A Q+SDYL+ G VSNALNM  ++ E
Sbjct: 263 EPATENPLFDLPNVVCTPHLGAATTEAQENVALQVAEQISDYLLTGAVSNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA HLG FIGQ+  E I+ I I+YDG  + MN   L  + +AGI++    
Sbjct: 323 EAKVMGPWIKLAGHLGNFIGQMTDEPIKAINILYDGVVSQMNLEALTCSAVAGIMKSVNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP+I KE  + +ST  +DKSGV
Sbjct: 383 EVNMVSAPVIAKERGVKISTTHQDKSGV 410


>gi|254708700|ref|ZP_05170511.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261316192|ref|ZP_05955389.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
 gi|261295415|gb|EEX98911.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis B2/94]
          Length = 533

 Score =  252 bits (643), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 160/208 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI+N + L+K K GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 203 LHTPLTDKTRNIINAQTLAKMKPGVRIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGLIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE +II+S +KRDKSG+
Sbjct: 383 DVNMVSAPIMVKERSIIVSEVKRDKSGI 410


>gi|260467077|ref|ZP_05813257.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium opportunistum
           WSM2075]
 gi|259029186|gb|EEW30482.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium opportunistum
           WSM2075]
          Length = 533

 Score =  252 bits (643), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 158/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI++   ++K K+GV IINCARGGLV E  L   L+SG VA AG DVFEV
Sbjct: 203 LHTPLTDKTRNIIDAAAIAKMKNGVRIINCARGGLVVEADLIAALKSGKVAGAGIDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA QN LFGL NV   P+LGAST E+QE VA+Q+A QMSDYLI G VSNA+NM  I+ E
Sbjct: 263 EPAEQNALFGLENVVATPHLGASTAEAQENVALQVAEQMSDYLIKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F+GQ+  + I+E++I++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFVKLAEVLGAFVGQVTEDPIKEVEILFDGSTATMNTRALISAALAGLIRPQVS 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II++ +KRDKSGV
Sbjct: 383 DVNMVSAPIMVKERGIIVAEVKRDKSGV 410


>gi|254453066|ref|ZP_05066503.1| phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
 gi|198267472|gb|EDY91742.1| phosphoglycerate dehydrogenase [Octadecabacter antarcticus 238]
          Length = 516

 Score =  251 bits (642), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 158/207 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T++T NIL++EN++KTK GV IINCARGGLVDE ALA+ L+SGHVA A FDVF V
Sbjct: 188 LHVPFTDQTANILSRENIAKTKKGVRIINCARGGLVDEAALADALKSGHVAGAAFDVFAV 247

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PLF LPNV   P+LGA+T E+QE VA+Q+A QMSDYL+ G V+NALNM  ++ E
Sbjct: 248 EPATDSPLFNLPNVVVTPHLGAATTEAQENVALQVAEQMSDYLMTGAVTNALNMPSVTAE 307

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P+++L+ HLG FIGQ+  E IQ I I++DG+ + MN   L +AV+AGI++    
Sbjct: 308 EAKVMTPWISLSGHLGNFIGQMTDEPIQAINILFDGTVSDMNLEALTAAVVAGIMKKANP 367

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP+I KE  I +ST K+DK+G
Sbjct: 368 DTNMVSAPVIAKERGIKISTTKQDKTG 394


>gi|126724751|ref|ZP_01740594.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705915|gb|EBA05005.1| D-3-phosphoglycerate dehydrogenase [Rhodobacterales bacterium
           HTCC2150]
          Length = 530

 Score =  251 bits (642), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 120/207 (57%), Positives = 155/207 (74%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T++T NIL+ EN++KTK GV I+NCARGGLVDE ALAE L+SGHVA A FDVF V
Sbjct: 203 LHVPFTDQTANILSAENIAKTKKGVRIVNCARGGLVDEAALAEALKSGHVAGAAFDVFAV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PLF LPNV C P+LGA+T E+QE VA+Q+A Q+SDYL+ G V+NALNM  ++ E
Sbjct: 263 EPATDSPLFNLPNVVCTPHLGAATTEAQENVALQVAEQISDYLLTGAVTNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LADHLG FIGQ+  E I+ I I+YDGS + MN   LN + +AGI++    
Sbjct: 323 EAKVMGPWIKLADHLGAFIGQMTDEPIKAINILYDGSVSEMNLAALNCSAVAGIMKAANP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAPII K+  I +ST  + KSG
Sbjct: 383 DVNMVSAPIIAKDRGIKISTTNQAKSG 409


>gi|23502543|ref|NP_698670.1| D-3-phosphoglycerate dehydrogenase [Brucella suis 1330]
 gi|148559678|ref|YP_001259539.1| D-3-phosphoglycerate dehydrogenase [Brucella ovis ATCC 25840]
 gi|161619616|ref|YP_001593503.1| D-3-phosphoglycerate dehydrogenase [Brucella canis ATCC 23365]
 gi|254703466|ref|ZP_05165294.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|254708447|ref|ZP_05170275.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|254714547|ref|ZP_05176358.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|254717444|ref|ZP_05179255.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|254719689|ref|ZP_05181500.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|256030226|ref|ZP_05443840.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|256061723|ref|ZP_05451860.1| D-3-phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|256370095|ref|YP_003107606.1| D-3-phosphoglycerate dehydrogenase [Brucella microti CCM 4915]
 gi|260568773|ref|ZP_05839241.1| SerA family protein [Brucella suis bv. 4 str. 40]
 gi|261219276|ref|ZP_05933557.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|261315946|ref|ZP_05955143.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261322337|ref|ZP_05961534.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|261325728|ref|ZP_05964925.1| phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|261754095|ref|ZP_05997804.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|265984704|ref|ZP_06097439.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|265987255|ref|ZP_06099812.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|306837853|ref|ZP_07470715.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. NF 2653]
 gi|306841404|ref|ZP_07474106.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO2]
 gi|306844678|ref|ZP_07477263.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO1]
 gi|23348542|gb|AAN30585.1| D-3-phosphoglycerate dehydrogenase [Brucella suis 1330]
 gi|148370935|gb|ABQ60914.1| phosphoglycerate dehydrogenase [Brucella ovis ATCC 25840]
 gi|161336427|gb|ABX62732.1| D-3-phosphoglycerate dehydrogenase [Brucella canis ATCC 23365]
 gi|256000258|gb|ACU48657.1| D-3-phosphoglycerate dehydrogenase [Brucella microti CCM 4915]
 gi|260154157|gb|EEW89239.1| SerA family protein [Brucella suis bv. 4 str. 40]
 gi|260924365|gb|EEX90933.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M13/05/1]
 gi|261295027|gb|EEX98523.1| D-3-phosphoglycerate dehydrogenase [Brucella ceti M644/93/1]
 gi|261301708|gb|EEY05205.1| phosphoglycerate dehydrogenase [Brucella neotomae 5K33]
 gi|261304972|gb|EEY08469.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M163/99/10]
 gi|261743848|gb|EEY31774.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 3 str. 686]
 gi|264659452|gb|EEZ29713.1| D-3-phosphoglycerate dehydrogenase [Brucella pinnipedialis
           M292/94/1]
 gi|264663296|gb|EEZ33557.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. 83/13]
 gi|306274850|gb|EFM56620.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO1]
 gi|306288510|gb|EFM59862.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. BO2]
 gi|306407092|gb|EFM63309.1| D-3-phosphoglycerate dehydrogenase [Brucella sp. NF 2653]
          Length = 533

 Score =  251 bits (642), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 159/208 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI+N + L+K K GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 203 LHTPLTDKTRNIINAQTLAKMKPGVRIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGLIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 383 DVNMVSAPIMVKERGIIVSEVKRDKSGI 410


>gi|254700347|ref|ZP_05162175.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261750842|ref|ZP_05994551.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
 gi|261740595|gb|EEY28521.1| D-3-phosphoglycerate dehydrogenase [Brucella suis bv. 5 str. 513]
          Length = 533

 Score =  251 bits (642), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 159/208 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI+N + L+K K GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 203 LHTPLTDKTRNIINAQTLAKMKPGVRIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGLIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 383 DVNMVSAPIMVKERGIIVSEVKRDKSGI 410


>gi|294850937|ref|ZP_06791613.1| phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-0026]
 gi|294821580|gb|EFG38576.1| phosphoglycerate dehydrogenase [Brucella sp. NVSL 07-0026]
          Length = 533

 Score =  251 bits (641), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 124/208 (59%), Positives = 159/208 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI+N + L+K K GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 203 LHTPLTDKTRNIINAQTLAKMKPGVRIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLMKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGLIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 383 DVNMVSAPIMVKERGIIVSEVKRDKSGI 410


>gi|304394494|ref|ZP_07376415.1| phosphoglycerate dehydrogenase [Ahrensia sp. R2A130]
 gi|303293404|gb|EFL87783.1| phosphoglycerate dehydrogenase [Ahrensia sp. R2A130]
          Length = 533

 Score =  251 bits (640), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 152/208 (73%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+ I+  + L+K K GV I+NCARGGL+DE ALAE L+SG VA AG DVFE 
Sbjct: 206 LHTPLTDKTRGIIGADALAKMKDGVRIVNCARGGLIDEAALAEALKSGKVAGAGIDVFET 265

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +P+FGLPNV C P+LGA+T E+QE VA+Q+A QMS YL  G VSNALNM  I+ E
Sbjct: 266 EPATDSPIFGLPNVVCTPHLGAATTEAQENVALQVAEQMSAYLTRGAVSNALNMPSITAE 325

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP + PF+ LAD LG F+GQ+  + I+ ++I+YDG  A MNT  L+SAVLAG++R    
Sbjct: 326 EAPRLTPFVKLADMLGSFVGQVTDKPIKSVEILYDGHVATMNTKALSSAVLAGLLRAQVA 385

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP++  E  I L  + RDKSGV
Sbjct: 386 DVNMVSAPVMATERGIKLLEMTRDKSGV 413


>gi|110635490|ref|YP_675698.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium sp. BNC1]
 gi|110286474|gb|ABG64533.1| D-3-phosphoglycerate dehydrogenase [Chelativorans sp. BNC1]
          Length = 532

 Score =  251 bits (640), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 122/208 (58%), Positives = 155/208 (74%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KT+ I+N   ++K K GV I+NCARGGL+ E  L E L+SG VA AG DVFE 
Sbjct: 203 LHTPLTEKTRGIINAAAIAKMKDGVRIVNCARGGLIVEADLVEGLKSGKVAGAGIDVFEN 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLF LPNV C P+LGAST E+QE VA+Q+A QMS+YLI G V+NA+NM  I+ E
Sbjct: 263 EPATENPLFNLPNVVCTPHLGASTTEAQENVALQIAEQMSEYLIKGAVTNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F+GQ+  E I  ++I++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFIKLAEVLGAFVGQVTDEPIAGVEILFDGSTAAMNTRALISAALAGLIRPQVN 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSGV
Sbjct: 383 DVNMVSAPIMVKERGIIVSEVKRDKSGV 410


>gi|77464929|ref|YP_354433.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides 2.4.1]
 gi|221640849|ref|YP_002527111.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides KD131]
 gi|77389347|gb|ABA80532.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides 2.4.1]
 gi|221161630|gb|ACM02610.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides KD131]
          Length = 534

 Score =  249 bits (637), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 154/207 (74%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+NIL+ E ++KTK GV IINCARGGLVDE ALAE ++SGHVA A FDVFEV
Sbjct: 206 LHVPLTDKTRNILSAEAIAKTKKGVRIINCARGGLVDEKALAEAIKSGHVAGAAFDVFEV 265

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLF LPNV   P+LGAST E+QE VA+Q+A QMSDYL+ G V NALNM  ++ E
Sbjct: 266 EPASESPLFNLPNVVVTPHLGASTTEAQENVALQVAEQMSDYLLTGAVQNALNMPSVTAE 325

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA HLG F+GQ+  E I+ I ++YDG+   MN   LN A +AGI++    
Sbjct: 326 EAAVMGPWVKLAGHLGAFVGQMTDEPIKAINVLYDGAVGEMNLAALNCATIAGIMKATNP 385

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  I +ST  + KSG
Sbjct: 386 DVNLVSAPVVAKERGIQISTTTQAKSG 412


>gi|126460798|ref|YP_001041912.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102462|gb|ABN75140.1| D-3-phosphoglycerate dehydrogenase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 531

 Score =  249 bits (637), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 154/207 (74%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+NIL+ E ++KTK GV IINCARGGLVDE ALAE ++SGHVA A FDVFEV
Sbjct: 203 LHVPLTDKTRNILSAEAIAKTKKGVRIINCARGGLVDEKALAEAIKSGHVAGAAFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLF LPNV   P+LGAST E+QE VA+Q+A QMSDYL+ G V NALNM  ++ E
Sbjct: 263 EPASESPLFNLPNVVVTPHLGASTTEAQENVALQVAEQMSDYLLTGAVQNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA HLG F+GQ+  E I+ I ++YDG+   MN   LN A +AGI++    
Sbjct: 323 EAAVMGPWVKLAGHLGAFVGQMTDEPIKAINVLYDGAVGEMNLAALNCATIAGIMKATNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP++ KE  I +ST  + KSG
Sbjct: 383 DVNLVSAPVVAKERGIQISTTTQAKSG 409


>gi|13473319|ref|NP_104886.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium loti MAFF303099]
 gi|14024068|dbj|BAB50672.1| phosphoglycerate dehydrogenase [Mesorhizobium loti MAFF303099]
          Length = 533

 Score =  249 bits (636), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 122/208 (58%), Positives = 157/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI++   ++K K+GV IINCARGGL+ E  L   L+SG VA AG DVFEV
Sbjct: 203 LHTPLTDKTRNIIDAGAIAKMKNGVRIINCARGGLIVEADLIAALKSGKVAGAGIDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA QN LFG+ NV   P+LGAST E+QE VA+Q+A QMSDYLI G VSNA+NM  I+ E
Sbjct: 263 EPAEQNALFGMENVVATPHLGASTAEAQENVALQVAEQMSDYLIKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F+GQ+  + I E++I++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFVKLAEVLGAFVGQVTEDPIMEVEILFDGSTATMNTRALISATLAGLIRPQVS 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II++ +KRDKSGV
Sbjct: 383 DVNMVSAPIMVKERGIIVAEVKRDKSGV 410


>gi|89052752|ref|YP_508203.1| D-3-phosphoglycerate dehydrogenase [Jannaschia sp. CCS1]
 gi|88862301|gb|ABD53178.1| D-3-phosphoglycerate dehydrogenase [Jannaschia sp. CCS1]
          Length = 531

 Score =  249 bits (636), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 153/208 (73%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVP T KT NIL+ ENL+KTK GV I+NCARGGLVDE ALAELL+SGHVA A FDVF  
Sbjct: 203 MHVPFTEKTANILSAENLAKTKKGVRIVNCARGGLVDEAALAELLKSGHVAGAAFDVFAQ 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLF LPNV   P+LGA+T E+QE VA+Q+A QMSD+L+ G VSNALNM  ++ E
Sbjct: 263 EPATENPLFHLPNVVVTPHLGAATTEAQENVALQVAEQMSDFLLSGAVSNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA+HLG F+GQL  E IQ I ++Y+G    MN   L+ A +AG+++    
Sbjct: 323 EAAIMGPWVKLAEHLGAFVGQLTEEPIQSIDVVYNGVVTGMNLKALDCAAIAGVMKATNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP+I KE  I LS   +DK+GV
Sbjct: 383 DVNMVSAPVIAKERGIDLSQTTQDKTGV 410


>gi|17986632|ref|NP_539266.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
 gi|17982247|gb|AAL51530.1| d-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           16M]
          Length = 538

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 158/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PL +KT+NI+N + L+K K GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 208 LHTPLIDKTRNIINAQTLAKMKPGVRIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 267

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 268 EPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 327

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG++R    
Sbjct: 328 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGLIRSQVA 387

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 388 DVNMVSAPIMVKERGIIVSEVKRDKSGI 415


>gi|225853142|ref|YP_002733375.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis ATCC 23457]
 gi|256045296|ref|ZP_05448190.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256263367|ref|ZP_05465899.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|260565812|ref|ZP_05836295.1| aspartyl/glutamyl tRNA amidotransferase subunit C [Brucella
           melitensis bv. 1 str. 16M]
 gi|265991722|ref|ZP_06104279.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|225641507|gb|ACO01421.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis ATCC 23457]
 gi|260151185|gb|EEW86280.1| aspartyl/glutamyl tRNA amidotransferase subunit C [Brucella
           melitensis bv. 1 str. 16M]
 gi|263002678|gb|EEZ15081.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093365|gb|EEZ17434.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 2 str.
           63/9]
 gi|326409698|gb|ADZ66763.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis M28]
 gi|326539406|gb|ADZ87621.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis M5-90]
          Length = 533

 Score =  249 bits (635), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 158/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PL +KT+NI+N + L+K K GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 203 LHTPLIDKTRNIINAQTLAKMKPGVRIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGLIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 383 DVNMVSAPIMVKERGIIVSEVKRDKSGI 410


>gi|256114254|ref|ZP_05454999.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265995559|ref|ZP_06108116.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
 gi|262766843|gb|EEZ12461.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis bv. 3 str.
           Ether]
          Length = 533

 Score =  249 bits (635), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 158/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PL +KT+NI+N + L+K K GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 203 LHTPLIDKTRNIINAQTLAKMKPGVRIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGLIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 383 DVNMVSAPIMVKERGIIVSEVKRDKSGI 410


>gi|62290557|ref|YP_222350.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 1 str.
           9-941]
 gi|82700473|ref|YP_415047.1| D-3-phosphoglycerate dehydrogenase [Brucella melitensis biovar
           Abortus 2308]
 gi|189024778|ref|YP_001935546.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus S19]
 gi|254689854|ref|ZP_05153108.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|254694347|ref|ZP_05156175.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698003|ref|ZP_05159831.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730889|ref|ZP_05189467.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|256258108|ref|ZP_05463644.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|260547197|ref|ZP_05822935.1| SerA family protein [Brucella abortus NCTC 8038]
 gi|260755386|ref|ZP_05867734.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260758607|ref|ZP_05870955.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260762439|ref|ZP_05874776.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884402|ref|ZP_05896016.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|261214655|ref|ZP_05928936.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297248957|ref|ZP_06932665.1| phosphoglycerate dehydrogenase [Brucella abortus bv. 5 str. B3196]
 gi|62196689|gb|AAX74989.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 1
           str. 9-941]
 gi|82616574|emb|CAJ11653.1| ATP/GTP-binding site motif A (P-loop):Amino acid-binding
           ACT:D-isomer specific 2-hydroxyacid dehydrogenase,
           catalytic domain: [Brucella melitensis biovar Abortus
           2308]
 gi|189020350|gb|ACD73072.1| SerA-1, D-3-phosphoglycerate dehydrogenase [Brucella abortus S19]
 gi|260095562|gb|EEW79440.1| SerA family protein [Brucella abortus NCTC 8038]
 gi|260668925|gb|EEX55865.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 4 str.
           292]
 gi|260672865|gb|EEX59686.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675494|gb|EEX62315.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 6 str.
           870]
 gi|260873930|gb|EEX80999.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 9 str.
           C68]
 gi|260916262|gb|EEX83123.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus bv. 3 str.
           Tulya]
 gi|297174090|gb|EFH33447.1| phosphoglycerate dehydrogenase [Brucella abortus bv. 5 str. B3196]
          Length = 533

 Score =  249 bits (635), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 158/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PL +KT+NI+N + L+K K GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 203 LHTPLIDKTRNIINAQTLAKMKPGVRIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGLIRSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 383 DVNMVSAPIMVKERGIIVSEVKRDKSGI 410


>gi|237816063|ref|ZP_04595059.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus str. 2308 A]
 gi|237788726|gb|EEP62938.1| D-3-phosphoglycerate dehydrogenase [Brucella abortus str. 2308 A]
          Length = 538

 Score =  249 bits (635), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 158/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PL +KT+NI+N + L+K K GV I+NCARGGL+ E  L   L+SGHVA AG DV+E 
Sbjct: 208 LHTPLIDKTRNIINAQTLAKMKPGVRIVNCARGGLIVEKDLIAALKSGHVAGAGIDVYET 267

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 268 EPATENELFSLPNVVCTPHLGASTSEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAE 327

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F+GQ+  E IQE+++++DGSTA MNT  L SA LAG++R    
Sbjct: 328 EAPRLKPFVKLADVLGAFVGQVTDEPIQEVEVLFDGSTASMNTRALLSAALAGLIRSQVA 387

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II+S +KRDKSG+
Sbjct: 388 DVNMVSAPIMVKERGIIVSEVKRDKSGI 415


>gi|163733251|ref|ZP_02140695.1| D-3-phosphoglycerate dehydrogenase [Roseobacter litoralis Och 149]
 gi|161393786|gb|EDQ18111.1| D-3-phosphoglycerate dehydrogenase [Roseobacter litoralis Och 149]
          Length = 531

 Score =  248 bits (633), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 153/208 (73%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T++T NIL+ E ++K K GV IINCARGGLVDE ALA+ L+SGHVA A FDVF  
Sbjct: 203 LHVPFTDQTANILSAEAIAKMKPGVRIINCARGGLVDEEALADALKSGHVAGAAFDVFSQ 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA QNPLF LPNV C P+LGA+T E+QE VA+Q+A QMSDYL+ G VSNALNM  ++ E
Sbjct: 263 EPATQNPLFNLPNVVCTPHLGAATSEAQENVALQVAEQMSDYLLTGAVSNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ L+ HLG FIGQ+  E I+ I I+YDGS A MN   LN  V+AGI++    
Sbjct: 323 EAIVMGPWLKLSGHLGAFIGQMTDEPIKAINILYDGSVAEMNLSALNCGVVAGIMKKANP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP+I +E  I +ST  + KSGV
Sbjct: 383 DVNMVSAPVIAQERGISISTTNQSKSGV 410


>gi|319781038|ref|YP_004140514.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166926|gb|ADV10464.1| D-3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 533

 Score =  248 bits (632), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 120/208 (57%), Positives = 156/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI++   ++K K GV IINCARGGL+ E  L   L+SG VA AG DVFEV
Sbjct: 203 LHTPLTDKTRNIIDAAAIAKMKKGVRIINCARGGLIVEADLVAALKSGKVAGAGVDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N LFG+ NV   P+LGAST E+QE VA+Q+A QM+DYLI G VSNA+NM  I+ E
Sbjct: 263 EPAANNELFGMENVVATPHLGASTTEAQENVALQVAEQMADYLIKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F+GQ+  + I+E++I++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFVKLAEVLGAFVGQVTEDPIKEVEILFDGSTATMNTRALISAALAGLIRPQVS 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II++ +KRDKSGV
Sbjct: 383 DVNMVSAPIMVKERGIIVAEVKRDKSGV 410


>gi|310814538|ref|YP_003962502.1| D-3-phosphoglycerate dehydrogenase [Ketogulonicigenium vulgare Y25]
 gi|308753273|gb|ADO41202.1| D-3-phosphoglycerate dehydrogenase [Ketogulonicigenium vulgare Y25]
          Length = 531

 Score =  248 bits (632), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 158/207 (76%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+ T+NIL+ E ++KTK GV I+NCARGGLVDE ALAE ++SGHVA A FDVFEV
Sbjct: 203 LHVPLTDATRNILSAEAIAKTKPGVRIVNCARGGLVDEAALAEAIKSGHVAGAAFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLF LPNV   P+LGAST E+QE VA+Q+A Q++DYL+ G V+NALNM  ++ E
Sbjct: 263 EPATESPLFNLPNVVVTPHLGASTSEAQENVALQVAEQIADYLLTGAVTNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA HLG FIGQ+ +E I  I I++DG  + MN   LNSAV+AGI+R +  
Sbjct: 323 EAKIMGPWIKLAGHLGNFIGQMTNEPIVAINILFDGVASTMNLKALNSAVIAGIMRKFNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP+I K+  I +ST ++D +G
Sbjct: 383 DTNLVSAPVIAKDRGIKISTTQQDAAG 409


>gi|254462167|ref|ZP_05075583.1| phosphoglycerate dehydrogenase [Rhodobacterales bacterium HTCC2083]
 gi|206678756|gb|EDZ43243.1| phosphoglycerate dehydrogenase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 531

 Score =  247 bits (631), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 155/207 (74%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T+ T NIL++ENL+KTK+GV IINCARGGLVDE ALA++L+SGH+A A FDVF+ 
Sbjct: 203 LHVPFTDATANILSRENLAKTKNGVRIINCARGGLVDEGALADMLKSGHIAGAAFDVFKE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LF LPNV C P+LGA+T E+QE VA+Q+A QMS+YL  G V NALNM  ++ E
Sbjct: 263 EPATENALFDLPNVVCTPHLGAATTEAQENVALQVAQQMSNYLNTGAVENALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P+++LA HLG FIGQ+  E I+ I I+YDGS A MN   LN A +AGI++    
Sbjct: 323 EAKIMGPWVSLAGHLGAFIGQMTDEPIKAINILYDGSVAQMNLDALNCAAIAGIMKRVNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP+I  E  I +ST  ++KSG
Sbjct: 383 DVNMVSAPVIAAERGIKISTTNQEKSG 409


>gi|61612115|gb|AAX47292.1| 3-phosphoglycerate dehydrogenase [Mesorhizobium ciceri]
          Length = 533

 Score =  247 bits (630), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 120/208 (57%), Positives = 156/208 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI++   ++K K GV IINCARGGL+ E  L   L+SG VA AG DVFEV
Sbjct: 203 LHTPLTDKTRNIIDAAAIAKMKKGVRIINCARGGLIVEADLVAALKSGKVAGAGVDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N LFG+ NV   P+LGAST E+QE VA+Q+A QM+DYLI G VSNA+NM  I+ E
Sbjct: 263 EPAENNELFGMENVVATPHLGASTTEAQENVALQVAEQMADYLIKGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F+GQ+  + I+E++I++DGSTA MNT  L SA LAG++R    
Sbjct: 323 EAPRLKPFVKLAEVLGAFVGQVTEDPIKEVEILFDGSTATMNTRALISAALAGLIRPQVS 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  II++ +KRDKSGV
Sbjct: 383 DVNMVSAPIMVKERGIIVAEVKRDKSGV 410


>gi|84514603|ref|ZP_01001967.1| D-3-phosphoglycerate dehydrogenase [Loktanella vestfoldensis SKA53]
 gi|84511654|gb|EAQ08107.1| D-3-phosphoglycerate dehydrogenase [Loktanella vestfoldensis SKA53]
          Length = 530

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 115/207 (55%), Positives = 157/207 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT++T+NIL++EN++K K GV IINCARGGLVDE+ALA+ L+SGHVA A FDVF V
Sbjct: 203 MHVPLTDQTRNILSRENIAKLKQGVRIINCARGGLVDEDALADALKSGHVAGAAFDVFAV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PLF LPNV   P+LGA+T E+QE VA+Q+A QMSDYL+ G VSNALNM  ++ E
Sbjct: 263 EPATDSPLFNLPNVVVTPHLGAATTEAQENVALQVAEQMSDYLLTGAVSNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ L+ HLG FIGQ+  E I  I I++DG+ + MN   L ++ +AGI++    
Sbjct: 323 EAKIMGPWIKLSGHLGNFIGQMTDEPIMAINILFDGTASEMNLKALTASSVAGIMKATNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP+I KE  + +ST K+D+SG
Sbjct: 383 DVNMVSAPVIAKERGVKISTTKQDQSG 409


>gi|110677605|ref|YP_680612.1| D-3-phosphoglycerate dehydrogenase [Roseobacter denitrificans OCh
           114]
 gi|109453721|gb|ABG29926.1| D-3-phosphoglycerate dehydrogenase [Roseobacter denitrificans OCh
           114]
          Length = 531

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 152/208 (73%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T++T NIL+ E ++K + GV IINCARGGLVDE ALA  L+SGHVA A FDVF  
Sbjct: 203 LHVPFTDQTANILSAEAIAKMRPGVRIINCARGGLVDEEALAAALKSGHVAGAAFDVFSQ 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLF LPNV C P+LGA+T E+QE VA+Q+A QMSDYL+ G VSNALNM  ++ E
Sbjct: 263 EPATENPLFNLPNVVCTPHLGAATSEAQENVALQVAEQMSDYLLTGAVSNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ L+ HLG FIGQ+  E I+ I I+YDGS A MN   LN  V+AGI++    
Sbjct: 323 EAKVMGPWLKLSGHLGAFIGQMTDEPIKAINILYDGSVAEMNLSALNCGVIAGIMKKANP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP+I +E  I +ST  + KSGV
Sbjct: 383 DVNMVSAPVIAQERGITISTTNQSKSGV 410


>gi|119383566|ref|YP_914622.1| D-3-phosphoglycerate dehydrogenase [Paracoccus denitrificans
           PD1222]
 gi|119373333|gb|ABL68926.1| D-3-phosphoglycerate dehydrogenase [Paracoccus denitrificans
           PD1222]
          Length = 529

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 154/208 (74%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT+KT+NIL++ENL KT+ GV IIN ARGGL+DE ALA+LL+SGHVA A  DVF  
Sbjct: 202 MHVPLTDKTRNILSRENLEKTRKGVRIINAARGGLIDEEALADLLKSGHVAGAALDVFAT 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PLFGLPNV   P+LGAST E+QE VA+Q+A QMSDYL+ G V NALNM  ++ E
Sbjct: 262 EPATASPLFGLPNVVVTPHLGASTTEAQENVALQVAEQMSDYLLTGAVQNALNMPSVTAE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ LA HLG FIGQ+  E I+ I ++YDG  + MN   LN+AV+AG+++    
Sbjct: 322 EAAVMGPWLKLAGHLGAFIGQMTDEPIKAINVLYDGVASEMNLKALNAAVIAGVMQATNP 381

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP++  E  + ++T  + KSGV
Sbjct: 382 DVNMVSAPVMAAERGVQVATTTQAKSGV 409


>gi|188579907|ref|YP_001923352.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium populi BJ001]
 gi|179343405|gb|ACB78817.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium populi BJ001]
          Length = 535

 Score =  244 bits (624), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 150/204 (73%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+NIL++ENL+KTK GV I+NCARGGLVDE AL   L SGHVA A  DVF  
Sbjct: 209 LHVPLTDKTRNILSEENLAKTKRGVRIVNCARGGLVDEAALRAALDSGHVAGAALDVFVT 268

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFG PNV C P+LGAST E+QE VA+Q+A QM+DYL+ G ++NA+N   IS E
Sbjct: 269 EPATENPLFGHPNVICTPHLGASTAEAQENVALQVAEQMADYLLSGAITNAINFPSISAE 328

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ L + LG F+GQL    I+ I+I Y+G+ A MNT  L SA + G++R    
Sbjct: 329 EAPRLKPFVALCEKLGSFLGQLTEAPIKGIRITYEGAVAGMNTRALTSAAVTGVLRPILQ 388

Query: 181 GANIISAPIIIKENAIILSTIKRD 204
             N++SAP+I ++  I++  IKR+
Sbjct: 389 EVNMVSAPVIARDRGIVIDEIKRE 412


>gi|126733884|ref|ZP_01749631.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS2]
 gi|126716750|gb|EBA13614.1| D-3-phosphoglycerate dehydrogenase [Roseobacter sp. CCS2]
          Length = 530

 Score =  244 bits (622), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 153/207 (73%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT++TKNIL++EN++K K GV I+NCARGGLVDE ALAE L+SGHVA A FDVF V
Sbjct: 203 MHVPLTDQTKNILSEENIAKLKKGVRIVNCARGGLVDEAALAEALKSGHVAGAAFDVFAV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLF LPNV   P+LGA+T E+QE VA+Q+A QMSDYL+ G V NALNM  ++ E
Sbjct: 263 EPATESPLFNLPNVVVTPHLGAATTEAQENVALQVAEQMSDYLLTGAVQNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ L  HLG F GQ+  E I+ I I++DG  + MN   L +A +AGI+     
Sbjct: 323 EAKVMGPWIKLTGHLGNFTGQMTDEPIKAINILFDGEASEMNLKALTAATIAGIMTKANP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP+I KE  I +ST K+D+SG
Sbjct: 383 DTNMVSAPVIAKERGIKVSTTKQDQSG 409


>gi|254436982|ref|ZP_05050476.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 307]
 gi|198252428|gb|EDY76742.1| D-3-phosphoglycerate dehydrogenase [Octadecabacter antarcticus 307]
          Length = 531

 Score =  244 bits (622), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 157/207 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T++T NIL++EN++KTK GV IINCARGGLVDE ALA+ L+SG VA A FDVFEV
Sbjct: 203 LHVPFTDQTANILSRENIAKTKKGVRIINCARGGLVDEAALADALKSGQVAGAAFDVFEV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PLF LPNV   P+LGA+T E+QE VA+Q+A QMSDYL+ G V+NALNM  ++ E
Sbjct: 263 EPATDSPLFNLPNVVVTPHLGAATTEAQENVALQVAEQMSDYLMTGAVTNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P+++L+ HLG FIGQ+  E IQ I I++DGS + MN   L +A +AGI++    
Sbjct: 323 EAKVMTPWISLSGHLGNFIGQMTDEPIQAINILFDGSVSDMNLAALTAATIAGIMKKANP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP+I KE  I +ST K+DK+G
Sbjct: 383 DTNMVSAPVIAKERGIKISTTKQDKTG 409


>gi|298292958|ref|YP_003694897.1| D-3-phosphoglycerate dehydrogenase [Starkeya novella DSM 506]
 gi|296929469|gb|ADH90278.1| D-3-phosphoglycerate dehydrogenase [Starkeya novella DSM 506]
          Length = 528

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 148/207 (71%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+N+L+ E ++KTK GV I+NCARGGLVDE ALAE LQSG V  A FDVF  
Sbjct: 203 LHTPLTDKTRNVLSAEAIAKTKKGVRIVNCARGGLVDEAALAEALQSGQVGGAAFDVFVT 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G +SNA+N   I+ E
Sbjct: 263 EPATENPLFGLPNVICTPHLGASTTEAQENVALQVAEQMSDYLLRGAISNAVNFPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL    I+ ++I YDG+ A +    L SA +AG++R    
Sbjct: 323 EAPKLKPFIELAEKLGSFAGQLTDTDIKTVRITYDGAVASLKIKALTSAAVAGLLRPALQ 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP + KE  I++    R+ +G
Sbjct: 383 DVNVVSAPSVAKERGIVVEETTREVAG 409


>gi|325284843|ref|YP_004264305.1| D-3-phosphoglycerate dehydrogenase [Deinococcus proteolyticus MRP]
 gi|324316558|gb|ADY27670.1| D-3-phosphoglycerate dehydrogenase [Deinococcus proteolyticus MRP]
          Length = 534

 Score =  243 bits (619), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 156/207 (75%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+N+L++ENL +TK GV IIN ARGGL+DE ALAELL+SGHVA A  DVF  
Sbjct: 203 LHVPLTDKTRNLLSRENLLRTKPGVRIINAARGGLLDEEALAELLRSGHVAGAALDVFAQ 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA Q+PLFGLPNV   P+LGA+T E+QE VA+Q+A QMSDYL+ G V NALNM  ++ E
Sbjct: 263 EPATQSPLFGLPNVVVTPHLGAATTEAQENVALQVAEQMSDYLLSGAVHNALNMPAVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA  + P++ LA HLG F+GQ++ E +  + I Y G+ A MNT  LN+A+++G+++    
Sbjct: 323 EAARMGPWIHLARHLGAFVGQMVEEPMTSLNITYGGAAAGMNTGALNAALISGLMKPSNP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
            AN++SAP++ +E  I ++T  +D+SG
Sbjct: 383 DANMVSAPLMAREKGIQVATTIQDQSG 409


>gi|255264452|ref|ZP_05343794.1| phosphoglycerate dehydrogenase [Thalassiobium sp. R2A62]
 gi|255106787|gb|EET49461.1| phosphoglycerate dehydrogenase [Thalassiobium sp. R2A62]
          Length = 530

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 153/207 (73%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T +T NIL+ E ++K K GV I+NCARGGLVDE+ALAE L+SGHVA A FDVF V
Sbjct: 203 LHVPKTEQTANILSAERIAKLKKGVRIVNCARGGLVDEDALAEALKSGHVAGAAFDVFAV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLF LPNV   P+LGA+T E+QE VA+Q+A QMSDYL+ G V+NALNM  ++ E
Sbjct: 263 EPATESPLFNLPNVVVTPHLGAATTEAQENVALQVAEQMSDYLLTGAVTNALNMPSVTAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EA ++ P++ L+ HLG FIGQ+  E I  I I+YDG  + MN   LN +V+AGI++    
Sbjct: 323 EAKVMGPWVKLSGHLGNFIGQMTDEPITAINILYDGEVSEMNLEALNCSVVAGIMKKANP 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP+I KE  I +ST ++D+SG
Sbjct: 383 DVNMVSAPVIAKERGITISTTRQDQSG 409


>gi|218528706|ref|YP_002419522.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium
           chloromethanicum CM4]
 gi|218521009|gb|ACK81594.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium
           chloromethanicum CM4]
          Length = 535

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 152/204 (74%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+N+L++ENL+KTK GV I+NCARGGLVDE AL   L+SGHVA A  DVF  
Sbjct: 209 LHVPLTDKTRNLLSEENLAKTKRGVRIVNCARGGLVDEIALRAALESGHVAGAALDVFVT 268

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA++NPLFG PNV C P+LGA+T E+QE VA+Q+A QM+DYL+ G ++NA+N   IS E
Sbjct: 269 EPAIENPLFGHPNVICTPHLGAATSEAQENVALQIAEQMADYLLSGAITNAINFPSISAE 328

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ L + LG F+GQL    I+ I+I Y+G+ A MNT  L SA + G++R    
Sbjct: 329 EAPRLKPFVALCEKLGLFLGQLTEAPIKGIRITYEGAVAGMNTRALTSAAVTGVLRPILQ 388

Query: 181 GANIISAPIIIKENAIILSTIKRD 204
             N++SAP+I ++  I++  IKR+
Sbjct: 389 EVNMVSAPVIARDRGIVIDEIKRE 412


>gi|163850102|ref|YP_001638145.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium extorquens
           PA1]
 gi|163661707|gb|ABY29074.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium extorquens
           PA1]
          Length = 535

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 151/204 (74%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+N+L++ENL+KTK GV I+NCARGGLVDE AL   L SGHVA A  DVF  
Sbjct: 209 LHVPLTDKTRNLLSEENLAKTKRGVRIVNCARGGLVDEIALRAALDSGHVAGAALDVFVT 268

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA++NPLFG PNV C P+LGA+T E+QE VA+Q+A QM+DYL+ G ++NA+N   IS E
Sbjct: 269 EPAIENPLFGHPNVICTPHLGAATSEAQENVALQIAEQMADYLLSGAITNAINFPSISAE 328

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ L + LG F+GQL    I+ I+I Y+G+ A MNT  L SA + G++R    
Sbjct: 329 EAPRLKPFVALCEKLGSFLGQLTEAPIKGIRITYEGAVAGMNTRALTSAAVTGVLRPILQ 388

Query: 181 GANIISAPIIIKENAIILSTIKRD 204
             N++SAP+I ++  I++  IKR+
Sbjct: 389 EVNMVSAPVIARDRGIVIDEIKRE 412


>gi|254559246|ref|YP_003066341.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens DM4]
 gi|254266524|emb|CAX22288.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens DM4]
          Length = 535

 Score =  242 bits (617), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 151/204 (74%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+N+L++ENL+KTK GV I+NCARGGLVDE AL   L SGHVA A  DVF  
Sbjct: 209 LHVPLTDKTRNLLSEENLAKTKRGVRIVNCARGGLVDEIALRAALDSGHVAGAALDVFVT 268

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA++NPLFG PNV C P+LGA+T E+QE VA+Q+A QM+DYL+ G ++NA+N   IS E
Sbjct: 269 EPAIENPLFGHPNVICTPHLGAATSEAQENVALQIAEQMADYLLSGAITNAINFPSISAE 328

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ L + LG F+GQL    I+ I+I Y+G+ A MNT  L SA + G++R    
Sbjct: 329 EAPRLKPFVALCEKLGLFLGQLTEAPIKGIRITYEGAVAGMNTRALTSAAVTGVLRPILQ 388

Query: 181 GANIISAPIIIKENAIILSTIKRD 204
             N++SAP+I ++  I++  IKR+
Sbjct: 389 EVNMVSAPVIARDRGIVIDEIKRE 412


>gi|240137235|ref|YP_002961704.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens AM1]
 gi|240007201|gb|ACS38427.1| phosphoglycerate dehydrogenase [Methylobacterium extorquens AM1]
          Length = 535

 Score =  241 bits (614), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 150/204 (73%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+N+L++ENL+KTK GV I+NCARGGLVDE AL   L SGHVA A  DVF  
Sbjct: 209 LHVPLTDKTRNLLSEENLAKTKRGVRIVNCARGGLVDEIALRAALDSGHVAGAALDVFVT 268

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA++NPLFG PNV C P+LGA+T E+QE VA+Q+A QM+DYL+ G ++NA+N   IS E
Sbjct: 269 EPAIENPLFGHPNVICTPHLGAATSEAQENVALQIAEQMADYLLSGAITNAINFPSISAE 328

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ L + LG F+GQL    I+ I+I Y+G+ A MNT  L SA + G +R    
Sbjct: 329 EAPRLKPFVALCEKLGSFLGQLTEAPIKGIRITYEGTVAGMNTRALTSAAVTGALRPILQ 388

Query: 181 GANIISAPIIIKENAIILSTIKRD 204
             N++SAP+I ++  I++  IKR+
Sbjct: 389 EVNMVSAPVIARDRGIVIDEIKRE 412


>gi|39937368|ref|NP_949644.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           CGA009]
 gi|192293149|ref|YP_001993754.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           TIE-1]
 gi|39651226|emb|CAE29749.1| putative phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           CGA009]
 gi|192286898|gb|ACF03279.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           TIE-1]
          Length = 529

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 146/203 (71%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KTKNI++   ++K K GV IINCARGGLVDENALAE L+SGHVA A FDVF  
Sbjct: 204 LHTPLTDKTKNIIDAAAIAKMKKGVRIINCARGGLVDENALAEALKSGHVAGAAFDVFSE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G ++NA+N   I+ E
Sbjct: 264 EPATKNVLFGLPNVICTPHLGASTTEAQENVALQVAEQMSDYLLTGAITNAINFPSITAE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL    I ++ I Y+G  A M    L SAVL+G++R    
Sbjct: 324 EAPKLKPFIELAEKLGSFAGQLTETGITKVTITYEGEVAEMKIKALTSAVLSGLLRPMLG 383

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP+I KE  +++  + R
Sbjct: 384 DINVVSAPVIAKERGMVVDEVVR 406


>gi|182678253|ref|YP_001832399.1| D-3-phosphoglycerate dehydrogenase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634136|gb|ACB94910.1| D-3-phosphoglycerate dehydrogenase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 529

 Score =  238 bits (608), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 145/203 (71%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT +TKNIL+ ENL+KTK GV +INCARGGLVDE AL +LL SGHVA A FDVF  
Sbjct: 203 LHTPLTPQTKNILSAENLAKTKKGVRVINCARGGLVDEEALRKLLDSGHVAGAAFDVFIT 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFG PNV C P+LGAST E+QE VA+Q+A QMSDYL  G +SNA+N   I+ E
Sbjct: 263 EPAKENPLFGHPNVVCTPHLGASTSEAQENVALQVAEQMSDYLTRGAISNAVNFPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQ+I  +I+++ I Y+G    +    L ++ +AGI+R    
Sbjct: 323 EAPKLKPFIALAEKLGSFAGQVIDSAIKKVTITYEGEVGQLKIKALTASAIAGILRPLLA 382

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP + KE  I++  + R
Sbjct: 383 DVNVVSAPAVAKERGIVIDEVSR 405


>gi|217977921|ref|YP_002362068.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
 gi|217503297|gb|ACK50706.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
          Length = 531

 Score =  238 bits (606), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 148/207 (71%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT +TK+IL+ E+L+KTK GV IINCARGGLVDE AL  LL SGHV  A FDVF  
Sbjct: 203 LHTPLTPQTKHILSAESLAKTKKGVRIINCARGGLVDEAALRALLDSGHVGGAAFDVFVK 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFG PNV C P+LGAST E+QE VA+Q+A QMSDYL  G +SNA+N   IS E
Sbjct: 263 EPATENPLFGHPNVVCTPHLGASTNEAQENVALQIAEQMSDYLTRGAISNAVNFPSISAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP ++PF+ LADHLG F GQ +   ++++ IIY+G+ A + T  L ++V+AG++R    
Sbjct: 323 EAPKLRPFIALADHLGSFGGQTVDSGVKKVTIIYEGAVAQLKTKALTASVVAGLLRPLLA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             +++SAP + KE  +++  + R   G
Sbjct: 383 DVSVVSAPAVAKERGVVVDEVIRASDG 409


>gi|154245150|ref|YP_001416108.1| D-3-phosphoglycerate dehydrogenase [Xanthobacter autotrophicus Py2]
 gi|154159235|gb|ABS66451.1| D-3-phosphoglycerate dehydrogenase [Xanthobacter autotrophicus Py2]
          Length = 528

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/207 (54%), Positives = 144/207 (69%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTKNIL+ EN+++TK GV IINCARGGLVDE AL   L S HVA A FDVF V
Sbjct: 203 LHTPLTEKTKNILSAENIARTKKGVRIINCARGGLVDEAALRAALDSKHVAGAAFDVFAV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA QNPLFG PNV C P+LGA+T E+QE VA+Q+A QMSDYL+ G ++NA+N   I+ E
Sbjct: 263 EPAEQNPLFGHPNVVCTPHLGAATNEAQENVALQVAEQMSDYLLTGAITNAVNFTSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL    I+ + I+Y+G+ A      L SA +AG++R    
Sbjct: 323 EAPKLKPFIALAEKLGSFAGQLTDTDIKTVHIVYEGAVADQKVKALTSAAVAGLLRPMLS 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP + KE  I++    R  +G
Sbjct: 383 EVNVVSAPTVAKERGIVIEETTRAATG 409


>gi|114704945|ref|ZP_01437853.1| phosphoglycerate dehydrogenase [Fulvimarina pelagi HTCC2506]
 gi|114539730|gb|EAU42850.1| phosphoglycerate dehydrogenase [Fulvimarina pelagi HTCC2506]
          Length = 532

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 110/208 (52%), Positives = 152/208 (73%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH P+T+KT+ ++N ++L+K + GV I+NCARGGL+ E  LA+ ++SG VA AG DVFE 
Sbjct: 203 LHTPMTDKTRGMINAQSLAKMRDGVRIVNCARGGLIVEADLADAIKSGKVAGAGIDVFET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PLFGL NV C P+LGAST E+QE VA+Q+A QMSDYL  G V+NA+NM  I+ E
Sbjct: 263 EPAKDSPLFGLDNVVCTPHLGASTTEAQENVALQVAEQMSDYLTRGAVTNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++ PF+ LA+ LG F+GQ+  E I+ ++I+YDG  A MNT  L SA L+G+++    
Sbjct: 323 EAPILTPFVRLAECLGAFVGQVTEEPIRSVEIVYDGLVAEMNTKALTSATLSGLMKSQVA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI+ +E  I ++   RDKSGV
Sbjct: 383 EVNMVSAPIMARERGIQITESTRDKSGV 410


>gi|316935825|ref|YP_004110807.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           DX-1]
 gi|315603539|gb|ADU46074.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           DX-1]
          Length = 529

 Score =  235 bits (600), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/203 (55%), Positives = 145/203 (71%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KTKNI++   ++K K GV IINCARGGLVDENALAE L+SG VA A FDVF  
Sbjct: 204 LHTPLTDKTKNIIDAAAIAKMKKGVRIINCARGGLVDENALAEALKSGQVAGAAFDVFSE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G ++NA+N   I+ E
Sbjct: 264 EPATKNVLFGLPNVICTPHLGASTTEAQENVALQVAEQMSDYLLTGAITNAINFPSITAE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL    I ++ I Y+G  A M    L SAVL+G++R    
Sbjct: 324 EAPKLKPFIELAEKLGSFAGQLTETGITKVTITYEGQVAEMKIKALTSAVLSGLLRPMLG 383

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP+I KE  +++  + R
Sbjct: 384 DINVVSAPVIAKERGMVVDEVVR 406


>gi|90418985|ref|ZP_01226896.1| D-3-phosphoglycerate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337065|gb|EAS50770.1| D-3-phosphoglycerate dehydrogenase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 535

 Score =  235 bits (599), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 151/208 (72%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH P+T+KTK I+N   ++K K GV IINCARGGLV E  LAE ++SG VA AG DVFE 
Sbjct: 203 LHTPMTDKTKGIINAAAIAKMKDGVRIINCARGGLVVEADLAEGIKSGKVAGAGVDVFET 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  + LFGL NV C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ E
Sbjct: 263 EPATDSVLFGLENVVCTPHLGASTSEAQENVAVQVAEQMSDYLVRGAVSNAINMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++ PF+ LA+ LG F GQ+  E I  ++I+YDG+ A MNT  L SA L+G+++    
Sbjct: 323 EAPILTPFVKLAEILGGFAGQVTEEPITSVEILYDGTVAGMNTNALTSAALSGLIKSQVS 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAPI++KE  I ++  +RD+SGV
Sbjct: 383 DVNMVSAPIMVKERGIHVTESRRDQSGV 410


>gi|294010170|ref|YP_003543630.1| D-3-phosphoglycerate dehydrogenase [Sphingobium japonicum UT26S]
 gi|292673500|dbj|BAI95018.1| D-3-phosphoglycerate dehydrogenase [Sphingobium japonicum UT26S]
          Length = 526

 Score =  234 bits (597), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 109/207 (52%), Positives = 150/207 (72%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+NIL+KENL+KTK GV IINCARGGL+DE AL E L SGHVA A  DVF  
Sbjct: 200 LHTPLTDQTRNILSKENLAKTKKGVRIINCARGGLIDEAALKEALDSGHVAGAALDVFVQ 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFG PN  C P+LGAST E+Q  VA+Q+A Q+SDYL+DG ++NALN+  +S E
Sbjct: 260 EPAKESPLFGTPNFICTPHLGASTDEAQVNVALQVAEQLSDYLLDGGITNALNVPSLSAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KP+M LA+ LG  +GQL  + IQ + +  +G  A +N   + +AVLAG++RV+  
Sbjct: 320 EAPKLKPYMALAEELGSLVGQLEGDRIQSVSVEVEGHAAELNQKPITAAVLAGLMRVYSD 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP + KE  + +  ++ D+ G
Sbjct: 380 TVNMVNAPFLAKERGLDVREVRHDREG 406


>gi|86748440|ref|YP_484936.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
 gi|86571468|gb|ABD06025.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           HaA2]
          Length = 529

 Score =  234 bits (597), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 113/203 (55%), Positives = 144/203 (70%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KTKNI++   ++K K GV IINCARGGLVDE ALAE L+SG VA A FDVF  
Sbjct: 204 LHTPLTDKTKNIIDAAAIAKMKKGVRIINCARGGLVDEQALAEALKSGQVAGAAFDVFSE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N LFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL++G ++NA+N   I+ E
Sbjct: 264 EPATSNVLFGLPNVICTPHLGASTTEAQENVALQVAEQMSDYLLNGAITNAVNFPSITAE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL    I ++ I Y+G  A M    L SAVL+G++R    
Sbjct: 324 EAPKLKPFIELAEKLGSFAGQLTETGITKVTITYEGEVAEMKIKALTSAVLSGLLRPMLG 383

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP+I KE  +++  I R
Sbjct: 384 DINVVSAPVIAKERGMVVDEIVR 406


>gi|148253350|ref|YP_001237935.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. BTAi1]
 gi|146405523|gb|ABQ34029.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. BTAi1]
          Length = 529

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 113/203 (55%), Positives = 142/203 (69%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI++   ++K K GV IINCARGGL+DE AL   L S HVA A  DVF  
Sbjct: 204 LHTPLTDKTRNIIDAAAIAKMKQGVRIINCARGGLIDEQALLAALNSKHVAGAALDVFAE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPLFG P+V C P+LGAST E+QE VA+Q+A QMSDYL+ G +SNA+N   I+ E
Sbjct: 264 EPATSNPLFGHPSVICTPHLGASTTEAQENVALQIAEQMSDYLLTGAISNAINFPSITAE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL   SI +IQI Y+G  A M T  L SAVLAG++R    
Sbjct: 324 EAPKLKPFIALAEKLGSFAGQLTESSITKIQITYEGQVAEMKTKALTSAVLAGLLRPMLG 383

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP+I KE  +I+  + R
Sbjct: 384 EVNVVSAPVIAKERGMIVDEVLR 406


>gi|146342773|ref|YP_001207821.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. ORS278]
 gi|146195579|emb|CAL79606.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium sp. ORS278]
          Length = 529

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 142/203 (69%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI++ + ++K K GV IINCARGGL+DE AL E L S  VA A  DVF  
Sbjct: 204 LHTPLTDKTRNIIDAQAIAKMKQGVRIINCARGGLIDEAALLEALNSKQVAGAALDVFAE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPLFG P V C P+LGAST E+QE VA+Q+A QMSDYL+ G +SNA+N   I+ E
Sbjct: 264 EPATSNPLFGHPGVICTPHLGASTTEAQENVALQIAEQMSDYLLTGAISNAINFPSITAE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL   SI ++QI Y+G  A M T  L SAVLAG++R    
Sbjct: 324 EAPKLKPFIALAEKLGSFAGQLTESSITKVQITYEGQVAEMKTKALTSAVLAGLLRPMLG 383

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP+I KE  +I+  + R
Sbjct: 384 EVNVVSAPVIAKERGMIVDEVLR 406


>gi|326389093|ref|ZP_08210675.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206693|gb|EGD57528.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 528

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 105/207 (50%), Positives = 153/207 (73%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+NIL++ENL+KTK GV I+NCARGGL+DE AL +LL SGHVA A  DVFE 
Sbjct: 202 LHTPLTSETRNILSRENLAKTKKGVRIVNCARGGLIDEAALKDLLDSGHVAGAALDVFET 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFG PN  C P+LGAST E+Q  VA+Q+A QM+++L  G V+NALNM  +S E
Sbjct: 262 EPAKESPLFGTPNFICTPHLGASTTEAQVNVALQVAEQMAEFLTTGGVTNALNMPSLSAE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KP+M LA+ LG  +GQL+ +S+++I I  +G+ A +N   + +AVLAG+++ +  
Sbjct: 322 EAPKLKPYMALAEKLGALVGQLVGDSVKKIAIEVEGAAAQLNQKPITAAVLAGLMKQYSQ 381

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP + KE  + +  ++ ++ G
Sbjct: 382 TVNMVNAPFLAKERGLDVREVRHEREG 408


>gi|158422609|ref|YP_001523901.1| D-3-phosphoglycerate dehydrogenase [Azorhizobium caulinodans ORS
           571]
 gi|158329498|dbj|BAF86983.1| D-3-phosphoglycerate dehydrogenase [Azorhizobium caulinodans ORS
           571]
          Length = 528

 Score =  232 bits (591), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 142/207 (68%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTKN+L+ EN+++ K GV IINCARGGLVDE AL   L SGHVA A FDVF V
Sbjct: 203 LHTPLTEKTKNVLSAENIARAKPGVRIINCARGGLVDEVALRAALDSGHVAGAAFDVFSV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N LFG PNV C P+LGA+T E+QE VA+Q+A QMSDYL+ G +SNA+N   I+ E
Sbjct: 263 EPAETNVLFGHPNVVCTPHLGAATTEAQENVALQVAEQMSDYLLAGAISNAVNFPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL    I+ ++I Y+G+ A      L SA +AG++R    
Sbjct: 323 EAPRLKPFIALAEKLGSFAGQLTDTDIKTVRITYEGAVAEQKVKALTSAAIAGLLRPVLA 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP + KE  I++    RD  G
Sbjct: 383 DVNVVSAPSVAKERGIVIEETTRDAVG 409


>gi|307294836|ref|ZP_07574678.1| D-3-phosphoglycerate dehydrogenase [Sphingobium chlorophenolicum
           L-1]
 gi|306879310|gb|EFN10528.1| D-3-phosphoglycerate dehydrogenase [Sphingobium chlorophenolicum
           L-1]
          Length = 526

 Score =  231 bits (590), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 107/207 (51%), Positives = 150/207 (72%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+NIL+KENL+KTK GV IINCARGGL+DE AL E + +GHVA A  DVF  
Sbjct: 200 LHTPLTDQTRNILSKENLAKTKKGVRIINCARGGLIDEAALKEAMDAGHVAGAALDVFVQ 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFG PN  C P+LGAST E+Q  VA+Q+A Q+SDYL+DG ++NALN+  +S E
Sbjct: 260 EPAKESPLFGTPNFICTPHLGASTDEAQVNVALQVAEQLSDYLLDGGITNALNVPSLSAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KP+M LA+ LG  +GQL  + IQ + +  +G  A +N   + +AVLAG++RV+  
Sbjct: 320 EAPKLKPYMALAEELGSLVGQLEGDRIQSVAVEVEGHAAELNQKPITAAVLAGLMRVYSD 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP + KE  + +  ++ D+ G
Sbjct: 380 TVNMVNAPFLAKERGLDVREVRHDREG 406


>gi|154252585|ref|YP_001413409.1| D-3-phosphoglycerate dehydrogenase [Parvibaculum lavamentivorans
           DS-1]
 gi|154156535|gb|ABS63752.1| D-3-phosphoglycerate dehydrogenase [Parvibaculum lavamentivorans
           DS-1]
          Length = 525

 Score =  231 bits (589), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 111/207 (53%), Positives = 146/207 (70%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NILN ENL+K K GV I+NCARGGL+ E+ L   ++SGHVA A  DVFE 
Sbjct: 200 LHTPLTDKTRNILNAENLAKCKKGVRIVNCARGGLIVESDLKAAIESGHVAGAALDVFEE 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPLFG+  V C P+LGAST E+QE VA+Q+A QM+DYL+ G V+N++N+  +S E
Sbjct: 260 EPAKSNPLFGMDQVICTPHLGASTNEAQENVALQVAEQMADYLLTGAVTNSINVPAVSAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP + PF+TLA  LG F GQL    I E+ I Y G  A MNT VL +A L G+++    
Sbjct: 320 EAPKLTPFLTLAQQLGSFAGQLTESGISEVTIEYAGDVAEMNTRVLTNAALTGLLKPQLE 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP+I K+  I +S +KR++ G
Sbjct: 380 DVNMVSAPVIAKDRNIKVSEVKREQQG 406


>gi|56552581|ref|YP_163420.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56544155|gb|AAV90309.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 527

 Score =  231 bits (589), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 151/207 (72%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL++ENL+KTK GV IINCARGGL+DE AL + L+SGHVA A  DVF  
Sbjct: 200 LHVPLTDQTRNILSRENLAKTKKGVRIINCARGGLIDEEALKDALESGHVAGAALDVFLK 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFG+PN    P+LGAST E+Q  VAIQ+A QM+DYL+ G VSNALNM  +S E
Sbjct: 260 EPAKENPLFGVPNFIATPHLGASTTEAQVNVAIQVAEQMADYLLTGGVSNALNMPSLSAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP V+P+M L++ LG  +GQL  + I+ + I  +G+ A ++   + SAVL+G++ V+  
Sbjct: 320 EAPRVRPYMALSEQLGRLLGQLEGDKIKSVSIEVEGAAAHLDQKPITSAVLSGLMGVYSQ 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP + +E  + +  I+ D+ G
Sbjct: 380 SVNMVNAPFLARERGLDVREIRHDREG 406


>gi|241762175|ref|ZP_04760258.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373425|gb|EER63025.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 527

 Score =  231 bits (589), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 151/207 (72%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL++ENL+KTK GV IINCARGGL+DE AL + L+SGHVA A  DVF  
Sbjct: 200 LHVPLTDQTRNILSRENLAKTKKGVRIINCARGGLIDEEALKDALESGHVAGAALDVFLK 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFG+PN    P+LGAST E+Q  VAIQ+A QM+DYL+ G VSNALNM  +S E
Sbjct: 260 EPAKENPLFGVPNFIATPHLGASTTEAQVNVAIQVAEQMADYLLTGGVSNALNMPSLSAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP V+P+M L++ LG  +GQL  + I+ + I  +G+ A ++   + SAVL+G++ V+  
Sbjct: 320 EAPRVRPYMALSEQLGRLLGQLEGDKIKSVSIEVEGAAAHLDQKPITSAVLSGLMGVYSQ 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP + +E  + +  I+ D+ G
Sbjct: 380 SVNMVNAPFLARERGLDVREIRHDREG 406


>gi|209886269|ref|YP_002290126.1| phosphoglycerate dehydrogenase [Oligotropha carboxidovorans OM5]
 gi|209874465|gb|ACI94261.1| phosphoglycerate dehydrogenase [Oligotropha carboxidovorans OM5]
          Length = 529

 Score =  231 bits (589), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 111/203 (54%), Positives = 144/203 (70%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NIL+   ++KTK GV IINCARGGLVDE AL   L SGHVA A FDVF  
Sbjct: 204 LHTPLTDKTRNILDATAINKTKKGVRIINCARGGLVDEAALRAALDSGHVAGAAFDVFVE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG PNV C P+LGAST E+QE VA+Q+A QMSDYL+ G +SNA+N   I+ E
Sbjct: 264 EPAKENVLFGHPNVICTPHLGASTTEAQENVALQVAEQMSDYLLTGAISNAINFPSITAE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL   +I ++QI Y+G+ A M    L +A L+G++R    
Sbjct: 324 EAPKLKPFIELAEKLGSFAGQLTESNIAKVQITYEGAVAEMKVKALTAAALSGLLRPMLG 383

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP++ KE  +I+  + R
Sbjct: 384 DVNVVSAPVVAKERGMIVDEVLR 406


>gi|114769879|ref|ZP_01447489.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium HTCC2255]
 gi|114549584|gb|EAU52466.1| D-3-phosphoglycerate dehydrogenase [alpha proteobacterium HTCC2255]
          Length = 529

 Score =  231 bits (588), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 114/208 (54%), Positives = 146/208 (70%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T+ T  ++++  + K K GV IINCARGGLVDE ALA+ L SGHVA A FDVF V
Sbjct: 202 LHVPKTDATAGMISEGAIKKMKPGVRIINCARGGLVDETALAKALNSGHVAGAAFDVFSV 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PLF LPNV   P+LGA+T E+QE VA+Q+A Q+SDYL +G VSNA+NM  I+ E
Sbjct: 262 EPATDSPLFNLPNVVVTPHLGAATTEAQENVALQVAEQLSDYLNNGAVSNAINMPSITAE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++ PF+ L+ HLG F GQL +E I EI I YDG  A MNT  L SA +AG+++    
Sbjct: 322 EAPILGPFVKLSQHLGAFAGQLTNEPITEINITYDGKVADMNTKALASAAIAGVMQAQNP 381

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP+I  +  I +S   + KSGV
Sbjct: 382 DVNMVSAPVIAADRGIKVSNTTQIKSGV 409


>gi|260753763|ref|YP_003226656.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258553126|gb|ACV76072.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 527

 Score =  231 bits (588), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 151/207 (72%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+NIL++ENL+KTK GV IINCARGGL+DE AL + L+SGHVA A  DVF  
Sbjct: 200 LHVPLTDQTRNILSRENLAKTKKGVRIINCARGGLIDEEALKDALESGHVAGAALDVFLK 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFG+PN    P+LGAST E+Q  VAIQ+A QM+DYL+ G VSNALNM  +S E
Sbjct: 260 EPAKENPLFGVPNFIATPHLGASTTEAQVNVAIQVAEQMADYLLTGGVSNALNMPSLSAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP V+P+M L++ LG  +GQL  + I+ + I  +G+ A ++   + SAVL+G++ V+  
Sbjct: 320 EAPRVRPYMALSEQLGRLLGQLEGDKIKAVSIEVEGAAAHLDQKPITSAVLSGLMGVYSQ 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP + +E  + +  I+ D+ G
Sbjct: 380 SVNMVNAPFLARERGLDVREIRHDREG 406


>gi|85373221|ref|YP_457283.1| D-3-phosphoglycerate dehydrogenase [Erythrobacter litoralis
           HTCC2594]
 gi|84786304|gb|ABC62486.1| phosphoglycerate dehydrogenase [Erythrobacter litoralis HTCC2594]
          Length = 527

 Score =  230 bits (587), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 109/207 (52%), Positives = 151/207 (72%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+NIL++ENL+KTK GV IINCARGGL+DE ALAE L SG VA A  DVF+ 
Sbjct: 202 LHTPLTDETRNILSQENLAKTKQGVRIINCARGGLIDEAALAEALDSGQVAGAALDVFQT 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PLFG PN  C P+LGAST E+Q  VA+Q+A QM+DYL+DG V+NALNM  +S E
Sbjct: 262 EPAKDSPLFGKPNFICTPHLGASTTEAQVNVALQVAEQMADYLVDGGVTNALNMPSLSAE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KP+M LA++LG  +GQL   ++ +I I  +G+ A ++   +  AVLAG++R +  
Sbjct: 322 EAPKLKPYMGLAENLGSLVGQLAHGNLTKISIEREGAAADLSGKPIEGAVLAGLMRQYSD 381

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP + KE  + + +I+ +K G
Sbjct: 382 TVNMVNAPFLAKERGLDIRSIRHEKEG 408


>gi|91978368|ref|YP_571027.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
 gi|91684824|gb|ABE41126.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB5]
          Length = 529

 Score =  229 bits (585), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 111/203 (54%), Positives = 142/203 (69%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KTKNI++   ++K K GV IINCARGGLVDE ALAE L+S  VA A FDVF  
Sbjct: 204 LHTPLTDKTKNIIDAAAIAKMKKGVRIINCARGGLVDEQALAEALKSKQVAGAAFDVFSE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N LFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G ++NA+N   I+ E
Sbjct: 264 EPATTNVLFGLPNVICTPHLGASTTEAQENVALQVAEQMSDYLLSGAITNAVNFPSITAE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL    I ++ I Y+G  A M    L SAVL+G++R    
Sbjct: 324 EAPKLKPFIELAEKLGSFAGQLTDSGITKVTITYEGHVAEMKIKALTSAVLSGLLRPMLG 383

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP+I KE  +++  + R
Sbjct: 384 DINVVSAPVIAKERGMVVDEVVR 406


>gi|148557578|ref|YP_001265160.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas wittichii RW1]
 gi|148502768|gb|ABQ71022.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas wittichii RW1]
          Length = 525

 Score =  229 bits (585), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 109/207 (52%), Positives = 147/207 (71%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+ TKNIL+KENL+KTK GV I+NCARGGL+DE AL E L SGHVA A  DVF  
Sbjct: 200 LHTPLTDSTKNILSKENLAKTKKGVRIVNCARGGLIDEAALKEALDSGHVAGAALDVFVT 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFG P     P+LGAST E+Q  VAIQ+A QM+D+L+ G V+NALNM  +S E
Sbjct: 260 EPATESPLFGTPGFISTPHLGASTNEAQVNVAIQVAEQMADFLLSGGVTNALNMPSLSAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KP+M LA+HLG  +GQL  ++I+ + I  +G+ A +N   +  AVLAG++ V+  
Sbjct: 320 EAPKLKPYMALAEHLGALVGQLEGDAIKAVAIEVEGAAAELNQKPITGAVLAGLMGVYSD 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP + KE  + L  ++ D+ G
Sbjct: 380 TVNMVNAPFLAKERGLDLREVRHDREG 406


>gi|299134302|ref|ZP_07027495.1| D-3-phosphoglycerate dehydrogenase [Afipia sp. 1NLS2]
 gi|298591049|gb|EFI51251.1| D-3-phosphoglycerate dehydrogenase [Afipia sp. 1NLS2]
          Length = 529

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 143/203 (70%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NIL+   ++KTK GV IINCARGGLVDE AL   L SGHVA A FDVF  
Sbjct: 204 LHTPLTDKTRNILDATAINKTKKGVRIINCARGGLVDETALRAALDSGHVAGAAFDVFVE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N LFG PNV C P+LGAST E+QE VA+Q+A QMSDYL+ G +SNA+N   I+ E
Sbjct: 264 EPAKANVLFGHPNVICTPHLGASTSEAQENVALQVAEQMSDYLLTGAISNAINFPSITAE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL   +I ++QI Y+G+ A M    L +A L+G++R    
Sbjct: 324 EAPKLKPFIELAEKLGSFAGQLTESNIAKVQITYEGAVAEMKVKALTAAALSGLLRPMLG 383

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP++ KE  +++  + R
Sbjct: 384 DVNVVSAPVVAKERGMVVDEVLR 406


>gi|296284464|ref|ZP_06862462.1| D-3-phosphoglycerate dehydrogenase [Citromicrobium bathyomarinum
           JL354]
          Length = 528

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 108/208 (51%), Positives = 148/208 (71%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+NIL+ ENL+KTK GV I+NCARGGL+DE ALAE L SGHVA A  DVF+ 
Sbjct: 203 LHTPLTDETRNILSGENLAKTKKGVRIVNCARGGLIDEAALAEALDSGHVAGAALDVFQT 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFG P   C P+LGAST E+QE VA+Q+A Q+SD+L+ G V+NALNM  +S E
Sbjct: 263 EPAKESPLFGKPGFICTPHLGASTREAQENVALQVAEQLSDFLLTGAVTNALNMPSLSAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KP+M LA+ LG  +GQL   S+ +I I  +G  A +N   + +AVLAG++R +  
Sbjct: 323 EAPRLKPYMQLAESLGSLVGQLAHGSLPKIAIELEGDAAELNPKPITAAVLAGLMRRFSQ 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N+++AP + K+  I +  I+  + G 
Sbjct: 383 SVNMVNAPFLAKDRGIEVREIRSTREGT 410


>gi|94496033|ref|ZP_01302612.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas sp. SKA58]
 gi|94424725|gb|EAT09747.1| D-3-phosphoglycerate dehydrogenase [Sphingomonas sp. SKA58]
          Length = 517

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 150/207 (72%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+NIL++ENL+KTK GV IINCARGGL+DE AL + L SG VA A  DVF+ 
Sbjct: 191 LHTPLTDQTRNILSRENLAKTKKGVRIINCARGGLIDEAALKDALDSGQVAGAALDVFQT 250

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFG PN  C P+LGAST E+Q  VA+Q+A Q+SDYL+DG ++NALN+  +S E
Sbjct: 251 EPAKESPLFGTPNFICTPHLGASTDEAQVNVALQVAEQLSDYLLDGGITNALNVPSLSAE 310

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KP+M LA+ LG  IGQL  ++I  + +  +G  A +N   + +AVLAG++RV+  
Sbjct: 311 EAPKLKPYMALAEKLGSLIGQLEGDAITGVAVEVEGQAAQLNPKPITAAVLAGLMRVYSD 370

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP + KE  + +  ++ D+ G
Sbjct: 371 TVNMVNAPFLAKERGLDVREVRHDREG 397


>gi|87200693|ref|YP_497950.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87136374|gb|ABD27116.1| D-3-phosphoglycerate dehydrogenase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 540

 Score =  227 bits (579), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 150/207 (72%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+NIL++EN++K K GV IINCARGGLVDE AL + L SGHVA A  DVFE 
Sbjct: 214 LHTPLTDQTRNILSRENIAKCKKGVRIINCARGGLVDEAALKDALDSGHVAGAALDVFET 273

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFG PN  C P+LGAST E+Q  VA+Q+A QM+D+L+ G V+NALNM  +S E
Sbjct: 274 EPAKESPLFGTPNFICTPHLGASTTEAQVNVALQVAEQMADFLVTGGVTNALNMPSLSAE 333

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP ++P+M LA+ LG  +GQL  +++ +I I  +G+ A +N   + +AVLAG+++ +  
Sbjct: 334 EAPKLRPYMALAEKLGSLVGQLAHDNLTKIAIEVEGAAAQLNQKPITAAVLAGLMKQYSQ 393

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP + KE  + +  ++ D+ G
Sbjct: 394 TVNMVNAPFLAKERGLDVREVRHDREG 420


>gi|167648422|ref|YP_001686085.1| D-3-phosphoglycerate dehydrogenase [Caulobacter sp. K31]
 gi|167350852|gb|ABZ73587.1| D-3-phosphoglycerate dehydrogenase [Caulobacter sp. K31]
          Length = 526

 Score =  227 bits (579), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 113/206 (54%), Positives = 143/206 (69%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NIL++E L KTK GV I+NCARGGLVDE AL ELL SGHV  AGFDVF  
Sbjct: 202 LHTPLTDKTRNILSREALQKTKKGVLIVNCARGGLVDEVALRELLDSGHVGGAGFDVFTE 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPLFG   V   P+LGAST E+QE VA+Q+A QMSDYL+ G V+NALN   IS E
Sbjct: 262 EPAKANPLFGSDRVVATPHLGASTNEAQENVALQVAEQMSDYLLTGAVTNALNSPSISAE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ +G   GQ++   I+ I I Y+G  A +N   + SA LAGI++    
Sbjct: 322 EAPKLKPFVALAEKIGALAGQMVDFGIKAIDIAYEGEVANLNVKPMTSAALAGILKPMLA 381

Query: 181 GANIISAPIIIKENAIILSTIKRDKS 206
             N++SAP + KE  I +S  +++ S
Sbjct: 382 EINMVSAPAVAKERGITVSESRQEVS 407


>gi|197106733|ref|YP_002132110.1| D-3-phosphoglycerate dehydrogenase [Phenylobacterium zucineum HLK1]
 gi|196480153|gb|ACG79681.1| D-3-phosphoglycerate dehydrogenase [Phenylobacterium zucineum HLK1]
          Length = 524

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 145/206 (70%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NIL++ENL KTK GV I+NCARGGLVDE AL +LL  GHV  A FDVF  
Sbjct: 200 LHTPLTDKTRNILSEENLRKTKKGVLIVNCARGGLVDEAALRKLLDEGHVGGAAFDVFIE 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG  N    P+LGAST+E+QE VA+Q+A QMSDYL+ G V+NALN   ++ E
Sbjct: 260 EPAKENVLFGAENFIATPHLGASTLEAQENVALQVAEQMSDYLLTGAVTNALNSPSVTAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQ++   +  + I ++G  A +NT  L +A LAG++R    
Sbjct: 320 EAPRLKPFVALAEKLGAFAGQMVDFGVTAVDIAFEGEVAKLNTKPLTAAALAGVLRPMLA 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKS 206
             N++SAP + KE  I +S  ++++S
Sbjct: 380 EVNMVSAPAVAKERGITVSESRQEES 405


>gi|16127445|ref|NP_422009.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 gi|221236257|ref|YP_002518694.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
 gi|13424897|gb|AAK25177.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 gi|220965430|gb|ACL96786.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
          Length = 526

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 109/206 (52%), Positives = 145/206 (70%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NIL+ ENL+KTK GV I+NCARGGLVDE AL +LL  GHV  A FDVF V
Sbjct: 202 LHTPLTDKTRNILSAENLAKTKKGVMIVNCARGGLVDEAALRKLLDEGHVGGAAFDVFTV 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFG   V   P+LGAST E+QE VA+Q+A Q+SDYL+ G V+NALN   I+ E
Sbjct: 262 EPAKENPLFGSDKVVATPHLGASTNEAQENVALQVAEQVSDYLLTGAVTNALNSPSITAE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ +G F GQ++   ++ I I Y+G  + +N   + SA LAG+++    
Sbjct: 322 EAPKLKPFVALAEKIGAFAGQMVDFGVKAIDIAYEGEVSNLNVKPMTSAALAGVLKPMLA 381

Query: 181 GANIISAPIIIKENAIILSTIKRDKS 206
             N++SAP I KE  I +S  +++ S
Sbjct: 382 EINMVSAPAIAKERGITVSESRQEVS 407


>gi|328542552|ref|YP_004302661.1| Aspartyl/glutamyl tRNA amidotransferase subunit C [Polymorphum
           gilvum SL003B-26A1]
 gi|326412298|gb|ADZ69361.1| Aspartyl/glutamyl tRNA amidotransferase subunit C [Polymorphum
           gilvum SL003B-26A1]
          Length = 528

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 109/207 (52%), Positives = 146/207 (70%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI++ E ++K K GV IINCARGGLVDE A+ E L SG +A A FDVF  
Sbjct: 203 LHTPLTDKTRNIISAEAIAKMKQGVYIINCARGGLVDEKAVREGLDSGKIAGAAFDVFTE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG PN+ C P+LGAST E+QE VA+Q+A QMSDYLI+G V+NALNM  IS +
Sbjct: 263 EPAKENVLFGAPNLVCTPHLGASTEEAQENVALQVAEQMSDYLINGAVTNALNMPSISAD 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP + PF+ LA+ LG F GQL    I+ I++ Y+G+ A MNT  L +A L G++     
Sbjct: 323 EAPRLTPFVRLAEQLGSFAGQLTETGIKGIRLEYEGAVAEMNTKALTAAALTGVLTPLLQ 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP + +E  I +  ++R++ G
Sbjct: 383 TVNMVSAPAMARERDIHVEEVRREQMG 409


>gi|254294765|ref|YP_003060788.1| D-3-phosphoglycerate dehydrogenase [Hirschia baltica ATCC 49814]
 gi|254043296|gb|ACT60091.1| D-3-phosphoglycerate dehydrogenase [Hirschia baltica ATCC 49814]
          Length = 525

 Score =  224 bits (571), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 141/206 (68%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+NIL++ENL KTK GV I+NCARGGLVDE AL +LL +GH+  A  DVFE 
Sbjct: 201 LHTPLTDQTRNILSRENLGKTKKGVIIVNCARGGLVDEEALKDLLDNGHITAAALDVFET 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++ LFG       P+LGASTVE+Q+ VA Q+A QM+DYL+ G VSNALNM  I+ E
Sbjct: 261 EPAKEHALFGTRGFIATPHLGASTVEAQDNVAFQVAEQMADYLLTGAVSNALNMPSITAE 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF  LA+ LG F GQ+ +E    ++I Y+G    +N   L SA LAGI+R    
Sbjct: 321 EAPRLKPFAELAEKLGEFAGQISTEGFDAVEIDYEGEVCELNRKPLTSAALAGIMRASMK 380

Query: 181 GANIISAPIIIKENAIILSTIKRDKS 206
             N++SAP ++KE  I L    ++ S
Sbjct: 381 DVNMVSAPTVLKERGIDLKESTQEDS 406


>gi|220926557|ref|YP_002501859.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium nodulans ORS
           2060]
 gi|219951164|gb|ACL61556.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium nodulans ORS
           2060]
          Length = 531

 Score =  224 bits (570), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 107/206 (51%), Positives = 145/206 (70%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KT+NIL+ E L++TK GV I+NCARGGLVDE AL   L  GHVA A FDVF V
Sbjct: 205 LHVPLTEKTRNILSAEALARTKPGVRIVNCARGGLVDEAALRAALDRGHVAGAAFDVFSV 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG P+V C P+LGAST E+QE VA+Q+A QM+D+L+ G + NA+N   IS E
Sbjct: 265 EPATENVLFGHPHVICTPHLGASTREAQENVALQVAEQMADHLLHGAIRNAVNFPSISAE 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP ++PF+TLA+ LG F+GQL    I+ I+I ++G  A MN   L ++ +AG ++ +  
Sbjct: 325 EAPRLRPFVTLAEQLGSFLGQLTEAPIRGIRIAFEGEIASMNLKALTASAVAGALKPFLE 384

Query: 181 GANIISAPIIIKENAIILSTIKRDKS 206
           G N++SA  + ++  I++ T  R  S
Sbjct: 385 GVNMVSATEVARQRGIVVETTTRTGS 410


>gi|149186566|ref|ZP_01864878.1| phosphoglycerate dehydrogenase [Erythrobacter sp. SD-21]
 gi|148829793|gb|EDL48232.1| phosphoglycerate dehydrogenase [Erythrobacter sp. SD-21]
          Length = 537

 Score =  223 bits (569), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 103/207 (49%), Positives = 150/207 (72%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+NIL++ENL+KTK GV I+NCARGGL+DE ALAE L SG  A A  DVF+ 
Sbjct: 212 LHTPLTDETRNILSRENLAKTKKGVRIVNCARGGLIDEAALAEALDSGQAAGAALDVFQT 271

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PLFG PN  C P+LGAST E+Q  VA+Q+A Q++DYL++G V+NALNM  +S E
Sbjct: 272 EPAKDSPLFGKPNFICTPHLGASTTEAQVNVALQVAEQLADYLVNGGVTNALNMPSLSAE 331

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP ++P+M LA++LG  +GQL   ++ +I I  +G+ A ++   +  AVL+G++R +  
Sbjct: 332 EAPKLRPYMKLAENLGSLVGQLAHGNLTKINIEREGAAAELSGKPIEGAVLSGLMRQYSD 391

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP + KE  + + +I+ +K G
Sbjct: 392 TVNMVNAPFLAKERGLDIRSIRHEKEG 418


>gi|323135941|ref|ZP_08071024.1| D-3-phosphoglycerate dehydrogenase [Methylocystis sp. ATCC 49242]
 gi|322399032|gb|EFY01551.1| D-3-phosphoglycerate dehydrogenase [Methylocystis sp. ATCC 49242]
          Length = 528

 Score =  223 bits (569), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 104/204 (50%), Positives = 143/204 (70%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TKNIL+ E L+KT+ GV +INCARGGL+DE AL + L  GHVA A  DVF V
Sbjct: 203 IHTPLTAQTKNILSAEALAKTRKGVRVINCARGGLLDEAALRKALDDGHVAGAALDVFAV 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA++NPLFG  NV C P+LGAST E+QEKVA+Q+A QMSDYL  G ++NA+N   IS E
Sbjct: 263 EPAMENPLFGHANVVCTPHLGASTTEAQEKVALQIAEQMSDYLTRGAITNAVNFPSISAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF  LA+ LG F GQ+    ++ + I+++G+ A   T  +++A L+G+++    
Sbjct: 323 EAPRLKPFAALAEKLGLFAGQIARSGVENLSIVFEGAIAHQKTRAISAAALSGLLKPILE 382

Query: 181 GANIISAPIIIKENAIILSTIKRD 204
             N +SAP+I +E  + +  I RD
Sbjct: 383 DVNPVSAPVIARERGVAVEEITRD 406


>gi|46203185|ref|ZP_00208842.1| COG0111: Phosphoglycerate dehydrogenase and related dehydrogenases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 534

 Score =  223 bits (568), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 145/208 (69%), Gaps = 4/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVA-EAGFD--- 56
           LHVPLT+KT+NIL+ ENL++TK GV I+NCARGGLVDE AL   L SGH    AG     
Sbjct: 204 LHVPLTDKTRNILSTENLARTKRGVRIVNCARGGLVDEAALRAALDSGHGGGRAGLSDRX 263

Query: 57  VFEVEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
                PA++NPLFG PNV C P+LGAST E+QE VA+Q+A QM+DYL+ G ++NA+N   
Sbjct: 264 FRSPSPAVENPLFGHPNVICTPHLGASTSEAQENVALQVAEQMADYLLSGAITNAINFPS 323

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR 176
           IS EEAP +KPF+ L + LG F+GQL    I+ I+I Y+G+ A MNT  L SA + G++R
Sbjct: 324 ISAEEAPRLKPFVALCEKLGSFLGQLTEAPIKGIRITYEGAVAGMNTRALTSAAVTGVLR 383

Query: 177 VWRVGANIISAPIIIKENAIILSTIKRD 204
                 N++SAP+I ++  I++  IKR+
Sbjct: 384 PILQDVNMVSAPVIARDRGIVVDEIKRE 411


>gi|92116697|ref|YP_576426.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter hamburgensis X14]
 gi|91799591|gb|ABE61966.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter hamburgensis X14]
          Length = 529

 Score =  223 bits (567), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 107/203 (52%), Positives = 141/203 (69%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI++   ++K K GV IINCARGGLVDE ALA+ L + HVA A FDVF  
Sbjct: 204 LHTPLTDKTRNIIDAAAIAKMKKGVRIINCARGGLVDEQALADALNAKHVAGAAFDVFVE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG PNV C P+LGAST E+QE VA+Q+A QMSDYL+ G ++NALN   I+ E
Sbjct: 264 EPATKNVLFGHPNVICTPHLGASTSEAQENVALQVAEQMSDYLLTGAITNALNFPSITAE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL    I ++ I Y+G  A M    L SA L+G++R    
Sbjct: 324 EAPKLKPFVELAEKLGSFAGQLTETGISKVIITYEGQVAEMKIKALTSAALSGLLRPMLG 383

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP++ KE  +++  + R
Sbjct: 384 DVNVVSAPVVAKERGMVVDEVVR 406


>gi|218461199|ref|ZP_03501290.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli Kim 5]
          Length = 463

 Score =  221 bits (564), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 134/171 (78%)

Query: 38  ENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAH 97
           +  L + ++SGHVA A FDVFEVEPA ++PLFGLPNV C P+LGAST E+QE VA+Q+A 
Sbjct: 201 KRPLQKAIKSGHVAGAAFDVFEVEPAKESPLFGLPNVVCTPHLGASTTEAQENVALQVAE 260

Query: 98  QMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGS 157
           QMSDYL+ G VSNA+NM  I+ EEAP++KPF+ LAD LG F+GQ+  E I+EI+I+YDG 
Sbjct: 261 QMSDYLVKGAVSNAINMPSITAEEAPILKPFIRLADVLGAFVGQVTEEPIKEIEILYDGI 320

Query: 158 TAVMNTMVLNSAVLAGIVRVWRVGANIISAPIIIKENAIILSTIKRDKSGV 208
           TA MNT  L SAVLAG++R      N++SAPI+IKE  I+LS +KRDK+GV
Sbjct: 321 TANMNTRALTSAVLAGLIRPQVADVNMVSAPIMIKEKGIVLSEVKRDKTGV 371


>gi|295688138|ref|YP_003591831.1| D-3-phosphoglycerate dehydrogenase [Caulobacter segnis ATCC 21756]
 gi|295430041|gb|ADG09213.1| D-3-phosphoglycerate dehydrogenase [Caulobacter segnis ATCC 21756]
          Length = 526

 Score =  221 bits (563), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 107/206 (51%), Positives = 144/206 (69%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NIL+ E L+KTK GV I+NCARGGLVDE AL +LL  GHV  A FDVF V
Sbjct: 202 LHTPLTDKTRNILSAEALAKTKKGVLIVNCARGGLVDEAALRKLLDEGHVGGAAFDVFTV 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFG   V   P+LGAST E+QE VA+Q+A Q+SDYL+ G V+NALN   I+ E
Sbjct: 262 EPAKENPLFGSDKVVATPHLGASTSEAQENVALQVAEQVSDYLLTGAVTNALNSPSITAE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ +G F GQ++   I+ I I ++G  + +N   + SA LAG+++    
Sbjct: 322 EAPKLKPFVALAEKIGAFAGQMVDFGIKAIDIAFEGEVSNLNVKPMTSAALAGVLKPMLA 381

Query: 181 GANIISAPIIIKENAIILSTIKRDKS 206
             N++SAP + KE  I +S  +++ S
Sbjct: 382 EINMVSAPAVAKERGITVSESRQEVS 407


>gi|27382512|ref|NP_774041.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium japonicum USDA
           110]
 gi|27355684|dbj|BAC52666.1| D-3-phosphoglycerate dehydrogenase [Bradyrhizobium japonicum USDA
           110]
          Length = 529

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 140/203 (68%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTKNI++   ++K K GV +INCARGGLVDE A+ + L S H+A A FDVF  
Sbjct: 204 LHTPLTEKTKNIIDAAAIAKMKKGVRLINCARGGLVDEQAVVDALNSKHIAGAAFDVFVE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N LFG PNV C P+LGAST E+QE VA+Q+A QMSDYL+ G +SNA+N   I+ E
Sbjct: 264 EPANTNVLFGHPNVICTPHLGASTTEAQENVALQVAEQMSDYLLTGAISNAVNFPSITAE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL    I +++I Y+G  A M    + SAVL+G++R    
Sbjct: 324 EAPKLKPFIALAEKLGSFAGQLTESGILKVEITYEGHVAEMKIKAITSAVLSGLLRPMLG 383

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP++ KE  +++  I R
Sbjct: 384 EVNVVSAPVVAKERGMVVDEIVR 406


>gi|85707813|ref|ZP_01038879.1| phosphoglycerate dehydrogenase [Erythrobacter sp. NAP1]
 gi|85689347|gb|EAQ29350.1| phosphoglycerate dehydrogenase [Erythrobacter sp. NAP1]
          Length = 534

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 144/207 (69%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+NIL++E L   K G+ I+NCARGGL+DE AL   L+SG VA A  DVF  
Sbjct: 209 LHTPLTDETRNILSRERLENAKPGIRIVNCARGGLIDEVALKNCLESGQVAGAALDVFAE 268

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFG PN  C P+LGAST E+Q  VA+Q+A QMSDYL++G V+NALNM  +S E
Sbjct: 269 EPAKENPLFGAPNFICTPHLGASTTEAQVNVALQVAEQMSDYLVNGGVTNALNMPSLSAE 328

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KP+M+LA+ LG  +GQL   ++ +I I  +G+ A +N   +  AVLAG +R +  
Sbjct: 329 EAPKLKPYMSLAEKLGSLVGQLAHGNLTKISIEREGAAAELNGKPITGAVLAGFMRRYSD 388

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP + KE  + +S I+  + G
Sbjct: 389 TVNMVNAPYLAKERGLDVSEIRHQREG 415


>gi|75677149|ref|YP_319570.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
 gi|74422019|gb|ABA06218.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter winogradskyi
           Nb-255]
          Length = 529

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 105/203 (51%), Positives = 139/203 (68%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI++ + ++  K GV IINCARGGLVDE ALA+ L +  VA A FDVF  
Sbjct: 204 LHTPLTDKTRNIIDADAIAGMKKGVRIINCARGGLVDEQALADALNTKQVAGAAFDVFVE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N LFG PNV C P+LGAST E+QE VA+Q+A QMSDYL+ G ++NALN   I+ E
Sbjct: 264 EPATGNVLFGHPNVICTPHLGASTTEAQENVALQVAEQMSDYLLTGAITNALNFPSITAE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL    I ++ I Y+G  A M    L SA L+G++R    
Sbjct: 324 EAPKLKPFVELAEKLGSFAGQLTETGISKVTITYEGQVAEMKIKALTSAALSGLLRPMLG 383

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP++ KE  +++  + R
Sbjct: 384 DVNVVSAPVVAKERGMVVDEVVR 406


>gi|148261633|ref|YP_001235760.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|326405123|ref|YP_004285205.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium multivorum AIU301]
 gi|146403314|gb|ABQ31841.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium cryptum JF-5]
 gi|325051985|dbj|BAJ82323.1| D-3-phosphoglycerate dehydrogenase [Acidiphilium multivorum AIU301]
          Length = 528

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 151/208 (72%), Gaps = 3/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT +T+NIL++E++++TK GV IINCARGGLVDE AL + L+SGHVA A  DVFEV
Sbjct: 200 LHTPLTEQTRNILSRESIARTKPGVRIINCARGGLVDEAALYDALKSGHVAGAALDVFEV 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLF LPNV C P+LGA+T E+QE VA+Q+A Q+SD+L+ G V+NA+NMA +S E
Sbjct: 260 EPAKESPLFALPNVVCTPHLGAATTEAQENVALQVAEQISDFLLTGAVTNAINMASVSAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISES---IQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           +AP +KP+M L   LG F GQL       I+++ I Y+G+ A +N   L++A+ AG++  
Sbjct: 320 DAPRLKPYMELCQLLGSFAGQLTEARQGVIRKVGIEYEGAAAHVNQRPLSAALFAGLLAP 379

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDK 205
              G N+++AP+  +++ I L+    D+
Sbjct: 380 MMEGVNMVNAPVFARDHGIELAETVFDR 407


>gi|90425581|ref|YP_533951.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
 gi|90107595|gb|ABD89632.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisB18]
          Length = 529

 Score =  218 bits (556), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 105/203 (51%), Positives = 139/203 (68%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI++   ++K K GV IINCARGGLVDE AL + L S  VA A FDVF  
Sbjct: 204 LHTPLTDKTRNIIDAAAIAKMKKGVRIINCARGGLVDEQALVDALNSKQVAGAAFDVFVE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG  NV C P+LGAST E+QE VA+Q+A QMSDYL+ G +SNA+N   I+ E
Sbjct: 264 EPATKNVLFGHANVICTPHLGASTTEAQENVALQVAEQMSDYLLTGAISNAVNFPSITAE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL    I ++ I Y+G+ A M    L SA L+G++R    
Sbjct: 324 EAPKLKPFIELAEKLGSFAGQLTESGISKVTITYEGAVAEMKIKALTSAALSGLLRPMLG 383

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP++ KE  +++  + R
Sbjct: 384 DVNVVSAPVVAKERGMVVDEVVR 406


>gi|85715274|ref|ZP_01046257.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter sp. Nb-311A]
 gi|85697920|gb|EAQ35794.1| D-3-phosphoglycerate dehydrogenase [Nitrobacter sp. Nb-311A]
          Length = 549

 Score =  218 bits (554), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 103/203 (50%), Positives = 140/203 (68%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI++   ++K K GV IINCARGGLVDE AL + L +  VA A FDVF  
Sbjct: 224 LHTPLTDKTRNIIDAAAIAKMKKGVRIINCARGGLVDEQALVDALNAKQVAGAAFDVFVE 283

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG P V C P+LGAST E+QE VA+Q+A QMSDYL++G ++NA+N   I+ E
Sbjct: 284 EPATKNVLFGHPGVICTPHLGASTTEAQENVALQVAEQMSDYLLNGAITNAINFPSITAE 343

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF++LA+ LG F GQL    I ++ I Y+G  A M    L SA L+G++R    
Sbjct: 344 EAPKLKPFVSLAEKLGSFAGQLTETGISKVTITYEGQVAEMKIKALTSAALSGLLRPMLG 403

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP++ KE  +++  + R
Sbjct: 404 DVNVVSAPVVAKERGMVVDEVVR 426


>gi|254473015|ref|ZP_05086413.1| phosphoglycerate dehydrogenase [Pseudovibrio sp. JE062]
 gi|211957736|gb|EEA92938.1| phosphoglycerate dehydrogenase [Pseudovibrio sp. JE062]
          Length = 532

 Score =  217 bits (552), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 140/207 (67%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+NI++   +   K GV +INCARGGLVDE AL   L SG VA A  DVF  
Sbjct: 203 LHTPLTDRTRNIIDAAAIDMMKEGVYLINCARGGLVDEVALRAALDSGKVAGAAVDVFTE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG PN+ C P+LGAST E+QE VA+Q+A QMSDYL++G VSNALNM  I+ E
Sbjct: 263 EPAKENVLFGAPNLVCTPHLGASTSEAQENVALQVAEQMSDYLVNGAVSNALNMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP + PF+ LA+ LG F GQ     I+ ++I Y+G  A MN   + +A L G++R    
Sbjct: 323 EAPRLAPFVKLAEQLGSFAGQATETGIKAVRIEYEGDVAEMNVKAMTAAALTGVLRPLLQ 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP + KE  I++  ++R++ G
Sbjct: 383 TVNMVSAPEVAKERGIVIEDVRREQHG 409


>gi|170744437|ref|YP_001773092.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium sp. 4-46]
 gi|168198711|gb|ACA20658.1| D-3-phosphoglycerate dehydrogenase [Methylobacterium sp. 4-46]
          Length = 531

 Score =  216 bits (550), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 145/203 (71%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT+KT+NIL+ E L++TK GV I+NCARGGLVDE AL   L SGHVA A  DVF V
Sbjct: 205 LHVPLTDKTRNILSAEALARTKPGVRIVNCARGGLVDEAALRAALDSGHVAGAALDVFAV 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG P+V C P+LGAST E+QE VA+Q+A QM+D+L+ G + NA+N   IS E
Sbjct: 265 EPATENVLFGHPSVICTPHLGASTREAQENVALQVAEQMADHLLHGAIRNAVNFPSISAE 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP ++PF+TLA+ LG F+GQL    I+ I+I ++G  A MN   L +A +AG +R +  
Sbjct: 325 EAPRLRPFVTLAEQLGSFLGQLTEAPIRGIRIAFEGEVAAMNLRALTAAAVAGALRPFLE 384

Query: 181 GANIISAPIIIKENAIILSTIKR 203
           G N++SA  + ++  I++ T  R
Sbjct: 385 GVNMVSATEVARQRGIVVETTTR 407


>gi|312115664|ref|YP_004013260.1| D-3-phosphoglycerate dehydrogenase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220793|gb|ADP72161.1| D-3-phosphoglycerate dehydrogenase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 526

 Score =  216 bits (549), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 107/207 (51%), Positives = 144/207 (69%), Gaps = 1/207 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTKNI+N ++++  K GV IINCARGGL+ E ALA+ +++GHVA A  DVFEV
Sbjct: 202 LHTPLTEKTKNIINAQSIATMKKGVRIINCARGGLIVEQALADAIKAGHVAGAALDVFEV 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFGL NV   P+LGAST E+QE VA+Q+A QM+DYL+ G +SNA+N   I+ E
Sbjct: 262 EPAKENVLFGLANVISTPHLGASTSEAQENVALQVAEQMADYLLTGAISNAVNFPSITAE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL   +   I++ Y G  A MNT  L SA ++G++R + +
Sbjct: 322 EAPKLKPFVKLAELLGSFAGQLTEAAPNFIRLEYAGDVADMNTRALTSAAISGVLRHF-L 380

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++S P + KE  I +   KR + G
Sbjct: 381 HVNMVSGPAVAKERGIQVEETKRGQEG 407


>gi|209965081|ref|YP_002297996.1| D-3-phosphoglycerate dehydrogenase [Rhodospirillum centenum SW]
 gi|209958547|gb|ACI99183.1| D-3-phosphoglycerate dehydrogenase [Rhodospirillum centenum SW]
          Length = 525

 Score =  215 bits (548), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 101/207 (48%), Positives = 142/207 (68%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLTN+T+ ILN+++L++TK GV IINCARGGL+ E  L   ++SGHVA A  DVF  
Sbjct: 200 LHTPLTNETRAILNRDSLARTKKGVRIINCARGGLIVEEDLKAAIESGHVAGAALDVFAE 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA QN LFG+  V C P+LGAST E+QE VA+Q+A QM+DYL+ G V NALNM  +S E
Sbjct: 260 EPAKQNGLFGMERVICTPHLGASTTEAQENVALQVAEQMADYLVSGAVVNALNMPSVSAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           +AP ++P+M LA+ LG F GQ+    ++ + + ++G  A +NT  L + VL G++     
Sbjct: 320 DAPRLRPYMKLAEQLGSFAGQITETGLKAVTVEFEGQVAELNTRPLTAVVLKGLLAPLME 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP+I +E  I +S  KR  +G
Sbjct: 380 SVNMVNAPVIAREREIKVSETKRQDAG 406


>gi|46201295|ref|ZP_00208046.1| COG0111: Phosphoglycerate dehydrogenase and related dehydrogenases
           [Magnetospirillum magnetotacticum MS-1]
          Length = 526

 Score =  215 bits (548), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 143/207 (69%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+ T+NI++ + ++K K GV IINCARGGLV E  L   L+SG VA A  DVF+ 
Sbjct: 200 LHTPLTDATRNIIDSKAMAKMKKGVRIINCARGGLVVEEDLLAALESGQVAGAALDVFKT 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLFG   V C P+LGAST E+QE VA+Q+A QM+DYL+ G V+NALN+  +S E
Sbjct: 260 EPAKENPLFGNSKVVCTPHLGASTSEAQENVALQVAEQMADYLLTGAVTNALNIPSVSAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           +AP +KP+MTLA+ LG F GQL    I+E++I Y G  A +NT  L + VL G+++    
Sbjct: 320 DAPKLKPYMTLANQLGSFAGQLTETGIREVKIEYMGHVASLNTKPLTAVVLEGLLKPMNE 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP++ KE  I +S +K +  G
Sbjct: 380 AVNMVNAPVVAKERNIKVSEVKTETEG 406


>gi|103486109|ref|YP_615670.1| D-3-phosphoglycerate dehydrogenase [Sphingopyxis alaskensis RB2256]
 gi|98976186|gb|ABF52337.1| D-3-phosphoglycerate dehydrogenase [Sphingopyxis alaskensis RB2256]
          Length = 528

 Score =  212 bits (540), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 147/208 (70%), Gaps = 1/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+N+L+KENL+KT+ GV IINCARGGL+DE AL + L SGHVA A  DVF V
Sbjct: 202 LHTPLTDQTRNVLSKENLAKTRKGVRIINCARGGLIDEAALKDALDSGHVAGAALDVFAV 261

Query: 61  EPA-LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    +PLF  PN  C P+LGAST E+Q  VAIQ+A Q+SDYL+ G ++NALN+  +S 
Sbjct: 262 EPPPADHPLFNTPNFICTPHLGASTDEAQVNVAIQVAEQISDYLLTGGITNALNVPSLSA 321

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           EEAP ++P+M+LA+ LG  +GQL  +++  I +  +G+ A +N   + +AVL G++R + 
Sbjct: 322 EEAPKLRPYMSLAEKLGSLVGQLAHDNLTHISVEVEGAAAELNLKPIVAAVLTGLMRRYS 381

Query: 180 VGANIISAPIIIKENAIILSTIKRDKSG 207
              N+++AP + +E  + +  ++ D+ G
Sbjct: 382 DSVNMVNAPHLARERGLDVREVRHDREG 409


>gi|332188569|ref|ZP_08390288.1| phosphoglycerate dehydrogenase [Sphingomonas sp. S17]
 gi|332011413|gb|EGI53499.1| phosphoglycerate dehydrogenase [Sphingomonas sp. S17]
          Length = 516

 Score =  212 bits (539), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 145/207 (70%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+NIL+ ENL+KTK GV IINCARGGL+DE+AL   L SGH+  A  DVF+V
Sbjct: 191 LHTPLTDQTRNILSAENLAKTKKGVRIINCARGGLIDEDALKAGLDSGHIGGAALDVFKV 250

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PLFG PN    P+LGAST E+Q  VAIQ+A Q++D+L+ G V+NALNM  ++ E
Sbjct: 251 EPAKESPLFGTPNFISTPHLGASTTEAQVNVAIQVAEQLADFLVSGGVTNALNMPSLTAE 310

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KP+M LA+ LG  +GQL   ++  I I  +G+ A +N   +  AVLAG +RV   
Sbjct: 311 EAPKLKPYMALAEKLGSLVGQLAHGAVTGIAIEAEGAAAALNLKPITGAVLAGFMRVHSD 370

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP + KE  + +  ++ D+ G
Sbjct: 371 TVNMVNAPFLAKERGLDVREVRHDREG 397


>gi|83312292|ref|YP_422556.1| D-3-phosphoglycerate dehydrogenase [Magnetospirillum magneticum
           AMB-1]
 gi|82947133|dbj|BAE51997.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Magnetospirillum magneticum AMB-1]
          Length = 526

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 101/207 (48%), Positives = 143/207 (69%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+ T+NI++ + ++K K GV IINCARGGLV E  L   L+SG VA A  DVF+ 
Sbjct: 200 LHTPLTDATRNIIDAKAMAKMKKGVRIINCARGGLVVEEDLLAALESGQVAGAALDVFKT 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG P V C P+LGAST E+QE VA+Q+A QM+DYL+ G V+NALN+  +S E
Sbjct: 260 EPAKENALFGNPKVVCTPHLGASTSEAQENVALQVAEQMADYLLTGAVTNALNIPSVSAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           +AP ++P+MTLA+ +G F GQL    I++++I Y G  A +NT  L + VL G+++    
Sbjct: 320 DAPKLRPYMTLANQIGSFAGQLTETGIKDVKIEYLGHVASLNTKPLTAMVLEGLLKPMNE 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP++ KE  I +S +K +  G
Sbjct: 380 AVNMVNAPVVAKERNIKVSEVKSESEG 406


>gi|294085874|ref|YP_003552634.1| phosphoglycerate dehydrogenase and related dehydrogenase
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292665449|gb|ADE40550.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 527

 Score =  210 bits (535), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 106/205 (51%), Positives = 145/205 (70%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+ T+NI++ + L+KTK GV I+NCARGGLVDE ALA  L +GHVA A  DVFE 
Sbjct: 200 LHTPLTDGTRNIISADALNKTKKGVRIVNCARGGLVDEMALAAALGTGHVAGAALDVFEN 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N LFG+ NV   P+LGAST E+QEKVA+Q+A QM+D+L+ G V+NALNMA +S E
Sbjct: 260 EPATDNILFGMDNVVATPHLGASTTEAQEKVALQVAEQMADFLVKGAVTNALNMASVSAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KP+M L   LG F+GQ+ SE +Q + I  DG  AV+N   + ++ LAG++     
Sbjct: 320 EAPILKPYMVLGRQLGSFLGQVESEGLQSVSIELDGKAAVLNPEPIVASTLAGLLGPVME 379

Query: 181 GANIISAPIIIKENAIILSTIKRDK 205
             N+++A  +   N I +ST++ D+
Sbjct: 380 SVNMVNAAAVASANGIAVSTVRHDR 404


>gi|115526154|ref|YP_783065.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
 gi|115520101|gb|ABJ08085.1| D-3-phosphoglycerate dehydrogenase [Rhodopseudomonas palustris
           BisA53]
          Length = 530

 Score =  210 bits (535), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 111/203 (54%), Positives = 142/203 (69%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KTKNI++   ++K K GV IINCARGGLVDE ALAE L++  VA A FDVF  
Sbjct: 205 LHTPLTDKTKNIIDAAAIAKMKPGVRIINCARGGLVDEAALAEALKAKKVAGAAFDVFVE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N LFGLPNV C P+LGAST E+QE VA+Q+A QMSDYL+ G +SNA+N   I+ E
Sbjct: 265 EPATANVLFGLPNVICTPHLGASTTEAQENVALQVAEQMSDYLLTGAISNAVNFPSITAE 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LA+ LG F GQL   +I ++ I Y+G  A M    L SA L+G++R    
Sbjct: 325 EAPKLKPFIELAEKLGSFAGQLTESNIAKVTITYEGHVAEMKIKALTSAALSGLLRPMLG 384

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP+I KE  +++  I R
Sbjct: 385 DINVVSAPVIAKERGMVVDEIVR 407


>gi|114800302|ref|YP_761802.1| D-3-phosphoglycerate dehydrogenase [Hyphomonas neptunium ATCC
           15444]
 gi|114740476|gb|ABI78601.1| D-3-phosphoglycerate dehydrogenase [Hyphomonas neptunium ATCC
           15444]
          Length = 531

 Score =  209 bits (533), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 150/208 (72%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++TKN+L++E L KTK G+ ++NCARGGLVDE A+ +LL+SGH+A A FDVF V
Sbjct: 200 LHVPLTDQTKNVLSREALEKTKKGLILVNCARGGLVDEEAVRDLLESGHLAGAAFDVFAV 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG  N    P+LGA+T E+QE VA+Q+A QM+DY++ G V+NALNM  ++ E
Sbjct: 260 EPAKENVLFGAKNFVATPHLGAATAEAQENVALQVAEQMADYILTGAVTNALNMPSVTAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF TLA+ LG F GQ+     +E+ I Y+G  + +N   + +A+LAG++R  R 
Sbjct: 320 EAPRLKPFATLAEKLGSFAGQISDYGYEEVVIEYEGEVSELNRKPITAALLAGLLRASRG 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKSGV 208
             N++SAP I+ ++ + L+  K + S V
Sbjct: 380 DVNMVSAPAILADSGVKLTETKTETSPV 407


>gi|307944592|ref|ZP_07659932.1| phosphoglycerate dehydrogenase [Roseibium sp. TrichSKD4]
 gi|307772341|gb|EFO31562.1| phosphoglycerate dehydrogenase [Roseibium sp. TrichSKD4]
          Length = 528

 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 139/207 (67%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI++++ ++  KSG  ++NCARGGLVDE A+   L SG +  A FDVF  
Sbjct: 203 LHTPLTDKTRNIVDEKAIASMKSGAYLVNCARGGLVDEQAVRSALDSGKLGGAAFDVFVE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG PN    P+LGA+T E+QE VA+Q+A QM DYL+ G VSNALNM  I+ E
Sbjct: 263 EPATENVLFGAPNFVSTPHLGAATSEAQENVALQVAEQMCDYLLHGAVSNALNMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP + PF+ LA+ LG F GQL    I+EI++ Y G  + M T  L +A L+G++     
Sbjct: 323 EAPKLVPFVRLAEQLGSFAGQLTETGIKEIRLEYAGVVSDMKTEALTAAALSGLLTPLLQ 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP+  KE  I ++ +KR K G
Sbjct: 383 TVNMVSAPVFAKERGIEVAEVKRGKRG 409


>gi|254504693|ref|ZP_05116844.1| D-3-phosphoglycerate dehydrogenase [Labrenzia alexandrii DFL-11]
 gi|222440764|gb|EEE47443.1| D-3-phosphoglycerate dehydrogenase [Labrenzia alexandrii DFL-11]
          Length = 528

 Score =  206 bits (525), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 99/207 (47%), Positives = 135/207 (65%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+N ++   +++ + G  +INCARGGL DE A+ + L SG +A A FDVF  
Sbjct: 203 LHTPLTDKTRNTIDAAAIAQMRDGAYLINCARGGLADEQAVRDALDSGKLAGAAFDVFVD 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG P     P+LGAST E+QE VA+Q+A QM DYL+ G V NALNM  I+ E
Sbjct: 263 EPAKENVLFGAPTFVSTPHLGASTEEAQENVALQVAEQMCDYLLSGAVRNALNMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP + PF+ LA+ LG F GQL    I+ +++ Y G+ A MN   L SA L G++     
Sbjct: 323 EAPKLAPFVRLAEQLGSFAGQLTETGIERVRLEYAGAVADMNVQALTSAALTGLLTPLLQ 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAPI+ KE  + +  ++RDK G
Sbjct: 383 TVNMVSAPILAKERGMQIEEVRRDKQG 409


>gi|118588317|ref|ZP_01545726.1| D-3-phosphoglycerate dehydrogenase [Stappia aggregata IAM 12614]
 gi|118439023|gb|EAV45655.1| D-3-phosphoglycerate dehydrogenase [Stappia aggregata IAM 12614]
          Length = 528

 Score =  204 bits (519), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 99/207 (47%), Positives = 134/207 (64%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+KT+NI++ + + K + G  +INCARGGL DE A+   L  G +  A FDVF  
Sbjct: 203 LHTPLTDKTRNIIDAKAIEKMRKGAYLINCARGGLADEAAVRAALDEGKLGGAAFDVFVE 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG PN    P+LGAST E+QE VA+Q+A QM DYL+ G V NALNM  I+ E
Sbjct: 263 EPAKENVLFGAPNFVSTPHLGASTTEAQENVALQVAEQMCDYLLQGAVRNALNMPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP + PF+ LA+ LG F GQL    I+ +++ Y G+ A MN   L +A L G++     
Sbjct: 323 EAPKLVPFVRLAEQLGSFAGQLTETGIEGVRLEYAGAVAEMNVQALTAAALTGLLTPLLQ 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAPI+ KE  + +  I+R+K G
Sbjct: 383 TVNMVSAPILAKERGMKIEEIRREKDG 409


>gi|304319942|ref|YP_003853585.1| putative phosphoglycerate dehydrogenase [Parvularcula bermudensis
           HTCC2503]
 gi|303298845|gb|ADM08444.1| putative phosphoglycerate dehydrogenase [Parvularcula bermudensis
           HTCC2503]
          Length = 527

 Score =  203 bits (516), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 98/207 (47%), Positives = 142/207 (68%), Gaps = 1/207 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT++T+NIL+K+ L+KTK GV IINCARGGLVDE AL + L+SGH+A A  DVFE 
Sbjct: 202 LHTPLTDQTRNILSKQALAKTKKGVRIINCARGGLVDEEALYDGLESGHIAGAALDVFEK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++ LFG  +V C P+LGA+T E+QE VAIQ+A Q++DYL+ G V+NALNM  +S E
Sbjct: 262 EPATEHKLFGRDDVICTPHLGAATTEAQENVAIQIAEQIADYLLTGAVTNALNMPSVSAE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           EAP ++P++ LA  LG   GQL   ++  +++ + G+ A +N   + +A L  ++R   R
Sbjct: 322 EAPKLRPYIDLAGRLGGLAGQLAPGAVTGVEMAFAGTAASLNPAPMTAAALTAVLRPAMR 381

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
              N ++A  + K+  I +S  + + S
Sbjct: 382 EAVNSVNAGQLAKQRGIQVSETRTETS 408


>gi|163796990|ref|ZP_02190946.1| Phosphoglycerate dehydrogenase and related dehydrogenase [alpha
           proteobacterium BAL199]
 gi|159177737|gb|EDP62288.1| Phosphoglycerate dehydrogenase and related dehydrogenase [alpha
           proteobacterium BAL199]
          Length = 525

 Score =  202 bits (513), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/205 (47%), Positives = 138/205 (67%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT+ T+NI++   ++K K GV IINCARGGLV E  L   L SG V  A FDVF  
Sbjct: 200 LHTPLTDATRNIIDAAAIAKMKRGVRIINCARGGLVVEADLRVGLDSGQVGGAAFDVFVT 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFG PNV C P+LGAST E+QEKVA+Q+A QMSDYL+ G +SNA+N+  ++ E
Sbjct: 260 EPAKENVLFGHPNVVCTPHLGASTSEAQEKVALQVAEQMSDYLLTGAISNAVNVPSVTAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP++KP+M LA+ LG F GQ++   I  + + ++G  A +N   + +A LAG++R    
Sbjct: 320 EAPILKPYMKLAELLGSFCGQMVDGPIDAVSLEFEGHAAKLNAEPIKAAALAGLLRPQVD 379

Query: 181 GANIISAPIIIKENAIILSTIKRDK 205
             N+++AP +  +  I +S  + D+
Sbjct: 380 SVNMVNAPTMAHQRGIEVSVTRHDR 404


>gi|296445352|ref|ZP_06887310.1| D-3-phosphoglycerate dehydrogenase [Methylosinus trichosporium
           OB3b]
 gi|296257113|gb|EFH04182.1| D-3-phosphoglycerate dehydrogenase [Methylosinus trichosporium
           OB3b]
          Length = 528

 Score =  199 bits (505), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 101/207 (48%), Positives = 143/207 (69%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT +T++ILN E++++ K G  I+NCARGGLVDE ALA  L +GHVA A  DVFE+
Sbjct: 203 LHTPLTARTRHILNAESIARMKRGARIVNCARGGLVDEAALAAALDAGHVAGAALDVFEI 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPLF   NV C P+LGASTVE+QEKVA+Q+A +++D+L  G + +A+N   ++ E
Sbjct: 263 EPAGDNPLFARENVVCTPHLGASTVEAQEKVALQIAQRIADFLTRGEIVDAVNFPSVNAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP + P++ LA+ LG F+GQ    S + + IIY+G+ A  N   L +A LAG++R    
Sbjct: 323 EAPRLAPYIALAERLGAFVGQTARGSFEHVSIIYEGAAAARNVKALTAAALAGLLRPILS 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N++SAP+I KE  +++  + R  SG
Sbjct: 383 ETNMVSAPVIAKERGVVVDEVTRSASG 409


>gi|144897885|emb|CAM74749.1| D-3-phosphoglycerate dehydrogenase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 525

 Score =  198 bits (503), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 139/207 (67%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT  T+N++  ++++  K GV IINCARGGL++E  L   + SG VA A  DV++ 
Sbjct: 200 LHTPLTEATRNLICTDSIALMKDGVRIINCARGGLINEADLRAAIVSGKVAGAALDVYQT 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +N LFGL  V C P+LGAST E+QE  A+Q+A QMSD+L+ G+V+NALNM  +S E
Sbjct: 260 EPATENCLFGLEQVVCTPHLGASTAEAQENQALQVAEQMSDFLLSGIVANALNMVPVSAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           +AP +KP+M LA  LG F GQL   +I+ ++I Y+G  A +NT  L + VL  ++R   V
Sbjct: 320 DAPKLKPYMKLAGQLGSFAGQLTEHAIKAVRIEYEGHVAGLNTKPLTAIVLESLLRPMMV 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N+++AP++ K   I +S +  ++ G
Sbjct: 380 SVNMVNAPLVAKARGIEVSEVTCERKG 406


>gi|217977556|ref|YP_002361703.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
 gi|217502932|gb|ACK50341.1| D-3-phosphoglycerate dehydrogenase [Methylocella silvestris BL2]
          Length = 528

 Score =  197 bits (502), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 95/203 (46%), Positives = 134/203 (66%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH P+T +TKNIL+ ENL++TK GV IIN  R  L+DE AL  LL+SGH+A A  D+ E 
Sbjct: 203 LHTPVTPQTKNILSAENLARTKPGVMIINSCRAALIDEEALLALLESGHIAAAAMDILEK 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           E    +PLF  PN+   P+LGAST E+QE VA Q+A QMSDYL    +SNA+N   I+ E
Sbjct: 263 EQPSGHPLFSHPNMIVTPHLGASTKEAQENVAAQIAEQMSDYLTRDAISNAVNFPSITAE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           EAP +KPF+ LAD LG F GQLI  +I ++ I Y+G  A +    L+++++A ++R    
Sbjct: 323 EAPKLKPFIALADRLGSFAGQLIESNIVKVSITYEGEVADLKIKALSASMIAALLRPLLA 382

Query: 181 GANIISAPIIIKENAIILSTIKR 203
             N++SAP + +E  +++  + R
Sbjct: 383 DVNVVSAPTVARELGVVIDEVTR 405


>gi|262276980|ref|ZP_06054773.1| phosphoglycerate dehydrogenase [alpha proteobacterium HIMB114]
 gi|262224083|gb|EEY74542.1| phosphoglycerate dehydrogenase [alpha proteobacterium HIMB114]
          Length = 526

 Score =  186 bits (471), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 136/206 (66%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTKNI+NK++    K G+ I+NCARGGL+DE AL E L+ GHVA A  DVF  
Sbjct: 200 LHTPLTEKTKNIINKDSFKLMKKGIRIVNCARGGLIDEEALKENLEGGHVASAALDVFIN 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL G  N+   P+LGAST E+QEKVA+Q+A Q+SDYL  G ++NA+N   ++ +
Sbjct: 260 EPPKDSPLLGTKNLIMTPHLGASTTEAQEKVALQVAEQISDYLKTGAITNAVNTFSLTAK 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   V+P++ L++ LG F GQL   +I+ I+I ++G  + +NT  L   ++  +++    
Sbjct: 320 EYNSVQPYLKLSEQLGGFAGQLTENAIKRIEIEFEGQVSQINTQPLMQTMICALLKSNFD 379

Query: 181 GANIISAPIIIKENAIILSTIKRDKS 206
           G N+I++ ++ K  +I +S  K +K+
Sbjct: 380 GVNVINSILVAKNKSIQISETKHEKA 405


>gi|330813822|ref|YP_004358061.1| D-3-phosphoglycerate dehydrogenase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486917|gb|AEA81322.1| D-3-phosphoglycerate dehydrogenase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 527

 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 133/205 (64%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTKNI+ KE+ SK K GV I+NCARGGLVDE+AL E L+SG VA A  DVF  
Sbjct: 200 LHTPLTEKTKNIIGKESFSKMKKGVRIVNCARGGLVDEDALKENLESGQVASAALDVFVN 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   + L G  N+   P+LGAST E+QEKVA+Q+A Q+SDYL  G + NA+N   ++ +
Sbjct: 260 EPPKDSSLLGTKNLILTPHLGASTTEAQEKVALQIAEQISDYLKTGAIMNAVNTFSLTAK 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   VKP+++L   LG F GQL   +I+ IQ+ ++G  + +NT  L   ++  +++    
Sbjct: 320 EYTSVKPYLSLCSQLGGFAGQLTENAIKSIQVEFEGQASEINTQPLLQTIIYSLLKPTMD 379

Query: 181 GANIISAPIIIKENAIILSTIKRDK 205
             N+I++ ++ K  +I +S +K  K
Sbjct: 380 NINVINSILVAKSKSIEISEVKHQK 404


>gi|206890990|ref|YP_002248773.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742928|gb|ACI21985.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 529

 Score =  178 bits (452), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 135/209 (64%), Gaps = 2/209 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++TK ++NK  + K K GV IINCARGG+V+E  L + +QSG VA A  DVFE 
Sbjct: 199 IHTPLTSETKYLINKNTIEKMKKGVYIINCARGGIVNEKDLYDAIQSGKVAGAALDVFEK 258

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  +   L     V C P+LGAST+E+QE VA+ +A Q+ DYLI+G + NA+N   I F
Sbjct: 259 EPPEEGYALITDERVICTPHLGASTLEAQENVAVAIAEQVVDYLINGTIRNAVNFPSIPF 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           ++ PL++P++ L + +G F+ Q+ ++SI+++QI Y G  + +NT  L +A L GI+  + 
Sbjct: 319 DQVPLIRPYLVLLERMGSFVSQIFTKSIKQVQIEYLGEISNLNTQALTAAALKGILDPIL 378

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKSG 207
               N ++A  I KE  I +  IK  ++G
Sbjct: 379 GEPVNYVNASFIAKERGIEVREIKGKEAG 407


>gi|218509868|ref|ZP_03507746.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli Brasil 5]
          Length = 254

 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 81/133 (60%), Positives = 104/133 (78%)

Query: 76  CAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHL 135
           C P+LGAST E+QE VA+Q+A QMSDYL+ G VSNA+NM  I+ EEAP++KPF+ LAD L
Sbjct: 1   CTPHLGASTTEAQENVALQVAEQMSDYLVKGAVSNAINMPSITAEEAPILKPFIRLADVL 60

Query: 136 GCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRVGANIISAPIIIKENA 195
           G F+GQ+  E I+EI+I+YDG TA MNT  L SAVLAG++R      N++SAPI+IKE  
Sbjct: 61  GAFVGQVTEEPIKEIEILYDGITANMNTRALTSAVLAGLIRSQVADVNMVSAPIMIKEKG 120

Query: 196 IILSTIKRDKSGV 208
           I+LS +KRDK+GV
Sbjct: 121 IVLSEVKRDKTGV 133


>gi|260891940|ref|YP_003238037.1| D-3-phosphoglycerate dehydrogenase [Ammonifex degensii KC4]
 gi|260864081|gb|ACX51187.1| D-3-phosphoglycerate dehydrogenase [Ammonifex degensii KC4]
          Length = 527

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 88/207 (42%), Positives = 132/207 (63%), Gaps = 1/207 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PL+ +T +++++E   K K GV +INCARGG+VDE AL E L+ G VA A  DVFE 
Sbjct: 201 IHIPLSKETYHLIDREAFVKMKPGVRLINCARGGIVDEEALYEALKEGKVAGAALDVFEK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LPNV   P+LGASTVE+Q  VA  +A ++   L  G V +A+N+  +  E
Sbjct: 261 EPVTSHPLFSLPNVVVTPHLGASTVEAQLAVAEVIAQEVLTALRGGFVRHAVNLPYLRPE 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV-WR 179
             P+V PF+ LA+ LG F  QL+S  I ++++ Y G  A  +T +LN+AVL G++ V  +
Sbjct: 321 VLPVVGPFLPLAEKLGLFAAQLVSGRINQVEVNYSGEIARYDTSLLNTAVLKGVLSVALQ 380

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
              N ++AP + K+  I +   K+++ 
Sbjct: 381 DTINYVNAPEVAKQRGIKVKETKQERE 407


>gi|218679036|ref|ZP_03526933.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli CIAT 894]
          Length = 231

 Score =  171 bits (432), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 104/133 (78%)

Query: 76  CAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHL 135
           C P+LGAST E+QE VA+Q+A QM+DYL+ G VSNA+NM  I+ EEAP++KPF+ LAD L
Sbjct: 2   CTPHLGASTTEAQENVALQVAEQMADYLVKGAVSNAINMPSITAEEAPILKPFIRLADVL 61

Query: 136 GCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRVGANIISAPIIIKENA 195
           G F+GQ+  E I+EI+I+YDG TA MNT  L SAVLAG++R      N++SAPI+IKE  
Sbjct: 62  GAFVGQVTEEPIKEIEILYDGITANMNTRALTSAVLAGLIRPQVADVNMVSAPIMIKEKG 121

Query: 196 IILSTIKRDKSGV 208
           I+LS +KRDK+GV
Sbjct: 122 IVLSEVKRDKTGV 134


>gi|116750521|ref|YP_847208.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116699585|gb|ABK18773.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 525

 Score =  167 bits (423), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 89/208 (42%), Positives = 130/208 (62%), Gaps = 3/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH P T++T  ILN+E L++TK GV I+NCARGGL+DE AL E L +GHV  A  DVFE 
Sbjct: 200 LHTPSTSETVRILNRETLARTKPGVRILNCARGGLIDEQALYEFLLNGHVGGAALDVFEQ 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + +PL  L NV   P+LGAS+ ++Q  VA  +A Q+ DYL+ G++ NA+N   I  +
Sbjct: 260 EPPVDSPLLKLENVIFTPHLGASSYQAQANVARAIATQIVDYLLYGIIRNAVNFPSIRPQ 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGST-AVMNTMVLNSAVLAGIVR-VW 178
           +   +KP++ LA+ LG   GQ +S  IQ ++I Y GS    +    L   V+ G++  + 
Sbjct: 320 DYEKIKPYLVLAERLGSLQGQ-VSTPIQRLEITYSGSDLQELPLQPLTHTVIKGLLDPIL 378

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
               N+++AP+++KE  I L T  R +S
Sbjct: 379 AEKVNLVNAPLLLKERQIELITTTRSES 406


>gi|114775665|ref|ZP_01451233.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Mariprofundus ferrooxydans PV-1]
 gi|114553776|gb|EAU56157.1| Phosphoglycerate dehydrogenase and related dehydrogenase
           [Mariprofundus ferrooxydans PV-1]
          Length = 529

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/206 (39%), Positives = 130/206 (63%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPL   T+N+++ + L+    G  ++NCARGG++DE AL +  +SGH+  A  DV+E 
Sbjct: 201 IHVPLLPATRNLIDADILAAMTPGSIVVNCARGGIIDEKALYDACKSGHLRAAALDVYEQ 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA +NPLF L NV   P++GAST E+QE VA+Q+A QMS YL+ GVV+NA+N+  +S E
Sbjct: 261 EPARENPLFELDNVSFTPHIGASTDEAQENVAVQIAEQMSAYLLTGVVTNAVNVPSLSVE 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E  L+ P++ LA+ +G F+GQ +      + +  +G  A +N   L +A+L G++     
Sbjct: 321 EQRLLAPYLLLAERMGSFLGQTMRPGYSRMTVHLEGHAASINRKPLINAMLQGLLSQSME 380

Query: 181 GANIISAPIIIKENAIILSTIKRDKS 206
             N ++A ++ +E  I L    R+ +
Sbjct: 381 EVNAVNAGMLARERGIELVESARENA 406


>gi|124514290|gb|EAY55804.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum rubarum]
          Length = 535

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 88/209 (42%), Positives = 131/209 (62%), Gaps = 2/209 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T  ++NK++++K K GV IINCARGG+VDEN LAE LQSGHVA A  DVF  
Sbjct: 203 VHTPLTPETTGLINKQSIAKMKKGVYIINCARGGIVDENDLAEALQSGHVAGAASDVFVQ 262

Query: 61  EPA-LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    +PL  L N    P++GA+T E+QE VA+ +A QM DYL  G++  A N+  +  
Sbjct: 263 EPPPADHPLLKLDNFISTPHIGAATKEAQENVALAIADQMVDYLGKGIIRFAANLPSVPP 322

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           +E  L+ P++ LA+ +G  + Q+ISE I+++ + Y G  A ++T  L  + L GI+  + 
Sbjct: 323 DELALLNPYLKLAEIMGAVMAQVISEPIRKVTLEYGGEVANLSTPSLTISALKGILTPIL 382

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKSG 207
               N ++API+ KE  I +  ++    G
Sbjct: 383 ASRVNEVNAPILAKERGIEVVEVRSSHHG 411


>gi|206602883|gb|EDZ39364.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum sp. Group II
           '5-way CG']
          Length = 535

 Score =  164 bits (415), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 131/209 (62%), Gaps = 2/209 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T  ++NK++++K K GV +INCARGG++DEN LAE LQSGHVA A  DVF  
Sbjct: 203 VHTPLTPETTGLINKQSIAKMKKGVYVINCARGGIIDENDLAEALQSGHVAGAASDVFVQ 262

Query: 61  EPA-LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    +PL  L N    P++GA+T E+QE VA+ +A QM DYL  G++  A N+  +  
Sbjct: 263 EPPPADHPLLKLDNFISTPHIGAATKEAQENVALAIADQMVDYLGKGIIRFAANLPSVPP 322

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           +E  L+ P++ LA+ +G  + Q+ISE I+++ + Y G  A ++T  L  A L GI+  + 
Sbjct: 323 DELALLNPYLKLAEIMGAVMAQVISEPIRKVTLEYGGEVANLSTPSLTIAALKGILTPIL 382

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKSG 207
               N ++API+ KE  I +  ++    G
Sbjct: 383 ASRVNEVNAPILAKERGIEVVEVRSSHHG 411


>gi|225873973|ref|YP_002755432.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium capsulatum ATCC
           51196]
 gi|225792519|gb|ACO32609.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium capsulatum ATCC
           51196]
          Length = 525

 Score =  164 bits (414), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 127/206 (61%), Gaps = 1/206 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHV LT +T  I+N+  L+  K GV IINCARG L+ E ALA+ L+SG V  A  DVF  
Sbjct: 198 LHVGLTPQTHGIINETTLATMKKGVRIINCARGELIVEAALADALKSGQVGGAALDVFVT 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++P FGL NV   P++  ST E+QE V IQ+A QM +YL  GVV NA+N+  ++ E
Sbjct: 258 EPPKESPFFGLDNVILTPHIAGSTAEAQEAVGIQIAKQMREYLKLGVVQNAVNLPSLTHE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   + P+MTL + LG F+GQ  + SI+ I+I Y+G  A   T ++ +A +AG++     
Sbjct: 318 EYLELSPYMTLGEKLGAFLGQFSTGSIESIEISYNGRIAEGKTDLIRNAAIAGVLG-HSE 376

Query: 181 GANIISAPIIIKENAIILSTIKRDKS 206
             N I+A  + +E  I L   K++ +
Sbjct: 377 QVNRINAASVAEERGIRLHEQKKENA 402


>gi|94967146|ref|YP_589194.1| D-3-phosphoglycerate dehydrogenase [Candidatus Koribacter
           versatilis Ellin345]
 gi|94549196|gb|ABF39120.1| D-3-phosphoglycerate dehydrogenase [Candidatus Koribacter
           versatilis Ellin345]
          Length = 531

 Score =  162 bits (411), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/176 (44%), Positives = 113/176 (64%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHV LT +T N++N   L+  K GV I+NCARG L+D+ ALAE ++SGHV  A  DVF  
Sbjct: 201 LHVGLTPQTANMINATTLATMKKGVRIVNCARGELIDDAALAEAVKSGHVGGAALDVFTE 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +P  G+PNV   P++G ST E+Q+ V +Q+AHQ+ DYL  GVV NA+NM  ++ +
Sbjct: 261 EPLKASPYHGVPNVILTPHIGGSTAEAQDAVGVQIAHQVRDYLQRGVVQNAVNMPSLTEQ 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR 176
           E   ++PF+TL + LG  + QL     +EI I Y G  A   T ++ +A + GI++
Sbjct: 321 EYVALEPFITLGERLGSLLAQLAESRFEEIGIRYTGPLADWKTELIRNASIKGILQ 376


>gi|212638896|ref|YP_002315416.1| D-3-phosphoglycerate dehydrogenase [Anoxybacillus flavithermus WK1]
 gi|212560376|gb|ACJ33431.1| Phosphoglycerate dehydrogenase [Anoxybacillus flavithermus WK1]
          Length = 549

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 126/201 (62%), Gaps = 3/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +L ++NL+KTK GV +INCARGG++DE AL   L++GHVA    DVFE 
Sbjct: 198 VHTPLTKETKGLLGQKNLAKTKKGVYLINCARGGIIDEQALIPFLENGHVAGVALDVFEQ 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL    NV   P+LGASTVE+Q  VA Q+A ++  +L    V++++N+  +S +
Sbjct: 258 EPPGDHPLLSFDNVVVTPHLGASTVEAQVNVATQVAEEVLTFLQGKPVTSSINLPTLSKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++ F TLA  +G    Q +SE +QEI I Y GS A + T  +  ++LAG ++  RV
Sbjct: 318 VYEKIQAFYTLARKMGILASQYMSEPVQEIAITYSGSVADLETTFITRSLLAGFLK-PRV 376

Query: 181 GA--NIISAPIIIKENAIILS 199
            +  N ++A +I KE  I  S
Sbjct: 377 ASTVNEVNAAMIAKERGIAFS 397


>gi|78044181|ref|YP_361480.1| D-3-phosphoglycerate dehydrogenase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996296|gb|ABB15195.1| D-3-phosphoglycerate dehydrogenase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 525

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 83/199 (41%), Positives = 124/199 (62%), Gaps = 5/199 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PL N+T+N++N+E L   K    IINCARGG++DE AL E L++G +A A  DVF  
Sbjct: 199 MHLPLNNETRNLINRERLKLMKKSAFIINCARGGIIDEEALYEALKAGEIAGAALDVFSK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PLF LPNV   P+LGAST E+Q  VAI +A +++  L  G+  NA+N   +  E
Sbjct: 259 EPLTESPLFELPNVIVTPHLGASTKEAQINVAIDVAREIASVLKGGLAQNAVNFPAMDKE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR---V 177
               +KP++ LA+ LG F+ Q++S  +   +I+Y+GS     T  L  A L G++    +
Sbjct: 319 SYQRLKPYINLAEKLGNFLAQILSGGLLAAEIVYNGSAFKEETRPLTLAALKGLLDPLLM 378

Query: 178 WRVGANIISAPIIIKENAI 196
            RV  N ++AP++ KE  I
Sbjct: 379 ERV--NYVNAPVVAKERGI 395


>gi|198283146|ref|YP_002219467.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667460|ref|YP_002425374.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|198247667|gb|ACH83260.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218519673|gb|ACK80259.1| D-3-phosphoglycerate dehydrogenase [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 527

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 89/208 (42%), Positives = 129/208 (62%), Gaps = 2/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT+ T+N+   E  +K K G  ++N ARG +VDE AL + L+SGH+  A  DVF  
Sbjct: 200 VHTPLTDATRNLFRAETFAKMKPGAILVNAARGCIVDEAALYDALKSGHLRAAALDVFCK 259

Query: 61  EPAL-QNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    NPL  L N  C P+LGAST E+Q  VAIQ+A Q+S YL+ GVV NA+N+  +  
Sbjct: 260 EPVHGDNPLLELDNFICTPHLGASTEEAQVNVAIQVAEQISAYLLRGVVQNAVNLPSVKE 319

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           EE  L++P++ L + LG  +GQL    ++E+ I Y G  A +NT  L +A+L GI++   
Sbjct: 320 EELLLLQPYLNLGERLGLVLGQLAGSGLREVVIEYAGEVAELNTAALTTAILKGILQSAL 379

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
               N ++AP++ KE  I + T KR+ +
Sbjct: 380 PETINAVNAPVLAKERGIGIETRKRESA 407


>gi|302038732|ref|YP_003799054.1| d-3-phosphoglycerate dehydrogenase [Candidatus Nitrospira defluvii]
 gi|300606796|emb|CBK43129.1| D-3-phosphoglycerate dehydrogenase [Candidatus Nitrospira defluvii]
          Length = 530

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 126/209 (60%), Gaps = 2/209 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK ++N + ++K K+GV I NCARGG+V E  L E L+S  VA A FDVFE 
Sbjct: 199 VHTPLTPETKALINAQAIAKMKTGVMIANCARGGIVHEGDLCEALKSKKVAAAAFDVFED 258

Query: 61  EPAL-QNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    NPL  L N  C+P++GAST E+QE VAI +A Q+ +Y   G+   A+N+  +S 
Sbjct: 259 EPVKPDNPLLALDNFICSPHIGASTTEAQENVAIGIAEQIVEYFTKGIARGAVNIPSVSP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           E  P ++P+++L + +G    QL+   ++ + + Y G  A +N   L  AVL G++  + 
Sbjct: 319 ELLPKLQPYLSLGERVGLLQAQLLEGGLERLTVEYSGEVAGLNVAPLTIAVLKGLLTPIL 378

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKSG 207
               N ++AP++ KE  I +  +K   +G
Sbjct: 379 EDPVNYVNAPVVAKERGIEVKEVKISDAG 407


>gi|196233471|ref|ZP_03132314.1| D-3-phosphoglycerate dehydrogenase [Chthoniobacter flavus Ellin428]
 gi|196222467|gb|EDY16994.1| D-3-phosphoglycerate dehydrogenase [Chthoniobacter flavus Ellin428]
          Length = 530

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 114/177 (64%), Gaps = 1/177 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT +TK +LN E L+KTK GV I+NCARGGL+DE AL E L+S  VA A  DVFE 
Sbjct: 204 LHMPLTAETKYMLNAERLAKTKKGVRIVNCARGGLIDEAALVEALKSKQVAAAALDVFEA 263

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP   ++PL GLPN+   P+LGAST E+QE V I++A Q+   L+ G + NA+NM  I  
Sbjct: 264 EPLPAESPLRGLPNLILTPHLGASTAEAQEGVGIEVAEQIRAALLSGEIRNAVNMPSIDA 323

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR 176
           +   +V P + L + LG F+ Q+ ++ ++ + I Y G     +T  +  ++LA  +R
Sbjct: 324 KTLAVVGPHIALGEKLGHFLSQIAAKRVESLNINYSGKINEADTTPVTRSILASFLR 380


>gi|31790358|gb|AAP58615.1| putative D-3-phosphoglycerate dehydrogenase [uncultured
           Acidobacteria bacterium]
          Length = 561

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 125/201 (62%), Gaps = 1/201 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVF-E 59
           +H PLT +T+ ++ +E  +K K G  IINCARGGLVDE AL + ++SG VA A  DVF E
Sbjct: 230 VHTPLTAETRGVIGREAFAKMKPGARIINCARGGLVDEGALYDAIKSGTVAGAALDVFVE 289

Query: 60  VEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
             PA  +PL  L  V   P+LGAST E+QE VA  +A QM DYL+ G +  A+N+  +  
Sbjct: 290 EPPAKDHPLLLLDEVIATPHLGASTAEAQEGVAFTVAEQMRDYLLTGALRGAVNVPSLGT 349

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           +E  +++P++ LA+ LG F  QL+  +++E+++ + G    +N   +  + LAG++R   
Sbjct: 350 KELAVLRPYIELAEKLGHFQAQLVDSAVREVKLEFAGEIVELNAAPVTRSFLAGLLRDVS 409

Query: 180 VGANIISAPIIIKENAIILST 200
              N I+A +I +E  I ++T
Sbjct: 410 ARVNAINAFLIAEERGINVTT 430


>gi|226312009|ref|YP_002771903.1| D-3-phosphoglycerate dehydrogenase [Brevibacillus brevis NBRC
           100599]
 gi|226094957|dbj|BAH43399.1| D-3-phosphoglycerate dehydrogenase [Brevibacillus brevis NBRC
           100599]
          Length = 527

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 123/204 (60%), Gaps = 3/204 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T +I++    +K K GV +INCARGG++DE AL E + +G VA A  DVFE 
Sbjct: 201 VHTPLTKETHHIISTREFAKMKDGVRLINCARGGIIDEKALYEAITTGKVAGAALDVFEE 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + NPL GLP V   P+LGAST+E+QE VA+ ++ ++   L +    NA+N+  I   
Sbjct: 261 EPPVDNPLVGLPQVVTTPHLGASTIEAQENVAVDVSEEILKVLRNEPFKNAVNLPSIPAH 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               V+P+ TL + LG F+ Q+   SI EI I Y G    ++T  L   VL G++  +R+
Sbjct: 321 VMEKVQPYFTLGEKLGHFLAQVTVGSISEISIKYSGELTDVDTSPLTRTVLKGVLS-FRL 379

Query: 181 G--ANIISAPIIIKENAIILSTIK 202
           G   N ++API+ K   I ++  K
Sbjct: 380 GEEVNYVNAPILAKVRDITVTEQK 403


>gi|328952982|ref|YP_004370316.1| D-3-phosphoglycerate dehydrogenase [Desulfobacca acetoxidans DSM
           11109]
 gi|328453306|gb|AEB09135.1| D-3-phosphoglycerate dehydrogenase [Desulfobacca acetoxidans DSM
           11109]
          Length = 526

 Score =  157 bits (397), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 89/203 (43%), Positives = 126/203 (62%), Gaps = 1/203 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH P T  T +I+++E   K K GV +INCARGGL+DE AL E L+ G VA A  DVFE 
Sbjct: 200 LHTPKTKDTAHIISREAFRKMKRGVMLINCARGGLIDEEALKEALEEGIVAGAALDVFEQ 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + +PL  + NV C P+LGAST E+QE VA+ +A QM DYL++G V NA+N   +S E
Sbjct: 260 EPPVGSPLLLMGNVVCTPHLGASTEEAQENVAVAIAEQMVDYLLNGTVKNAVNAPSVSGE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               ++P++TLA+ LG F  Q+    I  + I Y G  + ++T  L  +++ G++  V R
Sbjct: 320 VLNQLRPYLTLAEALGAFQAQIAEGPIDSVNIEYIGEISKLDTTPLMHSIMKGLLYPVMR 379

Query: 180 VGANIISAPIIIKENAIILSTIK 202
              N ++AP I K+  I L+  K
Sbjct: 380 DEVNYVNAPAIAKDRGIHLTETK 402


>gi|239827548|ref|YP_002950172.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. WCH70]
 gi|239807841|gb|ACS24906.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. WCH70]
          Length = 525

 Score =  157 bits (397), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 124/198 (62%), Gaps = 3/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +L ++NL+KTK GV +INCARGG++DE AL   LQSGHVA    DVFE 
Sbjct: 198 VHTPLTKETKGLLGEKNLAKTKKGVYLINCARGGIIDEQALIPFLQSGHVAGVALDVFEQ 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF   NV   P+LGAST+E+Q  VA Q+A ++  +L    V++++N+  +S +
Sbjct: 258 EPPGDHPLFAFDNVIVTPHLGASTIEAQLNVATQVAEEILHFLEGKPVTSSINLPTLSKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++ F  LA  +G    Q ++  +QE+ + Y G+ A + T  +  ++LAG +R  RV
Sbjct: 318 VYEKIQAFYNLAKKMGTIASQYMNIPVQELSVTYAGTVADLETTYITRSLLAGFLR-PRV 376

Query: 181 GA--NIISAPIIIKENAI 196
            +  N ++A +I KE  I
Sbjct: 377 ASTVNEVNAAMIAKERGI 394


>gi|285808609|gb|ADC36128.1| putative D-3-phosphoglycerate dehydrogenase [uncultured bacterium
           253]
          Length = 533

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 126/201 (62%), Gaps = 1/201 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ I+  +  +K K GV +INCARGGLVDE AL + ++SG VA A  DVF  
Sbjct: 202 VHTPLTAETRGIVGIDAFAKMKPGVRVINCARGGLVDEAALYDAIKSGIVAGAALDVFVA 261

Query: 61  EPAL-QNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    +PL  L  V   P+LGAST E+QE VA  +A QM DYL+ G +  A+N+  +  
Sbjct: 262 EPPPGDHPLLSLDEVIVTPHLGASTTEAQEGVAFTVAEQMRDYLLTGALRGAVNVPALGT 321

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           +E  L++P++ LA+ LG F  QL++ +++E++I + G  A  +   +  + LAG++R   
Sbjct: 322 KELGLLRPYIELAEKLGRFHAQLLASAVREVRIEFAGEIANADGAPVTRSFLAGLLRDVS 381

Query: 180 VGANIISAPIIIKENAIILST 200
              NI++A +I +E  I ++T
Sbjct: 382 ARVNIVNAFLIAEERGIKVTT 402


>gi|117924723|ref|YP_865340.1| D-3-phosphoglycerate dehydrogenase [Magnetococcus sp. MC-1]
 gi|117608479|gb|ABK43934.1| D-3-phosphoglycerate dehydrogenase [Magnetococcus sp. MC-1]
          Length = 527

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 127/197 (64%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL + T+N+++ + +++ K GV ++NCARGG+ +E+AL + L SG +  AG DV+  
Sbjct: 201 VHTPLNDHTRNLVDAKVVAQMKEGVILVNCARGGIYNEDALYDGLVSGKIYAAGLDVYVQ 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  + LF L NV   P+LG ST E+Q +VAIQ+A Q+SDYL+ GVV NALN+  ++  
Sbjct: 261 EPAYSHKLFELDNVVATPHLGGSTKEAQTRVAIQIAEQISDYLVSGVVKNALNIPSVTEA 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E P ++P++ L + LG  +GQ++   + ++++IY G  A +    + +A+L   +     
Sbjct: 321 ELPTLRPYLALVEKLGTTLGQIVETGVLKLEVIYQGEVARIKRAPITTALLKSFLSPMMD 380

Query: 181 G-ANIISAPIIIKENAI 196
           G  N+++A ++ ++  I
Sbjct: 381 GVVNMVNANLVAEQRGI 397


>gi|296109202|ref|YP_003616151.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus infernus ME]
 gi|295434016|gb|ADG13187.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus infernus ME]
          Length = 523

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 121/197 (61%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KTKN++ +E + + K G  I+NCARGGL+DE AL E L++  +  A  DVFE 
Sbjct: 199 LHVPLTPKTKNMIGEEQIKRMKEGAIIVNCARGGLIDEKALYEALKNKKIRAAALDVFEE 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL  L N+ C P+LGAST E+Q      +A Q+   +   +  N +NM  +  E
Sbjct: 259 EPPKNNPLLELENLICTPHLGASTEEAQRAAGTIVAEQIKKIVNGELAENIVNMPNLPAE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               +KP+M LA+ LG  + Q++  S++ +++IY G+ +  NT ++N A+L G++  +  
Sbjct: 319 VLGKIKPYMVLAELLGNIVMQVLDGSVKRVEVIYYGNLSKENTDLINRALLKGLLSPILL 378

Query: 180 VGANIISAPIIIKENAI 196
            G N+++API+ K   I
Sbjct: 379 AGVNLVNAPILAKNRGI 395


>gi|52080816|ref|YP_079607.1| D-3-phosphoglycerate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|52786187|ref|YP_092016.1| D-3-phosphoglycerate dehydrogenase [Bacillus licheniformis ATCC
           14580]
 gi|319645226|ref|ZP_07999459.1| SerA protein [Bacillus sp. BT1B_CT2]
 gi|52004027|gb|AAU23969.1| phosphoglycerate dehydrogenase SerA [Bacillus licheniformis ATCC
           14580]
 gi|52348689|gb|AAU41323.1| SerA [Bacillus licheniformis ATCC 14580]
 gi|317393035|gb|EFV73829.1| SerA protein [Bacillus sp. BT1B_CT2]
          Length = 525

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 132/210 (62%), Gaps = 4/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LNKE ++KTK GV ++NCARGG++DE AL E L+SGHVA A  DVFEV
Sbjct: 198 VHTPLTKETKGLLNKETIAKTKKGVRLVNCARGGIIDEAALLEALESGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + + L   P V   P+LGAST E+Q  VA Q++ ++  Y     V +A+N+  ++ +
Sbjct: 258 EPPVDSKLIDHPLVVATPHLGASTKEAQLNVAAQVSEEVLQYAQGNPVMSAINLPAMTKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++P+   A+ +G  + Q ++E +Q++ I Y+GS A + T  +  ++LAG ++  RV
Sbjct: 318 SFEKIQPYHQFANTIGNLVSQCMNEPVQDVAIQYEGSIAKLETSFITKSLLAGFLK-PRV 376

Query: 181 GA--NIISAPIIIKENAIILS-TIKRDKSG 207
            A  N ++A  + KE  I  S  I  ++SG
Sbjct: 377 AATVNEVNAGTVAKERGISFSEKISSNESG 406


>gi|251771412|gb|EES51991.1| D-3-phosphoglycerate dehydrogenase [Leptospirillum
           ferrodiazotrophum]
          Length = 537

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 125/198 (63%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVF-E 59
           +H PLT +T N+++  +++K K GV I+NCARGG+V+E  LA+ L+SGHVA A FDVF E
Sbjct: 205 VHTPLTPETTNLISSASIAKMKKGVYIVNCARGGIVNEADLAKALESGHVAGAAFDVFAE 264

Query: 60  VEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
             P+  NPL  L N    P++GA+T E+QE VA+ +A QM DYL  G++  A N+  +  
Sbjct: 265 EPPSPDNPLLKLDNFISTPHIGAATKEAQENVALAVADQMVDYLAKGIIRYAANLPSVPP 324

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           E+A  V P+  LA+ +G  + Q+ +E+  +I + + G  A + T ++  A L G++  + 
Sbjct: 325 EDAARVTPYQQLAEVMGGILSQIATEAFSKISVEFSGEAATLPTQIITIAALKGVLAPML 384

Query: 179 RVGANIISAPIIIKENAI 196
            V  N ++AP++ KE  +
Sbjct: 385 DVRVNEVNAPLLAKERGL 402


>gi|295398990|ref|ZP_06808972.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294978456|gb|EFG54052.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 524

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 124/198 (62%), Gaps = 3/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +L ++NL+KTK GV +INCARGG++DE AL   LQ+GHVA    DVFE 
Sbjct: 198 VHTPLTKETKGLLGEKNLAKTKKGVYLINCARGGIIDEQALIPFLQNGHVAGVALDVFEQ 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF   NV   P+LGASTVE+Q  VA Q+A ++  +L    V++++N+  +S +
Sbjct: 258 EPPGDHPLFAFDNVIFTPHLGASTVEAQLNVATQVAEEVLQFLEGKPVTSSINLPTLSKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++ F  LA  +G    Q ++  +QE+ + Y G+ A + T  +  ++LAG +R  RV
Sbjct: 318 VYEKIQAFYNLAKKMGTIASQYMNIPVQELSVTYAGTVADLETTYITRSLLAGFLR-PRV 376

Query: 181 GA--NIISAPIIIKENAI 196
            +  N ++A +I KE  I
Sbjct: 377 ASTVNEVNAAMIAKERGI 394


>gi|312110403|ref|YP_003988719.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y4.1MC1]
 gi|311215504|gb|ADP74108.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y4.1MC1]
          Length = 524

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 124/198 (62%), Gaps = 3/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +L ++NL+KTK GV +INCARGG++DE AL   LQ+GHVA    DVFE 
Sbjct: 198 VHTPLTKETKGLLGEKNLAKTKKGVYLINCARGGIIDEQALIPFLQNGHVAGVALDVFEQ 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF   NV   P+LGASTVE+Q  VA Q+A ++  +L    V++++N+  +S +
Sbjct: 258 EPPGDHPLFAFDNVIFTPHLGASTVEAQLNVATQVAEEVLQFLEGKPVTSSINLPTLSKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++ F  LA  +G    Q ++  +QE+ + Y G+ A + T  +  ++LAG +R  RV
Sbjct: 318 VYEKIQAFYNLAKKMGTIASQYMNIPVQELSVTYAGTVADLETTYITRSLLAGFLR-PRV 376

Query: 181 GA--NIISAPIIIKENAI 196
            +  N ++A +I KE  I
Sbjct: 377 ASTVNEVNAAMIAKERGI 394


>gi|295706456|ref|YP_003599531.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium DSM 319]
 gi|294804115|gb|ADF41181.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium DSM 319]
          Length = 524

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 79/200 (39%), Positives = 120/200 (60%), Gaps = 3/200 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LN++ L+KTK GV ++NCARGG++DE AL   L+ GHV  A  DVFEV
Sbjct: 198 VHTPLTKETKGLLNRDTLAKTKKGVFLLNCARGGIIDEKALVHYLEIGHVQGAAIDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + NPL     V   P+LGAST E+Q  VA  +AH +  +L    VS+++N+  +S E
Sbjct: 258 EPPIDNPLLHFDQVITTPHLGASTKEAQLNVAEDVAHDVLRFLEGNPVSSSINLPTLSKE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++PF +L   +G  + Q + E +Q I I Y G+   + T  +  ++L+G +   R+
Sbjct: 318 VFEKIQPFTSLTKQMGAVLSQCMREPVQHISISYGGTVTDLETTYITRSLLSGFL-THRI 376

Query: 181 GA--NIISAPIIIKENAIIL 198
            +  N ++A +I KE  I  
Sbjct: 377 DSPVNEVNASMIAKERGITF 396


>gi|296332953|ref|ZP_06875410.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|296149804|gb|EFG90696.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
          Length = 517

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 127/201 (63%), Gaps = 3/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LNKE ++KTK GV +INCARGG++DE AL E L+SGHVA A  DVFEV
Sbjct: 198 VHTPLTKETKGLLNKETIAKTKKGVRLINCARGGIIDEAALLEALESGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L   P V   P+LGAST E+Q  VA Q++ ++  +     V +A+N+  ++ +
Sbjct: 258 EPPVDNKLVDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGLPVMSAINLPAMTKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   +KP+  +A  +G  + Q + E +Q++ I Y+G+ A + T  +  ++L+G ++  RV
Sbjct: 318 EFAKIKPYHQIAGKIGSLVSQCMKEPVQDVAIQYEGTIAKLETSFITKSLLSGFLK-PRV 376

Query: 181 GA--NIISAPIIIKENAIILS 199
            +  N ++A  + KE  I  S
Sbjct: 377 DSTVNEVNAGGVAKERGISFS 397


>gi|305674943|ref|YP_003866615.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|305413187|gb|ADM38306.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 525

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 127/201 (63%), Gaps = 3/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LNKE ++KTK GV +INCARGG++DE AL E L+SGHVA A  DVFEV
Sbjct: 198 VHTPLTKETKGLLNKETIAKTKKGVRLINCARGGIIDEAALLEALESGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L   P V   P+LGAST E+Q  VA Q++ ++  +     V +A+N+  ++ +
Sbjct: 258 EPPVDNKLVDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGLPVMSAINLPAMTKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   +KP+  +A  +G  + Q + E +Q++ I Y+G+ A + T  +  ++L+G ++  RV
Sbjct: 318 EFAKIKPYHQIAGKIGSLVSQCMKEPVQDVAIQYEGTIAKLETSFITKSLLSGFLK-PRV 376

Query: 181 GA--NIISAPIIIKENAIILS 199
            +  N ++A  + KE  I  S
Sbjct: 377 DSTVNEVNAGGVAKERGISFS 397


>gi|171909940|ref|ZP_02925410.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobium spinosum DSM
           4136]
          Length = 534

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 78/174 (44%), Positives = 112/174 (64%), Gaps = 1/174 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT +TK++LN+E + K K GV IINCARGGLVD+NALA+LL+ GHVA A  DV+EV
Sbjct: 205 MHMPLTPETKHMLNEERMRKIKKGVRIINCARGGLVDDNALAKLLEEGHVAGAALDVYEV 264

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP   + PL   PNV   P+LGAST E+QE V I++A Q+   L++G V NA+NM  +  
Sbjct: 265 EPPPADYPLLKAPNVVFTPHLGASTDEAQESVGIEIAEQVKANLLEGTVVNAVNMPNVDP 324

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
                + P +   + LG  I Q+     +++++ Y G    M+T +++  VL G
Sbjct: 325 RTLAAIGPALRFGEILGRLISQIAPARAEKLRVNYSGKLGEMDTTLVSRGVLKG 378


>gi|194016714|ref|ZP_03055327.1| phosphoglycerate dehydrogenase [Bacillus pumilus ATCC 7061]
 gi|194011320|gb|EDW20889.1| phosphoglycerate dehydrogenase [Bacillus pumilus ATCC 7061]
          Length = 524

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 126/201 (62%), Gaps = 3/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ +LNKE ++KTK GV ++NCARGG++DE  L E L+SGHVA A  DVFEV
Sbjct: 198 VHTPLTKETRGLLNKETIAKTKKGVRLVNCARGGIIDERDLLEALESGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL   P V   P+LGAST E+Q  VA Q++ ++  +     V +++N+  ++ +
Sbjct: 258 EPPTDNPLVDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGLPVMSSINLPAMTKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   ++P+   A  LG  + Q + E ++E+ I Y+GS + + T  +  ++L+G ++  RV
Sbjct: 318 EYKKIQPYHQFAGKLGRLVSQSMREPVKEVGISYEGSISKLETSFITKSLLSGFLK-ERV 376

Query: 181 GA--NIISAPIIIKENAIILS 199
            +  N ++A ++ KE  I  S
Sbjct: 377 DSTVNEVNAGMVAKERGISFS 397


>gi|410116|gb|AAA67502.1| phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 419

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 127/201 (63%), Gaps = 3/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LNKE ++KTK GV +INCARGG++DE AL E L++GHVA A  DVFEV
Sbjct: 92  VHTPLTKETKGLLNKETIAKTKKGVRLINCARGGIIDEAALLEALENGHVAGAALDVFEV 151

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L   P V   P+LGAST E+Q  VA Q++ ++  +     V +A+N+  ++ +
Sbjct: 152 EPPVDNKLVDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGLPVMSAINLPAMTKD 211

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   +KP+  +A  +G  + Q + E +Q++ I Y+G+ A + T  +  A+L+G ++  RV
Sbjct: 212 EFAKIKPYHQIAGKIGSLVSQCMKEPVQDVAIQYEGTIAKLETSFITKALLSGFLK-PRV 270

Query: 181 GA--NIISAPIIIKENAIILS 199
            +  N ++A  + KE  I  S
Sbjct: 271 DSTVNEVNAGGVAKERGISFS 291


>gi|221314548|ref|ZP_03596353.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|255767495|ref|NP_390188.2| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|321311779|ref|YP_004204066.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis BSn5]
 gi|251757445|sp|P35136|SERA_BACSU RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|225185123|emb|CAB14239.2| 3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|291484735|dbj|BAI85810.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp. natto
           BEST195]
 gi|320018053|gb|ADV93039.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis BSn5]
          Length = 525

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 127/201 (63%), Gaps = 3/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LNKE ++KTK GV +INCARGG++DE AL E L++GHVA A  DVFEV
Sbjct: 198 VHTPLTKETKGLLNKETIAKTKKGVRLINCARGGIIDEAALLEALENGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L   P V   P+LGAST E+Q  VA Q++ ++  +     V +A+N+  ++ +
Sbjct: 258 EPPVDNKLVDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGLPVMSAINLPAMTKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   +KP+  +A  +G  + Q + E +Q++ I Y+G+ A + T  +  A+L+G ++  RV
Sbjct: 318 EFAKIKPYHQIAGKIGSLVSQCMKEPVQDVAIQYEGTIAKLETSFITKALLSGFLK-PRV 376

Query: 181 GA--NIISAPIIIKENAIILS 199
            +  N ++A  + KE  I  S
Sbjct: 377 DSTVNEVNAGGVAKERGISFS 397


>gi|1146196|gb|AAC83943.1| phosphoglycerate dehydrogenase [Bacillus subtilis subsp. subtilis
           str. 168]
          Length = 525

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 127/201 (63%), Gaps = 3/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LNKE ++KTK GV +INCARGG++DE AL E L++GHVA A  DVFEV
Sbjct: 198 VHTPLTKETKGLLNKETIAKTKKGVRLINCARGGIIDEAALLEALENGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L   P V   P+LGAST E+Q  VA Q++ ++  +     V +A+N+  ++ +
Sbjct: 258 EPPVDNKLVDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGLPVMSAINLPAMTKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   +KP+  +A  +G  + Q + E +Q++ I Y+G+ A + T  +  A+L+G ++  RV
Sbjct: 318 EFAKIKPYHQIAGKIGSLVSQCMKEPVQDVAIQYEGTIAKLETSFITKALLSGFLK-PRV 376

Query: 181 GA--NIISAPIIIKENAIILS 199
            +  N ++A  + KE  I  S
Sbjct: 377 DSTVNEVNAGGVAKERGISFS 397


>gi|221310225|ref|ZP_03592072.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221319470|ref|ZP_03600764.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323746|ref|ZP_03605040.1| D-3-phosphoglycerate dehydrogenase [Bacillus subtilis subsp.
           subtilis str. SMY]
          Length = 525

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 127/201 (63%), Gaps = 3/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LNKE ++KTK GV +INCARGG++DE AL E L++GHVA A  DVFEV
Sbjct: 198 VHTPLTKETKGLLNKETIAKTKKGVRLINCARGGIIDEAALLEALENGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L   P V   P+LGAST E+Q  VA Q++ ++  +     V +A+N+  ++ +
Sbjct: 258 EPPVDNKLVDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGLPVMSAINLPAMTKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   +KP+  +A  +G  + Q + E +Q++ I Y+G+ A + T  +  A+L+G ++  RV
Sbjct: 318 EFAKIKPYHQIAGKIGSLVSQCMKEPVQDVAIQYEGTIAKLETSFITKALLSGFLK-PRV 376

Query: 181 GA--NIISAPIIIKENAIILS 199
            +  N ++A  + KE  I  S
Sbjct: 377 DSTVNEVNAGGVAKERGISFS 397


>gi|157692807|ref|YP_001487269.1| D-3-phosphoglycerate dehydrogenase [Bacillus pumilus SAFR-032]
 gi|157681565|gb|ABV62709.1| phosphoglycerate dehydrogenase [Bacillus pumilus SAFR-032]
          Length = 524

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 126/201 (62%), Gaps = 3/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ +LNKE ++KTK GV ++NCARGG++DE  L E L+SGHVA A  DVFEV
Sbjct: 198 VHTPLTKETRGLLNKETIAKTKKGVRLVNCARGGIIDERDLLEALESGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL   P V   P+LGAST E+Q  VA Q++ ++  +     V +++N+  ++ +
Sbjct: 258 EPPTDNPLVDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGLPVMSSINLPAMTKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   ++P+   A  LG  + Q + E ++E+ I Y+GS + + T  +  ++L+G ++  RV
Sbjct: 318 EFKKIQPYHQFAGKLGRLVSQSMREPVKEVGISYEGSISKLETSFITKSLLSGFLK-ERV 376

Query: 181 GA--NIISAPIIIKENAIILS 199
            +  N ++A ++ KE  I  S
Sbjct: 377 DSTVNEVNAGMVAKERGISFS 397


>gi|297568578|ref|YP_003689922.1| D-3-phosphoglycerate dehydrogenase [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924493|gb|ADH85303.1| D-3-phosphoglycerate dehydrogenase [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 528

 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 81/199 (40%), Positives = 121/199 (60%), Gaps = 3/199 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT +TK++L  E  +  K    +I+CARGG+V+E AL E L++G +  A  DVFEV
Sbjct: 199 VHVPLTPETKHVLGAEQFALMKPEAMLIDCARGGVVEEKALYEALKNGTIRGAALDVFEV 258

Query: 61  EPALQN--PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  +   PL GL N  C P+LGAST E+QE VA+ +A QMS+YL+ G V NA+N+  +S
Sbjct: 259 EPTTKENCPLLGLDNFICTPHLGASTAEAQENVAVAIAEQMSNYLLHGTVVNAVNVPSVS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    V P++ LA+ +G    Q+    ++E+ + + G  A   T  +  A+L G+   +
Sbjct: 319 ADVMAKVGPYVKLAEMIGALHMQIAKGGVEEVVVEFSGDLAQQTTTPITVALLKGLFTPI 378

Query: 178 WRVGANIISAPIIIKENAI 196
            R   N ++AP+I KE  I
Sbjct: 379 LREAVNYVNAPLIAKERGI 397


>gi|308274573|emb|CBX31172.1| D-3-phosphoglycerate dehydrogenase [uncultured Desulfobacterium
           sp.]
          Length = 526

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 86/197 (43%), Positives = 122/197 (61%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVP    T N+LNK+   K K+GV IINCARGG+V+E+ L   ++SG VA A  DVFE 
Sbjct: 200 VHVPKLKDTLNLLNKDAFDKMKNGVMIINCARGGIVNESDLYNAIKSGKVAGAALDVFEK 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L  V C P+LGAST E+Q  VA  +A Q+ DYL +G ++NA+N+  ++ E
Sbjct: 260 EPPGASPLFELDRVICTPHLGASTQEAQVNVATAVAGQIIDYLKNGTIANAVNVPSVTGE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG-IVRVWR 179
               + PF++LAD +G  I QL     +EI I Y G+   ++   +++AVL G +V V +
Sbjct: 320 LLKKIGPFLSLADKMGSLITQLSKGPFKEIVIEYTGNFDGLDMSPVSTAVLRGLLVPVVK 379

Query: 180 VGANIISAPIIIKENAI 196
              N ++A  I KE  I
Sbjct: 380 DDVNFVNANYIAKERGI 396


>gi|299136357|ref|ZP_07029541.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX8]
 gi|298602481|gb|EFI58635.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX8]
          Length = 540

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 128/209 (61%), Gaps = 6/209 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHV LT +T+ ++NK +L+  K G+ I+NCARG L+ + ALAE ++SGHVA A  DVF  
Sbjct: 200 LHVGLTPQTEGLINKTSLAIMKKGIRIVNCARGELIVDEALAEAIKSGHVAGAALDVFRH 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +P F L NV  +P++  ST E+QE + IQLA+Q+ DYL  GVV NA+N+A +S E
Sbjct: 260 EPLKDSPYFELENVLLSPHIAGSTDEAQEAIGIQLANQVRDYLKLGVVQNAVNVASLSEE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISES-----IQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
           E   V P++ +A  LG F+   I  S     I+ I + Y+G  A + T ++ +A ++G++
Sbjct: 320 EYAEVSPYIEMAARLGQFLSHAIGSSETGGNIESIALTYNGRLAQLKTDLIRNAAISGVL 379

Query: 176 RVWRVGANIISAPIIIKENAIILSTIKRD 204
                G N I+A  +  +  I L   KR+
Sbjct: 380 -AGSDGINRINAASVAADRGIRLQEDKRE 407


>gi|325107117|ref|YP_004268185.1| D-3-phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
 gi|324967385|gb|ADY58163.1| D-3-phosphoglycerate dehydrogenase [Planctomyces brasiliensis DSM
           5305]
          Length = 546

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 127/213 (59%), Gaps = 10/213 (4%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++T+ I+N E ++K   GV IINCARGG+VDE ALA+ ++SGHVA A  DVF V
Sbjct: 205 VHTPLTDETRGIINAERIAKMPRGVRIINCARGGIVDEGALADAVESGHVAGAALDVFTV 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L GLP V   P+LGAST E+QE VA++    +S +L    V +A+NMA +S  
Sbjct: 265 EPPKDTRLTGLPGVLTTPHLGASTDEAQELVAVEAGEIISAFLTRNEVRHAVNMAPVSAS 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLI-SESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           E   +K ++ LA  LG  + Q    E I+  +I Y G  A  +T +L S+  AG++    
Sbjct: 325 EMEGMKKYIDLAHRLGLVLSQQTHGEGIRSAEIHYRGDVASKHTRLLTSSFTAGLLS--- 381

Query: 180 VGA-----NIISAPIIIKENAIILSTIKRDKSG 207
            GA     NI++A ++ +E  + +S     K+G
Sbjct: 382 -GALGDRINIVNANLLAEERGVPISEETSKKAG 413


>gi|294501109|ref|YP_003564809.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium QM B1551]
 gi|294351046|gb|ADE71375.1| D-3-phosphoglycerate dehydrogenase [Bacillus megaterium QM B1551]
          Length = 524

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/200 (39%), Positives = 119/200 (59%), Gaps = 3/200 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LN + L+KTK GV ++NCARGG++DE AL   L+ GHV  A  DVFEV
Sbjct: 198 VHTPLTKETKGLLNHDTLAKTKKGVFLLNCARGGIIDEKALVHYLEIGHVQGAAIDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + NPL     V   P+LGAST E+Q  VA  +AH +  +L    VS+++N+  +S E
Sbjct: 258 EPPIDNPLLHFDQVITTPHLGASTKEAQLNVAEDVAHDVLLFLEGNPVSSSINLPTLSKE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++PF +L   +G  + Q + E +Q I I Y G+   + T  +  ++L+G +   R+
Sbjct: 318 VFEKIQPFTSLTKQMGAILSQCMREPVQHISISYGGTVTDLETTYITRSLLSGFL-THRI 376

Query: 181 GA--NIISAPIIIKENAIIL 198
            +  N ++A +I KE  I  
Sbjct: 377 DSPVNEVNASMIAKERGITF 396


>gi|126179793|ref|YP_001047758.1| D-3-phosphoglycerate dehydrogenase [Methanoculleus marisnigri JR1]
 gi|125862587|gb|ABN57776.1| D-3-phosphoglycerate dehydrogenase [Methanoculleus marisnigri JR1]
          Length = 527

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 123/201 (61%), Gaps = 2/201 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T++++N E ++  + GV +INCARGG++DE ALA+ + SG VA A  DVFE 
Sbjct: 200 VHTPLIKETRHVINAETIATMRDGVRLINCARGGIIDEKALADAVASGKVAGAALDVFEN 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL GL  V   P+LGASTVE+Q+ VA+ +A+Q    L  G     +N  +I  E
Sbjct: 260 EPPTDSPLLGLDKVIVTPHLGASTVEAQKNVAVSVANQCISVLSGGSAKYVVNAPMIPAE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVM-NTMVLNSAVLAGIVR-VW 178
           +  LV+P+  LA  +G  + QL+   ++ ++I Y G  A + NT  +   +L G++  + 
Sbjct: 320 QQALVEPYAMLAQKMGSLLIQLVEGRLESLEITYGGEAAGLPNTKFVTRVILKGMLDPIL 379

Query: 179 RVGANIISAPIIIKENAIILS 199
           +V ANI++A  + KE  I +S
Sbjct: 380 QVPANIVNAEFVAKERGIRMS 400


>gi|225165807|ref|ZP_03727591.1| D-3-phosphoglycerate dehydrogenase [Opitutaceae bacterium TAV2]
 gi|224799953|gb|EEG18398.1| D-3-phosphoglycerate dehydrogenase [Opitutaceae bacterium TAV2]
          Length = 529

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 124/206 (60%), Gaps = 6/206 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT+ TK ++++  L+K K GV + NCARGG++ E+AL   L+SGHVA AG DV+E 
Sbjct: 200 VHMPLTDDTKYMIDEAALAKCKKGVRLFNCARGGIIKESALIAALKSGHVAAAGLDVYED 259

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  + L  LPNV   P+LGAST E+QE V I++A Q++D L  G + NA+NM  +  
Sbjct: 260 EPLAKDSELRALPNVVLTPHLGASTAEAQESVGIEIAEQIADVLKTGAIRNAVNMPSVDA 319

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
             A ++ P++ L   LG  + Q+  + I +++++Y G    ++   +  A+  G +R  R
Sbjct: 320 TTAQVLGPYINLGTKLGTLVQQIAPQQIAKVRVMYHGKMVELDANAVTRAIQHGFLR--R 377

Query: 180 VGA---NIISAPIIIKENAIILSTIK 202
           +     N ++API  +   I    IK
Sbjct: 378 ISGDEVNTVNAPIFFQRLGIDFEVIK 403


>gi|149176983|ref|ZP_01855592.1| phosphoglycerate dehydrogenase [Planctomyces maris DSM 8797]
 gi|148844238|gb|EDL58592.1| phosphoglycerate dehydrogenase [Planctomyces maris DSM 8797]
          Length = 541

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 125/209 (59%), Gaps = 1/209 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++T++++N E ++  + GV IINCARGG+V+E+ LA+ L+SG VA A  DVF  
Sbjct: 202 VHTPLTDETRDLINAERIATMRPGVRIINCARGGIVNEDDLADALESGKVAGAACDVFTQ 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L   PN+   P+LGAST E+QE VA++ A  +SD+L    + +A+NM  +S  
Sbjct: 262 EPPENRRLIDAPNMLATPHLGASTDEAQEMVALEAAEIISDFLTKNEIRHAINMIPVSGA 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
           E   +KP + L   LG F+ Q    S++ +QI Y G  A   T ++ S+  AG++   + 
Sbjct: 322 EMADLKPHIELGHRLGLFLSQQTKGSLKSVQIQYRGEVADKQTKLITSSFAAGLLSNAFE 381

Query: 180 VGANIISAPIIIKENAIILSTIKRDKSGV 208
              NI++A +  KE  I +S  K  ++G 
Sbjct: 382 AEINIVNATVFAKERGIEISESKSTEAGT 410


>gi|154686553|ref|YP_001421714.1| D-3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens
           FZB42]
 gi|154352404|gb|ABS74483.1| SerA [Bacillus amyloliquefaciens FZB42]
          Length = 525

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 134/210 (63%), Gaps = 4/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LN+E ++KTK GV +INCARGG++DE AL E L+SGHVA A  DVFEV
Sbjct: 198 VHTPLTKETKGLLNRETIAKTKKGVRLINCARGGIIDEAALLEALESGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP +++ L   P V   P+LGAST E+Q  VA Q++ ++  +     V +A+N+  ++ +
Sbjct: 258 EPPVESKLPDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGLPVMSAINLPAMTKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   ++P+  +AD +G  + Q + E ++++ I Y+G+ A + T  +  ++L+G ++  RV
Sbjct: 318 EFKKIQPYHQIADKIGSLVSQCMKEPVKDVAIQYEGTIAKLETSFITKSLLSGFLK-PRV 376

Query: 181 GA--NIISAPIIIKENAIILS-TIKRDKSG 207
            +  N ++A  + KE  I  S  I  ++SG
Sbjct: 377 DSTVNEVNAGGVAKERGISFSEKISSNESG 406


>gi|88604291|ref|YP_504469.1| D-3-phosphoglycerate dehydrogenase [Methanospirillum hungatei JF-1]
 gi|88189753|gb|ABD42750.1| D-3-phosphoglycerate dehydrogenase [Methanospirillum hungatei JF-1]
          Length = 528

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 128/202 (63%), Gaps = 3/202 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T++I+N+++++  K GV IINCARGG++DE ALA  ++SG VA A  DVFE 
Sbjct: 200 VHTPLIKETRHIINEKSIATMKDGVRIINCARGGIIDEAALAAAVKSGKVAGAAIDVFEE 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL G+PN+   P+LGASTVE+Q+ VAI +A Q  + L  G     +N  II  E
Sbjct: 260 EPPKDSPLIGIPNIIVTPHLGASTVEAQKNVAISIAKQCLEVLGGGDAKYVVNAPIIPSE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVM--NTMVLNSAVLAGIVR-V 177
           +  +++P+ TL + +G  + Q++   +Q++++IY G  A +  +T ++    + G++  +
Sbjct: 320 QHEIIEPYATLGERIGRLMIQIVDGRVQKLEMIYGGDLAALGQSTKLITHMAIKGLLDPI 379

Query: 178 WRVGANIISAPIIIKENAIILS 199
            R   N+++A  I K+  I +S
Sbjct: 380 LRFPVNMVNAAYIAKDRGIAVS 401


>gi|328552773|gb|AEB23265.1| D-3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens
           TA208]
 gi|328912429|gb|AEB64025.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens LL3]
          Length = 525

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 133/210 (63%), Gaps = 4/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LN+E ++KTK GV +INCARGG++DE AL E L+SGHVA A  DVFEV
Sbjct: 198 VHTPLTKETKGLLNRETIAKTKKGVRLINCARGGIIDEAALLEALESGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP +++ L   P V   P+LGAST E+Q  VA Q++ ++  +     V +A+N+  ++ +
Sbjct: 258 EPPVESKLPDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGLPVMSAINLPAMTKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   ++P+  +AD +G  + Q + E ++++ I Y+G+ A   T  +  ++L+G ++  RV
Sbjct: 318 EFKKIQPYHQIADKIGSLVSQCMKEPVKDVAIQYEGTIAKFETSFITKSLLSGFLK-PRV 376

Query: 181 GA--NIISAPIIIKENAIILS-TIKRDKSG 207
            +  N ++A  + KE  I  S  I  ++SG
Sbjct: 377 DSTVNEVNAGGVAKERGISFSEKISSNESG 406


>gi|308174098|ref|YP_003920803.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens DSM 7]
 gi|307606962|emb|CBI43333.1| 3-phosphoglycerate dehydrogenase [Bacillus amyloliquefaciens DSM 7]
          Length = 525

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 133/210 (63%), Gaps = 4/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LN+E ++KTK GV +INCARGG++DE AL E L+SGHVA A  DVFEV
Sbjct: 198 VHTPLTKETKGLLNRETIAKTKKGVRLINCARGGIIDEAALLEALESGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP +++ L   P V   P+LGAST E+Q  VA Q++ ++  +     V +A+N+  ++ +
Sbjct: 258 EPPVESKLPDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGLPVMSAINLPAMTKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   ++P+  +AD +G  + Q + E ++++ I Y+G+ A   T  +  ++L+G ++  RV
Sbjct: 318 EFKKIQPYHQIADKIGSLVSQCMKEPVKDVAIQYEGTIAKFETSFITKSLLSGFLK-PRV 376

Query: 181 GA--NIISAPIIIKENAIILS-TIKRDKSG 207
            +  N ++A  + KE  I  S  I  ++SG
Sbjct: 377 DSTVNEVNAGGVAKERGISFSEKISSNESG 406


>gi|303244898|ref|ZP_07331224.1| D-3-phosphoglycerate dehydrogenase [Methanothermococcus okinawensis
           IH1]
 gi|302484715|gb|EFL47653.1| D-3-phosphoglycerate dehydrogenase [Methanothermococcus okinawensis
           IH1]
          Length = 523

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 118/197 (59%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KTK+I+ KE +S  K    I+NCARGGL+DENAL E L+   +  A  DVFE 
Sbjct: 199 LHVPLTPKTKHIIGKEQISLMKKNAIIVNCARGGLIDENALYEALKDKKIRSAALDVFEQ 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL  L NV   P+ GASTVE+Q+     +A Q+   L      N +N+ ++  E
Sbjct: 259 EPPKNNPLLTLNNVIGTPHQGASTVEAQKSAGTIVAEQVVKILNGEPAENVVNLPMLPME 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           +   +KP+M L++ +G  I QL+ +SI+++++ Y G  A  +T ++  + L GI+  +  
Sbjct: 319 KMSKLKPYMALSEKIGNMIIQLLDKSIEKVELTYMGELAKEDTEMVKRSFLMGILSPILL 378

Query: 180 VGANIISAPIIIKENAI 196
            G N+I+AP I K   I
Sbjct: 379 AGVNLINAPTIAKNRNI 395


>gi|56963608|ref|YP_175339.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
 gi|56909851|dbj|BAD64378.1| D-3-phosphoglycerate dehydrogenase [Bacillus clausii KSM-K16]
          Length = 533

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 81/198 (40%), Positives = 121/198 (61%), Gaps = 3/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT  TK +LN E ++KTK GV +INCARGG++DE AL   L +GHVA A  DVF  
Sbjct: 207 VHTPLTKDTKGLLNMETIAKTKPGVFLINCARGGIIDEQALKHYLNNGHVAGAALDVFTE 266

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA    L G P+V   P++ AST E+Q  VA Q++ ++  +L      N++N+  +  +
Sbjct: 267 EPATDKELIGHPSVVATPHIAASTKEAQLNVAAQVSQEVLQFLNGEPALNSINLPAMPKD 326

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               +KP+  LA  +G  + QL+   +QEI++ Y G+TA  NT VL  ++++G ++  RV
Sbjct: 327 VYEKIKPYYDLARTMGSVLSQLMRIPVQEIEVFYSGTTAEQNTSVLTRSLISGFLQ-PRV 385

Query: 181 GA--NIISAPIIIKENAI 196
            A  N ++A +I KE  I
Sbjct: 386 DAAVNDVNASLIAKERGI 403


>gi|322437164|ref|YP_004219376.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX9]
 gi|321164891|gb|ADW70596.1| D-3-phosphoglycerate dehydrogenase [Acidobacterium sp. MP5ACTX9]
          Length = 570

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 123/206 (59%), Gaps = 2/206 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHV LT +T+ ++N+ +++  KSG+ IINCARG L+ + AL E L+SG VA A  DVF  
Sbjct: 218 LHVGLTTQTEGLINQHSIAIMKSGIRIINCARGELIVDEALVEGLKSGKVAGAALDVFHQ 277

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +P F LPNV  +P++  +T E+QE + IQLA Q+ DYL  GVV NA+N+  +S E
Sbjct: 278 EPLKNSPYFNLPNVLLSPHIAGATDEAQEAIGIQLAMQVRDYLKLGVVQNAVNLPSLSHE 337

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   V P++ +A  LG F+   I   ++ I I Y G  A   T ++ +A +AGI      
Sbjct: 338 EYIEVAPYIEMAARLGRFLSHAIPGHLETISITYTGRIATGKTDLIRNAAVAGIFADTEG 397

Query: 181 G--ANIISAPIIIKENAIILSTIKRD 204
           G   N I+A  I +E  I +   K++
Sbjct: 398 GNSVNRINAAAIAQERGIRIQEDKKE 423


>gi|294056127|ref|YP_003549785.1| D-3-phosphoglycerate dehydrogenase [Coraliomargarita akajimensis
           DSM 45221]
 gi|293615460|gb|ADE55615.1| D-3-phosphoglycerate dehydrogenase [Coraliomargarita akajimensis
           DSM 45221]
          Length = 528

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 83/203 (40%), Positives = 120/203 (59%), Gaps = 1/203 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT  TK++LN +   + K GV + NCARGG++DE AL + L SG VA AG DV+E 
Sbjct: 200 VHMPLTADTKHMLNADAFGRMKDGVRVFNCARGGIIDEAALVDALNSGKVAAAGLDVYED 259

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  +PL GL N+   P+LGAST E+QE V I +A QM + L  G+V NALNM  +  
Sbjct: 260 EPPAEDSPLRGLQNLVLTPHLGASTAEAQENVGIDVAKQMIEALTGGMVINALNMPSVDP 319

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           +    + P++ L + LG F  QL  E +++I I Y G    ++ + L +A+  G +R   
Sbjct: 320 KVLEKLGPYIELGEKLGTFSQQLAPEGVEKITIRYYGKITELDALPLTNAIQRGYLREIS 379

Query: 180 VGANIISAPIIIKENAIILSTIK 202
              N ++AP  I+   I    +K
Sbjct: 380 DNVNNVNAPKKIERLGIETEQVK 402


>gi|153005366|ref|YP_001379691.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. Fw109-5]
 gi|152028939|gb|ABS26707.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. Fw109-5]
          Length = 528

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 123/204 (60%), Gaps = 2/204 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT+KT+++++   L K K G  ++NCARGG+VDE ALA+ L+SG +  AG DVFE 
Sbjct: 201 IHVPLTDKTRHLVDATALGKMKKGALLVNCARGGIVDERALADALRSGQLGGAGLDVFEQ 260

Query: 61  EPA-LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    +PL+GL NV   P++GAST E+Q  VA+ +A Q++DYL+ GVV NA+N   +  
Sbjct: 261 EPPPADHPLYGLENVILTPHIGASTEEAQSAVAVAVAEQLADYLVRGVVRNAVNAPGLPP 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
           E    + P++ LA  LG    QL  +   E+ I   G  A +    L +  L G++  V 
Sbjct: 321 EVMEQLAPYLPLAQKLGALAAQLAPQGPSEVTIEVAGELAAVPIRPLAARTLVGMLGPVL 380

Query: 179 RVGANIISAPIIIKENAIILSTIK 202
               N +SAP I +E  +++  ++
Sbjct: 381 DTPVNEVSAPAIARERGLVVREVR 404


>gi|56420782|ref|YP_148100.1| D-3-phosphoglycerate dehydrogenase [Geobacillus kaustophilus
           HTA426]
 gi|56380624|dbj|BAD76532.1| phosphoglycerate dehydrogenase [Geobacillus kaustophilus HTA426]
          Length = 510

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 120/198 (60%), Gaps = 3/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ +L  ENL+KTK GV +INCARGG++DE AL   L+SGHVA    DVFE 
Sbjct: 184 VHTPLTKETRGLLGTENLAKTKKGVYLINCARGGIIDEQALIPFLESGHVAGVALDVFEQ 243

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL    NV   P+LGASTVE+Q  VA Q+A ++  +     V++++N+  +S +
Sbjct: 244 EPPGDHPLLAFDNVIVTPHLGASTVEAQLNVATQVAEELLHFFEGRPVTSSINLPALSKD 303

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++ F  L   LG    Q ++  +QE+ + Y G+ A + T  +  ++LAG +R  RV
Sbjct: 304 VYEKIQAFYHLGQKLGLIASQFMNIPVQELSVTYAGTVADLETTYITRSLLAGFLR-PRV 362

Query: 181 GA--NIISAPIIIKENAI 196
            +  N ++A ++ KE  I
Sbjct: 363 ASTVNEVNAAMVAKERGI 380


>gi|289193097|ref|YP_003459038.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus sp.
           FS406-22]
 gi|288939547|gb|ADC70302.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus sp.
           FS406-22]
          Length = 524

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 83/210 (39%), Positives = 122/210 (58%), Gaps = 3/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KT++++ KE ++  K    I+NCARGGL+DE AL E L+ G +  A  DVFE 
Sbjct: 200 LHVPLTPKTRHMIGKEQIALMKKNAIIVNCARGGLIDEKALYEALKEGKIRAAALDVFEE 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL  L NV   P+ GAST E+Q+     +A Q+   L   +  N +NM  I  E
Sbjct: 260 EPPKDNPLLTLDNVIGTPHQGASTEEAQKAAGTIVAEQIKKILRGELAENVVNMPNIPQE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           +   +KP+M LA+ LG  + Q++  S+  ++++Y G  A  NT ++  A L G++  +  
Sbjct: 320 KLGKLKPYMLLAEMLGNIVMQVLDGSVSRVELVYSGELAKENTDLIKRAFLKGLLSPILL 379

Query: 180 VGANIISAPIIIKENAI--ILSTIKRDKSG 207
            G N+++APII K   I  + ST   +K G
Sbjct: 380 AGINLVNAPIIAKNRNINVVESTTSEEKYG 409


>gi|261417914|ref|YP_003251596.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC61]
 gi|297529583|ref|YP_003670858.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. C56-T3]
 gi|319767274|ref|YP_004132775.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC52]
 gi|261374371|gb|ACX77114.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC61]
 gi|297252835|gb|ADI26281.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. C56-T3]
 gi|317112140|gb|ADU94632.1| D-3-phosphoglycerate dehydrogenase [Geobacillus sp. Y412MC52]
          Length = 524

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 120/198 (60%), Gaps = 3/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ +L  ENL+KTK GV +INCARGG++DE AL   L+SGHVA    DVFE 
Sbjct: 198 VHTPLTKETRGLLGTENLAKTKKGVYLINCARGGIIDEQALIPFLESGHVAGVALDVFEQ 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL    NV   P+LGASTVE+Q  VA Q+A ++  +     V++++N+  +S +
Sbjct: 258 EPPGDHPLLAFDNVIVTPHLGASTVEAQLNVATQVAEELLHFFEGRPVTSSINLPALSKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++ F  L   LG    Q ++  +QE+ + Y G+ A + T  +  ++LAG +R  RV
Sbjct: 318 VYEKIQAFYHLGRKLGLIASQFMNIPVQELSVTYAGTVADLETTYITRSLLAGFLR-PRV 376

Query: 181 GA--NIISAPIIIKENAI 196
            +  N ++A ++ KE  I
Sbjct: 377 ASTVNEVNAAMVAKERGI 394


>gi|311068824|ref|YP_003973747.1| D-3-phosphoglycerate dehydrogenase [Bacillus atrophaeus 1942]
 gi|310869341|gb|ADP32816.1| D-3-phosphoglycerate dehydrogenase [Bacillus atrophaeus 1942]
          Length = 525

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 81/210 (38%), Positives = 134/210 (63%), Gaps = 4/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LNKE ++KTK GV +INCARGG++DE AL E L++GHVA A  DVFEV
Sbjct: 198 VHTPLTKETKGLLNKETIAKTKKGVRLINCARGGIIDEAALLEALENGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP +++ L   P V   P+LGAST E+Q  VA Q++ ++  +     V +A+N+  ++ +
Sbjct: 258 EPPVESKLPDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAKGLPVMSAINLPAMTKD 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   ++P+  +AD +G  + Q + E ++++ I Y+G+ + + T  +  ++L+G ++  RV
Sbjct: 318 EFKKIQPYHQIADKIGSLVSQCMKEPVKDVAIQYEGTISKLETSFITKSLLSGFLK-PRV 376

Query: 181 GA--NIISAPIIIKENAIILS-TIKRDKSG 207
            +  N ++A  + KE  I  S  I  ++SG
Sbjct: 377 DSTVNEVNAGGVAKERGISFSEKISSNESG 406


>gi|89099089|ref|ZP_01171968.1| phosphoglycerate dehydrogenase [Bacillus sp. NRRL B-14911]
 gi|89086219|gb|EAR65341.1| phosphoglycerate dehydrogenase [Bacillus sp. NRRL B-14911]
          Length = 524

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 120/199 (60%), Gaps = 1/199 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +++ + +  TK GV  +NCARGG+++E  LAE +++GH+A A  DVFE 
Sbjct: 198 VHTPLTPQTKGLIDAKKIELTKKGVYFLNCARGGIINEKDLAEYIRNGHIAGAALDVFEE 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL    NV   P+LGAST E+Q  VA Q+A ++  +L +  VSN++N+  +S E
Sbjct: 258 EPPFDNPLLRFDNVIVTPHLGASTREAQLNVATQVAEEVRLFLENKPVSNSINLPAMSKE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               ++PF  L+  +G  + Q ++E +QEI I Y G+   + T  L  A+L+G  +    
Sbjct: 318 IYDKIQPFHQLSKQIGLILSQCVTEGVQEISITYSGTVTELETSYLTKALLSGFFKNRID 377

Query: 180 VGANIISAPIIIKENAIIL 198
           +  N ++A +  KE  I +
Sbjct: 378 IHVNEVNALLTAKERGITI 396


>gi|158522862|ref|YP_001530732.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
 gi|158511688|gb|ABW68655.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
          Length = 527

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 121/204 (59%), Gaps = 1/204 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVP   KT  +LN +  S+ K G+ IINCARGG++DE AL + LQSG VA A  DVF  
Sbjct: 200 IHVPKMEKTIGLLNADAFSRMKDGIMIINCARGGIIDEAALYDALQSGKVAGAALDVFAK 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PL    NV C P+LGAST E+Q  VA+ +A Q+  YL +G + NA+N   ++ +
Sbjct: 260 EPPGEHPLLTCENVICTPHLGASTQEAQTNVAVDVARQIIAYLKEGTIINAVNTPSVTGD 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               +KP++ L   LG  + Q+    +QE+ I Y G    +    +++A++ G++  + R
Sbjct: 320 RLARLKPYLELGRKLGLLLAQIHRGKLQEVAIEYSGEYHDLELGPISTALINGLLEPLVR 379

Query: 180 VGANIISAPIIIKENAIILSTIKR 203
            G N ++AP I +E  I ++   R
Sbjct: 380 EGVNAVNAPAIAQEMGIKVTETLR 403


>gi|330839849|ref|YP_004414429.1| D-3-phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC
           35185]
 gi|329747613|gb|AEC00970.1| D-3-phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC
           35185]
          Length = 527

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/208 (37%), Positives = 130/208 (62%), Gaps = 2/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PL   TK++L+K+ +++ K GV ++NCARGG+++E  LA+ +++GHVA A  DVF  
Sbjct: 198 VHMPLNPDTKDMLDKKAIARMKKGVRLVNCARGGIINEQDLADAVKAGHVAGAAIDVFTS 257

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  + NPL G+P +   P+LGASTVE+Q  VA+ +A  +   L    V  A+NMA +S 
Sbjct: 258 EPLEEGNPLVGVPGIILTPHLGASTVEAQIGVALDVAEGIRAALSGEPVLTAVNMAPVSA 317

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           +   +++P++ LA+ LGC +  L   +I E+ + Y G    +NT +L + V+ G++  V 
Sbjct: 318 DVMHVIRPYLDLAERLGCTVCSLADGAITELAVEYSGDITEVNTQMLTTGVIKGMLNPVL 377

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
               N ++AP + KE +I +  +K  +S
Sbjct: 378 EFNVNYVNAPSLAKERSIKVREVKHKES 405


>gi|260888757|ref|ZP_05900020.1| phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC 35185]
 gi|260861510|gb|EEX76010.1| phosphoglycerate dehydrogenase [Selenomonas sputigena ATCC 35185]
          Length = 529

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 78/208 (37%), Positives = 130/208 (62%), Gaps = 2/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PL   TK++L+K+ +++ K GV ++NCARGG+++E  LA+ +++GHVA A  DVF  
Sbjct: 200 VHMPLNPDTKDMLDKKAIARMKKGVRLVNCARGGIINEQDLADAVKAGHVAGAAIDVFTS 259

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  + NPL G+P +   P+LGASTVE+Q  VA+ +A  +   L    V  A+NMA +S 
Sbjct: 260 EPLEEGNPLVGVPGIILTPHLGASTVEAQIGVALDVAEGIRAALSGEPVLTAVNMAPVSA 319

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           +   +++P++ LA+ LGC +  L   +I E+ + Y G    +NT +L + V+ G++  V 
Sbjct: 320 DVMHVIRPYLDLAERLGCTVCSLADGAITELAVEYSGDITEVNTQMLTTGVIKGMLNPVL 379

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
               N ++AP + KE +I +  +K  +S
Sbjct: 380 EFNVNYVNAPSLAKERSIKVREVKHKES 407


>gi|154151703|ref|YP_001405321.1| D-3-phosphoglycerate dehydrogenase [Candidatus Methanoregula boonei
           6A8]
 gi|154000255|gb|ABS56678.1| D-3-phosphoglycerate dehydrogenase [Methanoregula boonei 6A8]
          Length = 534

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 80/202 (39%), Positives = 122/202 (60%), Gaps = 3/202 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +TK+++N ++++  K GV IINCARGG++DE AL + ++SG VA A  DVFE 
Sbjct: 201 VHTPLIKETKHVINAKSIATMKDGVRIINCARGGIIDEAALVDAIKSGKVAGAALDVFET 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP L++PL  L NV   P+LGASTVE+Q+ VAIQ+A Q  + L  G     +N  I+  E
Sbjct: 261 EPPLESPLLSLDNVIVTPHLGASTVEAQKNVAIQVAKQCVEVLNGGSAKYVVNAPIVPTE 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVM--NTMVLNSAVLAGIVR-V 177
            A +++PF  LA+ +G F  Q +   +  ++ IY G  A    +   +   VL G++  +
Sbjct: 321 HAEVLEPFAELAEKMGRFAIQTVEGRLASVECIYGGELAAYAGSMKFVTRLVLKGLLDPI 380

Query: 178 WRVGANIISAPIIIKENAIILS 199
            +   NI++A  + KE  I +S
Sbjct: 381 LQTPVNIVNAEFVAKERGIAMS 402


>gi|256810586|ref|YP_003127955.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus fervens
           AG86]
 gi|256793786|gb|ACV24455.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus fervens
           AG86]
          Length = 525

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 121/210 (57%), Gaps = 3/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KT++I+ KE ++  K    I+NCARGGL+DE AL E L+ G +  A  DVFE 
Sbjct: 200 LHVPLTPKTRHIIGKEQIALMKKNAIIVNCARGGLIDEKALYEALKEGRIRAAALDVFEE 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL  L NV   P+ GAST E+Q+     +A Q+   L   +  N +NM  I  E
Sbjct: 260 EPPKDNPLLTLDNVIGTPHQGASTEEAQKAAGTIVAEQIKKVLRGELAENVVNMPNIPQE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           +   +KP+M LA+ LG  + Q++  S+  ++++Y G  A   T ++  A L G++  +  
Sbjct: 320 KLGKLKPYMLLAETLGNIVMQVLDGSVNRVELVYSGELAKEKTDLIKRAFLKGLLSPILL 379

Query: 180 VGANIISAPIIIKENAI--ILSTIKRDKSG 207
            G N+++AP+I K   I  + ST   +K G
Sbjct: 380 AGINLVNAPVIAKNRNINVVESTTSEEKYG 409


>gi|313896711|ref|ZP_07830259.1| putative phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon
           137 str. F0430]
 gi|312974628|gb|EFR40095.1| putative phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon
           137 str. F0430]
          Length = 366

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 130/208 (62%), Gaps = 2/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT +T+ +++ + + + K GV ++NCARGG+++E  LA  ++ G VA A  DVFE 
Sbjct: 37  VHMPLTKETRGMISMKEMRRMKKGVRLVNCARGGIINETDLAAAVREGLVAGAAIDVFEE 96

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  +PL G+P V   P+LGASTVE+Q  V++ +A  +   L    V+ A+NMA +S 
Sbjct: 97  EPMAADHPLRGVPGVVLTPHLGASTVEAQIGVSVDVAEGIRTALRGEPVTTAVNMAPVSK 156

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           E   +++P++TLA+ LGC +  L   ++  +++IY+G    +NT  L +AVL G++  + 
Sbjct: 157 EVMRVIRPYITLAERLGCTVCSLAEGAVTRVEVIYNGEITEVNTSFLTTAVLKGMLNPIL 216

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
               N ++AP I K   I ++ +K  ++
Sbjct: 217 ESEINYVNAPSIAKSRGIKVTEVKEKEA 244


>gi|138895825|ref|YP_001126278.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermodenitrificans
           NG80-2]
 gi|134267338|gb|ABO67533.1| D-3-phosphoglycerate dehydrogenase [Geobacillus thermodenitrificans
           NG80-2]
          Length = 465

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 121/198 (61%), Gaps = 3/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ +L  ENL+KTK GV +INCARGG++DE AL   L+SGHVA    DVFE 
Sbjct: 139 VHTPLTKETRGLLGTENLAKTKKGVYLINCARGGIIDEQALIPFLESGHVAGVALDVFEQ 198

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL    NV   P+LGASTVE+Q  VA Q+A ++  ++    V++++N+  +S +
Sbjct: 199 EPPGDHPLLAFSNVIATPHLGASTVEAQLNVATQVAEELLHFVEGQPVTSSINLPALSKD 258

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++ F  L   LG    Q ++  +QE+ + Y G+ A + T  +  ++LAG ++  RV
Sbjct: 259 VYEKIQSFYHLGRKLGLIASQFMNIPVQELSVTYAGTVADLETTYITRSLLAGFLQ-PRV 317

Query: 181 GA--NIISAPIIIKENAI 196
            +  N ++A ++ KE  I
Sbjct: 318 ASTVNEVNAAMVAKERGI 335


>gi|169830231|ref|YP_001716213.1| D-3-phosphoglycerate dehydrogenase [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637075|gb|ACA58581.1| D-3-phosphoglycerate dehydrogenase [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 526

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 126/207 (60%), Gaps = 2/207 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT +  ++L+ +  +K K GV IINCARGG+VDE AL   L SG VA A  DVFE 
Sbjct: 199 VHMPLTKENYHLLDDDAFAKMKDGVRIINCARGGIVDEEALYRALVSGKVAGAALDVFEK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PLF LPN  C P+LGAST E+Q  VA+ +A ++   L   +V NA+N+  +  +
Sbjct: 259 EPQTESPLFSLPNFICTPHLGASTREAQVSVAVDVAEEVIAALRGELVKNAVNIPSLKPD 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTM-VLNSAVLAGIV-RVW 178
               + P++ LA+ LG F  QL++  ++ I++ Y G  A    +  L +A++ G++  + 
Sbjct: 319 ILKEIGPYLGLAEKLGRFHAQLLAGRLKRIEVTYSGELARFRQIDPLTTALVKGLLDTIL 378

Query: 179 RVGANIISAPIIIKENAIILSTIKRDK 205
           +   N ++AP+I +   I +S  + D+
Sbjct: 379 QERVNYVNAPVIARNRGIEISQTRVDR 405


>gi|320529979|ref|ZP_08031055.1| phosphoglycerate dehydrogenase [Selenomonas artemidis F0399]
 gi|320137776|gb|EFW29682.1| phosphoglycerate dehydrogenase [Selenomonas artemidis F0399]
          Length = 534

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 130/208 (62%), Gaps = 2/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT +T+ +++ + + + K GV ++NCARGG+++E  LA  ++ G VA A  DVFE 
Sbjct: 205 VHMPLTKETRGMISMKEIRRMKKGVRLVNCARGGIINETDLAAAVREGLVAGAAIDVFEE 264

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  +PL G+P V   P+LGASTVE+Q  V++ +A  +   L    V+ A+NMA +S 
Sbjct: 265 EPMAADHPLRGVPGVVLTPHLGASTVEAQIGVSVDVAEGIRTALRGEPVTTAVNMAPVSK 324

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           E   +++P++TLA+ LGC +  L   ++  +++IY+G    +NT  L +AVL G++  + 
Sbjct: 325 EVMRVIRPYITLAERLGCTVCSLAEGAVTRVEVIYNGEITEVNTSFLTTAVLKGMLNPIL 384

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
               N ++AP + K   I ++ +K  ++
Sbjct: 385 ESEINYVNAPSVAKSRGIKVTEVKEKEA 412


>gi|85859018|ref|YP_461220.1| D-3-phosphoglycerate dehydrogenase [Syntrophus aciditrophicus SB]
 gi|85722109|gb|ABC77052.1| D-3-phosphoglycerate dehydrogenase [Syntrophus aciditrophicus SB]
          Length = 527

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 80/197 (40%), Positives = 113/197 (57%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T  ++N    +K K GV +INCARGG+V+E  L + L SG VA A  DVFE 
Sbjct: 201 VHTPKNKETTGMINAAAFAKMKKGVFVINCARGGIVNEKDLYDALVSGQVAGAALDVFEE 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L  L NV C P+LGAST E+Q  VA+ +A QM DYL+ G +  A+N   +S +
Sbjct: 261 EPTKNIDLISLDNVICTPHLGASTDEAQTTVAVAIAEQMVDYLLKGEIRYAVNFPAVSAD 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               + P++ LA+ LG F  Q++S  I+EI I Y G     +   +  A+L G++  +  
Sbjct: 321 LMAAITPYLALAEKLGKFQAQIVSGGIEEINIEYSGEILKYDVAPITIALLKGLLTPILN 380

Query: 180 VGANIISAPIIIKENAI 196
              N I+AP+I KE  I
Sbjct: 381 ENVNYINAPVIAKERGI 397


>gi|15669207|ref|NP_248012.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus jannaschii
           DSM 2661]
 gi|3122874|sp|Q58424|SERA_METJA RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|1591676|gb|AAB99020.1| phosphoglycerate dehydrogenase (serA) [Methanocaldococcus
           jannaschii DSM 2661]
          Length = 524

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 121/210 (57%), Gaps = 3/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KT++I+ +E ++  K    I+NCARGGL+DE AL E L+ G +  A  DVFE 
Sbjct: 200 LHVPLTPKTRHIIGREQIALMKKNAIIVNCARGGLIDEKALYEALKEGKIRAAALDVFEE 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL  L NV   P+ GAST E+Q+     +A Q+   L   +  N +NM  I  E
Sbjct: 260 EPPKDNPLLTLDNVIGTPHQGASTEEAQKAAGTIVAEQIKKVLRGELAENVVNMPNIPQE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           +   +KP+M LA+ LG  + Q++  S+  +++IY G  A   T ++  A L G++  +  
Sbjct: 320 KLGKLKPYMLLAEMLGNIVMQVLDGSVNRVELIYSGELAKEKTDLIKRAFLKGLLSPILL 379

Query: 180 VGANIISAPIIIKENAI--ILSTIKRDKSG 207
            G N+++APII K   I  + S+   +K G
Sbjct: 380 AGINLVNAPIIAKNRNINVVESSTSEEKYG 409


>gi|15614165|ref|NP_242468.1| D-3-phosphoglycerate dehydrogenase [Bacillus halodurans C-125]
 gi|10174219|dbj|BAB05321.1| D-3-phosphoglycerate dehydrogenase [Bacillus halodurans C-125]
          Length = 540

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 117/198 (59%), Gaps = 3/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +L  +N+ KTK GV +INCARGG++DE AL   L+ GH+A A  DVFE 
Sbjct: 213 VHTPLTKETKGLLGMKNIGKTKKGVFLINCARGGIIDEEALKHYLREGHIAGAALDVFEE 272

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P++ AST E+Q  VA Q++ ++  +L    VSN++N+  +S E
Sbjct: 273 EPVADEELLAFDNVIATPHIAASTKEAQLNVAEQVSQEVLHFLEGNPVSNSINLPTLSKE 332

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV--RVW 178
               VKP+  L   +G  + Q +   +QEI++ Y G+ A + T +   +++AG +  RV 
Sbjct: 333 VYEKVKPYYELTKKMGFLLSQCMKTPVQEIEVRYGGNVADIETSITTRSLMAGFLSPRV- 391

Query: 179 RVGANIISAPIIIKENAI 196
             G N ++A +I KE  I
Sbjct: 392 DAGVNDVNAGLIAKERGI 409


>gi|116751067|ref|YP_847754.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
 gi|116700131|gb|ABK19319.1| D-3-phosphoglycerate dehydrogenase [Syntrophobacter fumaroxidans
           MPOB]
          Length = 526

 Score =  147 bits (372), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 119/197 (60%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P+T +T++ILN +   K K GV +INCARGG+V+E  L + +++G VA A  DVF  
Sbjct: 200 VHTPMTPETRDILNAKAFKKMKEGVFVINCARGGIVNEQDLHDAIRAGIVAGAALDVFAQ 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL  L +V   P+LGAST E+QE VAI +A Q+ D+L+ G + NA+N   I   
Sbjct: 260 EPPKDNPLLALDSVIATPHLGASTDEAQENVAIAVADQVIDFLVRGTIRNAVNAPNIDGA 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               ++P++ L++ LG  + Q+   +IQ++ I Y G  A M T  L  ++L G++  +  
Sbjct: 320 VLARLRPYLKLSEKLGSVLTQITRGAIQKVSIEYIGEVASMETQPLTYSILKGMLTPIMG 379

Query: 180 VGANIISAPIIIKENAI 196
              N ++ P++ +E  I
Sbjct: 380 DMVNFVNVPVLARERNI 396


>gi|258593832|emb|CBE70173.1| D-3-phosphoglycerate dehydrogenase [NC10 bacterium 'Dutch
           sediment']
          Length = 526

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 114/173 (65%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P+T +T ++++++ +++ K+GV IINCARGG+VDE AL E +++G VA A  DVFE 
Sbjct: 200 VHTPITPETYHLIDRDAIARMKTGVRIINCARGGIVDETALYEAMKAGKVAGAAMDVFEQ 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   + LF L N  C P++GA++ E+QE VA+++A Q+ +YL  G++ NA+N   I   
Sbjct: 260 EPTTDSSLFSLNNFICTPHIGAASEEAQENVAVEIAQQIVEYLQKGLIRNAVNAPSIDPA 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
              +++P++TL++ LG    QL    +++I+I Y G  A  +   L ++V+ G
Sbjct: 320 LYKMLQPYLTLSEKLGRLASQLAEGGLRQIRIDYRGEIAGYDPAALTASVIKG 372


>gi|189219266|ref|YP_001939907.1| D-3-phosphoglycerate dehydrogenase [Methylacidiphilum infernorum
           V4]
 gi|189186124|gb|ACD83309.1| Phosphoglycerate dehydrogenase and ACT domains [Methylacidiphilum
           infernorum V4]
          Length = 531

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 76/177 (42%), Positives = 109/177 (61%), Gaps = 1/177 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT +T+ I+NK+NL K K G+ IINCARGGL+    L ELL+SG VA A  DV+E 
Sbjct: 205 LHVPLTQETEGIINKDNLKKCKRGIRIINCARGGLIRIADLEELLKSGWVAGAALDVYEP 264

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP   + PL GLPNV   P+L AST+E+QE V  ++A  + D L   ++ NA+N+  +  
Sbjct: 265 EPPPADFPLRGLPNVVLTPHLAASTIEAQENVGTEIAAMVIDVLCHNIIRNAVNVPSVDP 324

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR 176
           +   +++P+M L + LG F+ Q +   I  + I + G     +T  +  AVL G +R
Sbjct: 325 KILSILRPYMALGEKLGIFMSQWVVNRIDSLTIYFSGKVNEYDTSPITRAVLKGFLR 381


>gi|320105785|ref|YP_004181375.1| D-3-phosphoglycerate dehydrogenase [Terriglobus saanensis SP1PR4]
 gi|319924306|gb|ADV81381.1| D-3-phosphoglycerate dehydrogenase [Terriglobus saanensis SP1PR4]
          Length = 537

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 111/175 (63%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHV LT +T+ ++N  +++  K GV I+NCARG L+ + AL E L+SG VA A  DVF  
Sbjct: 199 LHVGLTPQTEGLINAHSIAIMKKGVRIVNCARGELIVDEALVEALKSGQVAGAALDVFTK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++P   L NV  +P++  ST E+QE + IQLA Q+ DYL  GVV NA+N+  +S E
Sbjct: 259 EPLKESPYHALDNVILSPHIAGSTDEAQEAIGIQLAQQVRDYLKLGVVQNAVNVPSLSRE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
           E   V P++ LA+ LG F+      +++ IQI Y G  A   T ++ +A+LAG++
Sbjct: 319 EYVEVAPYVDLAERLGAFLSHATPGNLENIQIAYSGRLAQGKTDLIRNAILAGVL 373


>gi|147920120|ref|YP_686117.1| D-3-phosphoglycerate dehydrogenase [uncultured methanogenic
           archaeon RC-I]
 gi|110621513|emb|CAJ36791.1| D-3-phosphoglycerate dehydrogenase [uncultured methanogenic
           archaeon RC-I]
          Length = 526

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 126/209 (60%), Gaps = 3/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT  TK++++     K K GV IINCARGG++DE AL E ++SG VA A  DVFE 
Sbjct: 200 VHTPLTPSTKHMVSTAQFEKMKKGVRIINCARGGIIDEAALLEAIKSGKVAGAALDVFEK 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + +PL   PN+   P+LGAST E+Q  VAI +A Q+ +      V+ A+N+ I+  E
Sbjct: 260 EPPVGSPLLEQPNIIVTPHLGASTAEAQINVAITIAEQVLNAFKGLPVTTAINIPIMKPE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               VKPF+ LA+ LG F  Q+    I+E  + Y+G  A  +  ++  AVL G++ V ++
Sbjct: 320 VMEKVKPFLPLAEQLGKFAAQITDGQIKEAIVSYNGEIAQKDVTLVTVAVLKGLLDV-KL 378

Query: 181 G--ANIISAPIIIKENAIILSTIKRDKSG 207
           G   N ++A  I K+ +I ++  K  ++G
Sbjct: 379 GEPVNYVNAKHIAKDRSINVAETKLAETG 407


>gi|296131563|ref|YP_003638810.1| D-3-phosphoglycerate dehydrogenase [Thermincola sp. JR]
 gi|296030141|gb|ADG80909.1| D-3-phosphoglycerate dehydrogenase [Thermincola potens JR]
          Length = 523

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 124/209 (59%), Gaps = 2/209 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T ++ N++NK+ ++  K G  IIN ARGG+V+E  L E ++SG +A A  DVF  
Sbjct: 200 LHIPKTKESLNLINKDTIAMMKDGARIINVARGGIVNEQDLYEAVKSGKLAGAALDVFAE 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDG-VVSNALNMAIISF 119
           EP  ++PLF L NV  AP+LGAST E+Q  VA+ +A +  + L+ G +  NA+N+A I  
Sbjct: 260 EPTTESPLFELNNVVVAPHLGASTKEAQINVALDVAEEFVNVLVKGEMAKNAVNLAPIKP 319

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW- 178
           +    +KP++ LA+ LG F  QL + ++  ++I Y G  A +    L +A L G +    
Sbjct: 320 DVLAAIKPYLNLAEKLGKFQAQLAAGNVNNVKITYSGELAKVEVTPLTTAFLKGFLTPQV 379

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKSG 207
               N ++AP+I KE  I++   K  + G
Sbjct: 380 EDSVNFVNAPVIAKERGIVVEETKSAEEG 408


>gi|288556042|ref|YP_003427977.1| D-3-phosphoglycerate dehydrogenase [Bacillus pseudofirmus OF4]
 gi|288547202|gb|ADC51085.1| D-3-phosphoglycerate dehydrogenase [Bacillus pseudofirmus OF4]
          Length = 540

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 120/198 (60%), Gaps = 3/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK IL  EN++KTK GV +INCARGG++DE+AL   L +GH+A A  DVFE 
Sbjct: 214 VHTPLTKETKGILGMENIAKTKQGVFLINCARGGIIDESALKHYLANGHIAGAALDVFEE 273

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA    L    NV   P++ AST E+Q  VA Q++ ++  +L     +N++N+  +S E
Sbjct: 274 EPAQDKELLEFDNVIATPHIAASTKEAQLNVASQVSEEVIRFLEGQPATNSINLPTLSKE 333

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++P+  L   +G  + Q++   +QEI++ Y G+   + T +   +++AG ++  RV
Sbjct: 334 IYEKIQPYYDLTKRMGNLLSQVMKTPVQEIEVYYGGNITDLETSITTRSLIAGFLQ-PRV 392

Query: 181 GA--NIISAPIIIKENAI 196
            A  N ++A +I KE  I
Sbjct: 393 DAAVNDVNAALIAKERGI 410


>gi|291276391|ref|YP_003516163.1| D-3-phosphoglycerate dehydrogenase [Helicobacter mustelae 12198]
 gi|290963585|emb|CBG39417.1| D-3-phosphoglycerate dehydrogenase [Helicobacter mustelae 12198]
          Length = 527

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 80/197 (40%), Positives = 115/197 (58%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T +T +++NK+ L+  K G  IIN +RGG++DE AL E + +GH+  A  DVFE 
Sbjct: 198 LHVPKTKETTHMINKDTLALMKKGAYIINASRGGIIDEIALRESIDAGHIGGAALDVFEN 257

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  QN PL G P     P+LGAST E+Q  VAI +A Q+   L  G   +A+N+  +  
Sbjct: 258 EPDTQNFPLRGCPKAVLTPHLGASTEEAQLNVAIDVAGQIKSVLSGGTAQSAVNIPSLRA 317

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           ++   +K +M +A + G FI QL+ E I+ I I   G  A  N   L  A+L GI+    
Sbjct: 318 DKLEPIKDYMPIAQNAGAFIAQLLQEKIESIAITAQGELASKNLESLEVAILKGILSAHF 377

Query: 180 VGANIISAPIIIKENAI 196
              N ++AP+I K++ I
Sbjct: 378 EDVNYVNAPLIAKQSGI 394


>gi|126649438|ref|ZP_01721679.1| phosphoglycerate dehydrogenase [Bacillus sp. B14905]
 gi|126593763|gb|EAZ87686.1| phosphoglycerate dehydrogenase [Bacillus sp. B14905]
          Length = 535

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 108/175 (61%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+N++NKE  +  K GV IINCARGG+++E+ L + + +G VA A  DVF  
Sbjct: 209 VHTPLLPETRNLINKEKFAMMKDGVRIINCARGGIINEDDLYDAIVAGKVAGAALDVFVS 268

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  + L  LP V   P+LGAST+E+QE VA+ +++ +  +   G V+N +NM  I  E
Sbjct: 269 EPATDHKLLTLPQVIATPHLGASTIEAQESVAVDVSNDIIKFYKTGTVTNPVNMPSIPKE 328

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
               V+PF  LA+ LG F+ Q+ +E ++EI + Y G  A  +   L S  L G++
Sbjct: 329 LLAQVEPFFELAEKLGSFLSQVTTEPVKEINLSYAGDVANYDVRPLTSNALKGLL 383


>gi|223940712|ref|ZP_03632551.1| D-3-phosphoglycerate dehydrogenase [bacterium Ellin514]
 gi|223890639|gb|EEF57161.1| D-3-phosphoglycerate dehydrogenase [bacterium Ellin514]
          Length = 526

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 111/176 (63%), Gaps = 1/176 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P+T++TK +LN    +K KSGV ++NCARGG+++E  L E ++ G VA A  DV+EV
Sbjct: 198 VHMPMTDETKGMLNTAAFAKMKSGVRVLNCARGGIINETDLYEAIKGGKVAGAALDVYEV 257

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  +  PL  LP V   P+LGAST E+QE V I++A  ++DYL++G V NA+N+  +  
Sbjct: 258 EPLPKEFPLRDLPQVIMTPHLGASTDEAQENVGIEVAEAITDYLLNGAVRNAVNLPNLDA 317

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
           +   LVKP++ L + LG  + QL  +    + + Y G    + T  ++ ++L G +
Sbjct: 318 KTYALVKPYLALGEKLGRLVAQLAPKRNDRLVVTYGGKATEVPTDPISRSILKGFL 373


>gi|169825985|ref|YP_001696143.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus sphaericus
           C3-41]
 gi|168990473|gb|ACA38013.1| Phosphoglycerate dehydrogenase [Lysinibacillus sphaericus C3-41]
          Length = 535

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 108/175 (61%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+N++NKE  +  K GV IINCARGG+++E+ L + + +G VA A  DVF  
Sbjct: 209 VHTPLLPETRNLINKEKFAMMKDGVRIINCARGGIINEDDLYDAIVAGKVAGAALDVFVS 268

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  + L  LP V   P+LGAST+E+QE VA+ +++ +  +   G V+N +NM  I  E
Sbjct: 269 EPATDHKLLTLPQVIATPHLGASTIEAQESVAVDVSNDIIKFYKTGTVTNPVNMPSIPKE 328

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
               V+PF  LA+ LG F+ Q+ +E ++EI + Y G  A  +   L S  L G++
Sbjct: 329 LLAQVEPFFELAEKLGSFLSQVTTEPVKEINLSYAGEVANYDVRPLTSNALKGLL 383


>gi|134046847|ref|YP_001098332.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C5]
 gi|132664472|gb|ABO36118.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C5]
          Length = 523

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 118/200 (59%), Gaps = 1/200 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KTK+++ K+ ++  KS + I+NCARGGL+DE+AL E L SG +  AG DVFE 
Sbjct: 199 LHVPLTPKTKHMIGKDQIALMKSNMVIMNCARGGLIDEDALYEALNSGKIKAAGLDVFEQ 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PL  L N+   P+ GAST E+Q      +A Q    L      N +N+ ++  E
Sbjct: 259 EPPKESPLLTLNNLIGTPHQGASTEEAQLSAGTIVAEQTVKILKGESAENVVNLPMVPTE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           +   +KP+M LA+ +G    Q +  SI+ ++I Y G  A   T ++  + L GI+  +  
Sbjct: 319 KMKKLKPYMVLAEKMGSMAIQYLDNSIELLEITYMGGLANEKTEIIKRSFLKGILAPILL 378

Query: 180 VGANIISAPIIIKENAIILS 199
            G N+++AP+I K   I L+
Sbjct: 379 AGVNLVNAPVIAKSRNIKLA 398


>gi|134297895|ref|YP_001111391.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum reducens MI-1]
 gi|134050595|gb|ABO48566.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum reducens MI-1]
          Length = 526

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 125/206 (60%), Gaps = 2/206 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T +++N+E L   K GV IINCARGG+VDE AL + +++G VA A  DVFE 
Sbjct: 200 IHMPKTKETYHMINEEALELMKDGVRIINCARGGIVDEEALYKFMEAGKVAGAALDVFET 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL  L N    P+LGAST E+Q  VA+ +A ++   L   +V NA+NM  +S +
Sbjct: 260 EPCTDNPLLKLDNFIATPHLGASTQEAQINVAVDVAEEIVAALRGDLVKNAVNMPSMSPK 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               ++PF+ LA+ LG F  Q++   I++++++Y G  A  +   + + +L G++  + +
Sbjct: 320 LLAKIRPFLDLAEKLGTFQAQMLDGRIEKVEVVYSGELAKYDVNPVTTILLKGLLDPILQ 379

Query: 180 VGANIISAPIIIKENAI-ILSTIKRD 204
              N ++A ++ +   I ++ T K +
Sbjct: 380 ENVNFVNATLVARNRGISVVQTTKEN 405


>gi|32474150|ref|NP_867144.1| D-3-phosphoglycerate dehydrogenase [Rhodopirellula baltica SH 1]
 gi|32444687|emb|CAD74689.1| phosphoglycerate dehydrogenase [Rhodopirellula baltica SH 1]
 gi|327541027|gb|EGF27580.1| D-3-phosphoglycerate dehydrogenase [Rhodopirellula baltica WH47]
          Length = 540

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 120/199 (60%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ ++  E L K K G+ IIN ARGG+ D  A+ E L+SG +     DV+E 
Sbjct: 202 VHTPLTPETRGLIGMEQLEKVKPGLRIINVARGGIYDSEAMVEGLKSGKLGGVALDVYEN 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLFG+P V C P+LGAST E+Q +VA++  H + +YL  G + +++N+A +  +
Sbjct: 262 EPCTDSPLFGMPGVVCTPHLGASTEEAQTQVAVEGIHLLLNYLRTGEIRHSVNVASLDPK 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++  + +A  LG F+ QL    I   ++ + G  +  +T VLN+A  AG++     
Sbjct: 322 TLAELRGHLNVAHRLGLFLSQLHGGGIDHARLTFRGEVSGKDTRVLNNAFCAGLLERVVE 381

Query: 181 GANIISAPIIIKENAIILS 199
            AN+I++ ++++E  I L+
Sbjct: 382 DANVINSEMLLRERGIELT 400


>gi|283782491|ref|YP_003373246.1| D-3-phosphoglycerate dehydrogenase [Pirellula staleyi DSM 6068]
 gi|283440944|gb|ADB19386.1| D-3-phosphoglycerate dehydrogenase [Pirellula staleyi DSM 6068]
          Length = 542

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 118/208 (56%), Gaps = 1/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T N++    L   K GV +INCARGG+ +E+AL E L++G +     DVF  
Sbjct: 202 VHTPLTPETTNLVGFPELEVLKPGVRLINCARGGIYNEDALVEGLKTGKIGGVALDVFVT 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++P++G+PNV C P+LGAST E+Q++VAI+    + ++   G V +A+NMA +  +
Sbjct: 262 EPCDKHPIYGMPNVLCTPHLGASTEEAQQQVAIEAVQLLINFFTTGEVRHAVNMASVDPK 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
               +K ++ LA  LG  + Q          + Y G     NT +L +A  AG++ R   
Sbjct: 322 TLASIKGYLDLAYRLGVLLAQCQPGGTSACHLTYRGELTQKNTKMLTAAFCAGLLDRALE 381

Query: 180 VGANIISAPIIIKENAIILSTIKRDKSG 207
              NI++A I++KE  I L+   R   G
Sbjct: 382 EDVNIVNAEILLKERGIQLTQESRSDMG 409


>gi|261403538|ref|YP_003247762.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus vulcanius
           M7]
 gi|261370531|gb|ACX73280.1| D-3-phosphoglycerate dehydrogenase [Methanocaldococcus vulcanius
           M7]
          Length = 524

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 121/210 (57%), Gaps = 3/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KT++I+ K+ ++  K    I+NCARGGL+DE AL E L+   +  A  DVFE 
Sbjct: 200 LHVPLTPKTRHIIGKDQINLMKKNAIIVNCARGGLIDEKALYEALKEKKIRAAALDVFEE 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL  L NV   P+ GAST E+Q+     +A Q+   L   +  N +NM  I  E
Sbjct: 260 EPPKDNPLLTLDNVIGTPHQGASTEEAQKAAGTIVAEQIKKVLKGELAENVVNMPNIPQE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           +   +KP+M LA+ LG  + Q++  S++ ++I+Y G  A   T ++  A L G++  +  
Sbjct: 320 KLGKLKPYMLLAEMLGNIVMQVLDGSVKRVEIVYCGDLAKEKTDLIKRAFLKGLLSPILL 379

Query: 180 VGANIISAPIIIKEN--AIILSTIKRDKSG 207
            G N+++AP+I K    ++I +T    K G
Sbjct: 380 AGINLVNAPVIAKNRNISVIETTTSEKKFG 409


>gi|292669667|ref|ZP_06603093.1| phosphoglycerate dehydrogenase [Selenomonas noxia ATCC 43541]
 gi|292648464|gb|EFF66436.1| phosphoglycerate dehydrogenase [Selenomonas noxia ATCC 43541]
          Length = 526

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 128/208 (61%), Gaps = 2/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT +T+ +++ + + + K G+ ++NCARGG++ E  LA  ++ G VA A  DVFE 
Sbjct: 197 VHMPLTKETRGMISMKEMRRMKKGIRLVNCARGGIISETDLAAAVEEGIVAGAAIDVFEN 256

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  +PL G+P +   P+LGASTVE+Q  V++ +A  +   L    V+ A+NMA +S 
Sbjct: 257 EPLAEDHPLRGIPGIVLTPHLGASTVEAQIGVSVDVAEGIRAALRGEPVTAAVNMAPVSK 316

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           E   +++P++TLA+ LGC    L   +I  +++IY+G    +NT  L +A+L G++  + 
Sbjct: 317 EVMRVIRPYITLAEQLGCTACSLAEGAISHVEVIYNGEITEVNTSFLTTAILKGMLNPIL 376

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
               N ++AP + K   I ++ IK  ++
Sbjct: 377 ESEINYVNAPGVAKSRGIKVTEIKEKET 404


>gi|299537582|ref|ZP_07050875.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus fusiformis ZC1]
 gi|298726951|gb|EFI67533.1| D-3-phosphoglycerate dehydrogenase [Lysinibacillus fusiformis ZC1]
          Length = 537

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 120/208 (57%), Gaps = 6/208 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+N++NK+  +  K GV IINCARGG+++E+ L + + +G VA A  DVF  
Sbjct: 211 VHTPLLPETRNLINKDKFAMMKDGVRIINCARGGIINEDDLYDAIVAGKVAGAALDVFVS 270

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  + L  LP V   P+LGAST+E+QE VA+ +++ +  +   G V+N +NM  I  E
Sbjct: 271 EPATDHKLLTLPQVIATPHLGASTIEAQESVAVDVSNDIIKFYKTGTVTNPVNMPSIPKE 330

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV----- 175
               V+PF  LA+ LG F+ Q+ +E ++EI + Y G  A  +   L S  L G++     
Sbjct: 331 LLAQVEPFFELAEKLGSFLSQVTTEPVKEINLSYAGEVANYDVRPLTSNALKGLLSKNHG 390

Query: 176 -RVWRVGANIISAPIIIKENAIILSTIK 202
             V  V A  +S  I +K N    +T K
Sbjct: 391 NHVNDVNARYLSERIGMKINEHKTTTAK 418


>gi|327438749|dbj|BAK15114.1| phosphoglycerate dehydrogenase [Solibacillus silvestris StLB046]
          Length = 541

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 108/175 (61%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+NI+NKE  +  K GV IINCARGG+++E+ L + +  G VA A  DVF  
Sbjct: 215 VHTPLLPETRNIINKERFAIMKDGVRIINCARGGIINEDDLYDAIVEGKVAGAALDVFVQ 274

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  + L  LP V   P+LGASTVE+QE VA+ +++ +  +   G V+N +NM  I  E
Sbjct: 275 EPATDHKLLTLPQVIATPHLGASTVEAQESVAVDVSNDIIKFFKTGTVTNPVNMPSIPKE 334

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
           +   V+PF  LA+ LG F+ Q+  ESI+++ I Y G  A  +   L +  + G++
Sbjct: 335 KLAEVEPFFALAEKLGKFLIQVTEESIKQLNISYAGEVANFDVRPLTANAIKGLL 389


>gi|23100081|ref|NP_693547.1| D-3-phosphoglycerate dehydrogenase [Oceanobacillus iheyensis
           HTE831]
 gi|22778312|dbj|BAC14582.1| phosphoglycerate dehydrogenase [Oceanobacillus iheyensis HTE831]
          Length = 528

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 107/178 (60%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +TK+++NK+     K GV I+NCARGG++DE+AL + +QSG VA A  DVFE 
Sbjct: 202 VHTPLLKETKHLINKDAFDLMKDGVQIVNCARGGIIDEDALYDAIQSGKVAGAALDVFEQ 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ L  LP V   P+LGASTVE+QE VAI ++H +  +     V N +NM  +  E
Sbjct: 262 EPFTEHKLLTLPEVVATPHLGASTVEAQEVVAIDVSHDVLRFSQGEAVRNPVNMPSVPSE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
               ++P+  LA+ LG FI  L  E + E++I Y G  A +    L    + G+++ +
Sbjct: 322 IMYKIEPYFHLAEKLGTFITDLTKEVVSEVKITYAGDLADIEIAPLTRNAVKGLLKRY 379


>gi|323701688|ref|ZP_08113360.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum nigrificans
           DSM 574]
 gi|323533461|gb|EGB23328.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum nigrificans
           DSM 574]
          Length = 527

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 125/207 (60%), Gaps = 1/207 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T +++N+E  ++ K GV IINCARGG+VDE AL E + SG VA A  DVFE 
Sbjct: 201 IHMPKTKETYHMINQEAFNQMKDGVRIINCARGGIVDEAALYEAMISGKVAGAALDVFET 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL  L N    P+LGAST E+Q  VA+ +A ++   L   +V NA+N+  +S +
Sbjct: 261 EPCTDSPLLQLDNFIATPHLGASTQEAQINVAVDVAEEIVAALRGELVKNAVNIPSMSPK 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               ++PF+ LA+ LG F  Q+++  I++++++Y G  A      + + +L G++  + +
Sbjct: 321 LLAKIRPFLDLAEKLGKFQAQMLNGRIEKVEVVYSGELAKYEVNPITTTLLKGLLDPILQ 380

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
              N ++AP++ +   I +    +D +
Sbjct: 381 ENVNFVNAPLVARNRGITVIQTTKDNA 407


>gi|121535994|ref|ZP_01667786.1| D-3-phosphoglycerate dehydrogenase [Thermosinus carboxydivorans
           Nor1]
 gi|121305430|gb|EAX46380.1| D-3-phosphoglycerate dehydrogenase [Thermosinus carboxydivorans
           Nor1]
          Length = 528

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 81/208 (38%), Positives = 122/208 (58%), Gaps = 2/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  TK +L ++   + K GV IINCARGG++DE ALA+ LQ G VA A  DVFE 
Sbjct: 198 LHLPLTPDTKGLLGQDAFKRMKRGVRIINCARGGIIDEAALAQALQDGTVAGAAIDVFEK 257

Query: 61  EPA-LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    NPL GL NV   P+LGAST E+Q  VA+ +A  +   L    V+ A+NMA I  
Sbjct: 258 EPVDPNNPLLGLNNVVLTPHLGASTAEAQVGVAVDVARGIIAALRGEPVTTAVNMAPIPP 317

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
               +++P+  +A+ +GC    L    I  + + Y+G  + ++T ++ +AV+ G++  + 
Sbjct: 318 HVLEVIQPYFKVAEKMGCLAVHLADGRIGAVDVEYNGDISEVDTRLVTTAVIKGMLNPIL 377

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
           +   N ++AP I K   I +  IK  ++
Sbjct: 378 QENVNYVNAPGIAKARGIKVKEIKSKET 405


>gi|330509011|ref|YP_004385439.1| phosphoglycerate dehydrogenase [Methanosaeta concilii GP-6]
 gi|328929819|gb|AEB69621.1| phosphoglycerate dehydrogenase [Methanosaeta concilii GP-6]
          Length = 525

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 120/200 (60%), Gaps = 2/200 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLTN+T+N+++ +     K GV I+NCARGG+++E ALA+ +  G VA A  DVF  
Sbjct: 198 VHTPLTNETRNLIDDDEFKIMKDGVRIVNCARGGIINEAALAKAVAEGKVAGAAVDVFTK 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL G   +   P+LGAST E+Q  VA+ +A Q+      G+ +NA+NM  IS E
Sbjct: 258 EPPTGNPLLGQERIITTPHLGASTAEAQVNVALAVADQILAIAKGGLPTNAINMPAISPE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
              +++P+M LA+ +G  +GQ++    + +++IY G+ A  +T  +  + + G++   + 
Sbjct: 318 TLAVMEPYMMLAERMGSLLGQMVGSGFESLELIYSGTIAEKDTRPVTISAIRGLLGCLMG 377

Query: 179 RVGANIISAPIIIKENAIIL 198
           +   N ++A   +KE  + L
Sbjct: 378 KDSINFVNATTTLKEMGVKL 397


>gi|21227855|ref|NP_633777.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina mazei Go1]
 gi|20906268|gb|AAM31449.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina mazei Go1]
          Length = 540

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 116/197 (58%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+NIL+ E  +  K GV ++NCARGG+++E ALA  L+SG V  A  DVF  
Sbjct: 215 VHTPLIKETRNILDDEQFALMKKGVRVLNCARGGIINEEALARALESGKVGGAAIDVFVE 274

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL    NV   P+LGAST E+Q  VAI +A ++   L  G   NA+N+  +  E
Sbjct: 275 EPPFSSPLLNFDNVIVTPHLGASTQEAQVNVAIDIAKEVVSVLTGGSAKNAINIPSVKPE 334

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW-R 179
              ++ P++ L++ +G   GQL+  + ++++I Y+G  +  +T  L  + L G++ +   
Sbjct: 335 AMAVLAPYIRLSELMGKIAGQLVDSNYEKVEIAYNGEISGKDTRPLTVSALKGLLEMAVG 394

Query: 180 VGANIISAPIIIKENAI 196
            G N ++API+ K   I
Sbjct: 395 SGVNYVNAPILAKSRKI 411


>gi|322381790|ref|ZP_08055744.1| D-3-phosphoglycerate dehydrogenase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321154178|gb|EFX46500.1| D-3-phosphoglycerate dehydrogenase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 535

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 115/197 (58%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T++IL     +  K GV I+NCARGG+VDE AL E +++G V  A FDVFE 
Sbjct: 209 VHTPLTKETRHILGPGQFAIMKKGVRIVNCARGGIVDEEALVEAIKAGTVGGAAFDVFEH 268

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  +P    PN+   P+LGASTVE+QE VAI ++ ++   L +    NA+NM  +  
Sbjct: 269 EPPAADHPFLNHPNIIVTPHLGASTVEAQENVAIDVSEEVLHILRNEPFKNAVNMPPVPA 328

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
                ++P+  L + +G  +G+++ ++++EI I Y G  A  +T  L   ++ GI     
Sbjct: 329 SVMRKLQPYFQLGEKIGKMLGEMLQDAVKEITIHYSGDVADTDTSPLTRYIVKGIFEQQL 388

Query: 180 VGANIISAPIIIKENAI 196
            G N+++A  + K   I
Sbjct: 389 EGVNVVNAMHLTKSRGI 405


>gi|167465145|ref|ZP_02330234.1| phosphoglycerate dehydrogenase [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 527

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 115/197 (58%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T++IL     +  K GV I+NCARGG+VDE AL E +++G V  A FDVFE 
Sbjct: 201 VHTPLTKETRHILGPGQFAIMKKGVRIVNCARGGIVDEEALVEAIKAGTVGGAAFDVFEH 260

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  +P    PN+   P+LGASTVE+QE VAI ++ ++   L +    NA+NM  +  
Sbjct: 261 EPPAADHPFLNHPNIIVTPHLGASTVEAQENVAIDVSEEVLHILRNEPFKNAVNMPPVPA 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
                ++P+  L + +G  +G+++ ++++EI I Y G  A  +T  L   ++ GI     
Sbjct: 321 SVMRKLQPYFQLGEKIGKMLGEMLQDAVKEITIHYSGDVADTDTSPLTRYIVKGIFEQQL 380

Query: 180 VGANIISAPIIIKENAI 196
            G N+++A  + K   I
Sbjct: 381 EGVNVVNAMHLTKSRGI 397


>gi|260881561|ref|ZP_05404709.2| phosphoglycerate dehydrogenase [Mitsuokella multacida DSM 20544]
 gi|260848763|gb|EEX68770.1| phosphoglycerate dehydrogenase [Mitsuokella multacida DSM 20544]
          Length = 558

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 125/209 (59%), Gaps = 3/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT +TK ++  E + K K GV ++NCARGG++DE  LAE L+ G VA A  DV+  
Sbjct: 228 VHMPLTKETKGMIAMEQMKKMKPGVRLVNCARGGIIDEADLAEALKQGIVAAAAIDVYTS 287

Query: 61  EPALQ--NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  +  NPL   PN+   P+LGASTVE+Q  V++ +A  +   L    V+ A+NMA +S
Sbjct: 288 EPPAEKGNPLLEAPNIVLTPHLGASTVEAQIGVSVDVAKGIIAALHGEPVATAVNMAPVS 347

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +   ++ P++TLA+ LG  +  L    I+ +++ Y+G    +NT +L +AV+ GI+  V
Sbjct: 348 PQVMRVIAPYLTLAERLGGTVVGLADGPIESVEVTYNGEITEVNTGLLTTAVIKGILNPV 407

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
                N ++AP + KE  I +S  K   S
Sbjct: 408 MENEVNYVNAPGLAKERGIKVSERKERAS 436


>gi|147676347|ref|YP_001210562.1| D-3-phosphoglycerate dehydrogenase [Pelotomaculum thermopropionicum
           SI]
 gi|146272444|dbj|BAF58193.1| phosphoglycerate dehydrogenase and related dehydrogenases
           [Pelotomaculum thermopropionicum SI]
          Length = 526

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/207 (37%), Positives = 124/207 (59%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT ++K +L ++  S  K GV IINCARGG+VDE AL   ++SG VA A  DVFE 
Sbjct: 200 VHLPLTRESKYMLGEKAFSLMKDGVRIINCARGGVVDEQALYNAMKSGKVAGAALDVFEK 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF   N    P+LGAST E+Q  VA  +A ++   L   +V NA+N+  +S +
Sbjct: 260 EPNTDSPLFEFKNFIATPHLGASTQEAQLSVATDVAREVVAALKGELVKNAVNIPSVSPK 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
              ++KP+++LA+ +G F  Q+I   + +I+  Y G  A      L +A+L G +  + +
Sbjct: 320 VLAVIKPYLSLAEKMGKFAAQVICGRVNKIEATYSGDLAGQEVSPLTTAILKGFLDSILQ 379

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
              N ++AP++ K+  I  + I+R ++
Sbjct: 380 EMVNFVNAPLLAKKRGI--NVIQRQET 404


>gi|87312269|ref|ZP_01094368.1| phosphoglycerate dehydrogenase [Blastopirellula marina DSM 3645]
 gi|87285007|gb|EAQ76942.1| phosphoglycerate dehydrogenase [Blastopirellula marina DSM 3645]
          Length = 539

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 123/202 (60%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK ++N++ L   K G  +INCARGG+ DE AL   L+SG +     DV+  
Sbjct: 202 VHTPLTAETKGLINQDALEIIKPGARLINCARGGIYDEAALVAGLKSGKLGGVALDVYAA 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLFG+ NV C P+LGAST E+Q +VAI+    ++++L  G + +A+N+A I  +
Sbjct: 262 EPCTDSPLFGMENVVCTPHLGASTEEAQTQVAIEAVQLVTNHLNTGEIRHAVNVAPIDPK 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
               ++ ++ +A  +G F GQL    ++  ++ Y G  A  +T +L ++  AG++   + 
Sbjct: 322 TLDSMRGYLDVAYRIGLFAGQLHGGKLKACKLNYRGEVAGKDTKLLTASFCAGLLEQAMD 381

Query: 179 RVGANIISAPIIIKENAIILST 200
             GANII+A +++ E  + +ST
Sbjct: 382 EGGANIINAQMLLAERGVTIST 403


>gi|282163065|ref|YP_003355450.1| D-3-phosphoglycerate dehydrogenase [Methanocella paludicola SANAE]
 gi|282155379|dbj|BAI60467.1| D-3-phosphoglycerate dehydrogenase [Methanocella paludicola SANAE]
          Length = 526

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 117/198 (59%), Gaps = 3/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+++++       K GV +INCARGG++DE AL E L+SG VA A  DVFE 
Sbjct: 200 VHTPLIPETRHMISTPQFDMMKKGVRVINCARGGIIDEAALLEALKSGKVAGAALDVFEK 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + +PL   PNV   P+LGAST E+Q  VA+ +A Q+ +      V+ ALN+ I+  E
Sbjct: 260 EPPVGSPLLEQPNVIVTPHLGASTKEAQISVAVIIAEQVLNAFKGLPVTTALNIPIMKPE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               +KPF+ LA++LG F  Q++   IQE+ I Y G     +  ++  A + GI+  ++ 
Sbjct: 320 TMEKIKPFLPLAENLGKFTAQMVDGRIQEVDITYSGDITQKDVSLITIAAIKGILD-FKK 378

Query: 181 G--ANIISAPIIIKENAI 196
           G   N ++A  I K+  I
Sbjct: 379 GELVNYVNAKAIAKDYGI 396


>gi|20089481|ref|NP_615556.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina acetivorans C2A]
 gi|19914387|gb|AAM04036.1| phosphoglycerate dehydrogenase [Methanosarcina acetivorans C2A]
          Length = 523

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 115/197 (58%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+NIL+ E     KSGV I+NCARGG+++E AL   L+SG V  A  DVF  
Sbjct: 198 VHTPLIKETRNILDDEQFDLMKSGVRILNCARGGIINEAALVRALESGKVGGAALDVFVE 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL    NV   P+LGAST E+Q  VAI +A ++   L  G+  NA+N+  +  E
Sbjct: 258 EPPFGSPLLNFDNVIVTPHLGASTQEAQVNVAIDIAKEVVSVLTGGLAKNAINIPSVKPE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV-WR 179
              ++ P++ LA+ +G   GQL+  + ++++I Y+G  +  +T  L  + L G++ +   
Sbjct: 318 AMAVLAPYIRLAELMGKIAGQLVDSNYEKVEIGYNGEISGKDTRPLTVSALKGLLEMALG 377

Query: 180 VGANIISAPIIIKENAI 196
            G N ++AP + K   I
Sbjct: 378 AGVNYVNAPALAKSRQI 394


>gi|45359151|ref|NP_988708.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis S2]
 gi|45048026|emb|CAF31144.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis S2]
          Length = 523

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 114/197 (57%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KTK+++ KE ++  KS + I+NCARGGL+DE AL + L SG +  A  DVFE 
Sbjct: 199 LHVPLTPKTKHMIGKEQIALMKSNMVIMNCARGGLIDEAALYDALNSGKIKAAALDVFEQ 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PL  L N+   P+ GAST E+Q      +A Q    L      N +N+ ++  E
Sbjct: 259 EPPKESPLLTLNNLIGTPHQGASTEEAQLSAGTIVAEQTVKILKGESAENVVNLPMVPTE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           +   +KP+M LA+ +G    Q +  SI+ ++I Y G  A   T +L  + L GI+  +  
Sbjct: 319 KMKKLKPYMVLAEKMGSMAIQYLDNSIELLEITYMGGLAKEKTEILKRSFLKGILAPILL 378

Query: 180 VGANIISAPIIIKENAI 196
            G N+++AP+I K   I
Sbjct: 379 AGVNLVNAPVIAKSRNI 395


>gi|15678988|ref|NP_276105.1| D-3-phosphoglycerate dehydrogenase [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|3122860|sp|O27051|SERA_METTH RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|2622068|gb|AAB85466.1| phosphoglycerate dehydrogenase [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 525

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 121/207 (58%), Gaps = 1/207 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT +T+++++++     K    I+NCARGG++DE+AL   L+ G +A A  DVFE 
Sbjct: 201 IHVPLTPETRHLISEDEFKLMKDTAFIVNCARGGIIDEDALYRALKDGEIAGAALDVFEE 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL  L NV   P++GAST E+Q   AI +A+++      G   N LNM ++  E
Sbjct: 261 EPPEGSPLLELENVVLTPHIGASTSEAQRDAAIIVANEIKTVFQGGAPRNVLNMPVMDSE 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               +KP++ LA+ +G  I Q +  +I+++ + Y G  A M   +L   +L  I+  +  
Sbjct: 321 TYKSLKPYIELAEKMGAIIAQALPGNIEKLDVTYCGELAEMQFDILTRTMLQAILNPILT 380

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
              N+I+AP I K+  I+++  +R +S
Sbjct: 381 EPVNLINAPSIAKKRGIMVTEARRSES 407


>gi|258511215|ref|YP_003184649.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477941|gb|ACV58260.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 529

 Score =  140 bits (353), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 73/174 (41%), Positives = 106/174 (60%), Gaps = 1/174 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T ++++   +++ K GV IINCARGG++DE ALAE L++G VA A  DVFE 
Sbjct: 202 VHTPLTKETHHMIDAGRIAQMKEGVRIINCARGGIIDEVALAEALEAGRVAGAAIDVFEQ 261

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  + +PL   PNV   P+LGASTVE+QE VAIQ+A ++   L D    +A+N+  +S 
Sbjct: 262 EPLPMDHPLRRCPNVVLTPHLGASTVEAQENVAIQVAEEIVQVLRDDTFEHAVNLPSLSQ 321

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
            +   + P++ LA+ LG F  QL   +   + + Y G  A  +   L   VL G
Sbjct: 322 RQKERLAPYLALAEQLGLFAAQLAQGAPSSMTVRYAGDAADPDGGYLTRTVLKG 375


>gi|229543101|ref|ZP_04432161.1| D-3-phosphoglycerate dehydrogenase [Bacillus coagulans 36D1]
 gi|229327521|gb|EEN93196.1| D-3-phosphoglycerate dehydrogenase [Bacillus coagulans 36D1]
          Length = 541

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 117/197 (59%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PL  +TK+++N+  L+KTK GV IINCARGGLVDE AL + LQ G VA A  DVFE 
Sbjct: 201 LHTPLMKETKHLINEAFLAKTKKGVRIINCARGGLVDEQALLQALQEGRVAGAALDVFEN 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP +   L  LPNV   P+LGAST E+Q +VA  ++ ++        + NA+NM   S E
Sbjct: 261 EPDITPGLLELPNVTVTPHLGASTREAQVRVAADVSDEIIHIFESEEIRNAINMPQTSGE 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
               ++PF+ L + +     QL+ E+ ++I+I Y G     +T +L   ++ GI+ R   
Sbjct: 321 NRERMEPFLLLGEQVAQLGIQLLDEAPEKIEITYAGELLDEDTKLLTRTIIKGILARHLG 380

Query: 180 VGANIISAPIIIKENAI 196
              N+++A  ++KE  +
Sbjct: 381 STVNLVNALHLLKEQGL 397


>gi|218781218|ref|YP_002432536.1| D-3-phosphoglycerate dehydrogenase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762602|gb|ACL05068.1| D-3-phosphoglycerate dehydrogenase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 526

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 113/197 (57%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVP   +T  +LNK+  +K K GV +INCARGG+V+E  L + ++ G VA A  DVF  
Sbjct: 200 VHVPKMKETIGLLNKDAFAKMKKGVMVINCARGGIVEEADLYDAIKEGKVAGAALDVFAA 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP    PLF L NV C P+LGAST E+Q  VA+ +A Q+  YL  G V NA+N   ++ +
Sbjct: 260 EPPGMIPLFELDNVICTPHLGASTAEAQTNVAVAVAEQIIAYLQTGTVINAVNAPSVTGD 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               +KP +TL D +GC   QL    ++ + I Y G    ++   + +A+L G +    +
Sbjct: 320 LLEKLKPLLTLGDRMGCLQAQLAQGPVKSVSIEYYGDFRGLDLSPVTTAILKGFLTPALK 379

Query: 180 VGANIISAPIIIKENAI 196
              N ++A ++ +E  +
Sbjct: 380 DDVNFVNAGMLAQERGV 396


>gi|304406983|ref|ZP_07388637.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus curdlanolyticus
           YK9]
 gi|304343970|gb|EFM09810.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus curdlanolyticus
           YK9]
          Length = 530

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 120/200 (60%), Gaps = 5/200 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+++++ +     K G+ I+NCARGG++DE AL E +  G VA A FDVFEV
Sbjct: 201 VHTPLTPETRHMISSKQFEVMKKGMRIVNCARGGIIDEQALVEAVDQGIVAGAAFDVFEV 260

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  +P    P +   P+LGASTVE+QE VAI ++ Q+   L D    NA+NM  I  
Sbjct: 261 EPPAADHPFLTHPKIIVTPHLGASTVEAQENVAIDVSEQVLHILRDEPFINAVNMPPIPA 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
               +++P+ TL + LG F+ Q+   +++EI + Y G  A ++T  L   +  G++    
Sbjct: 321 NVRKILQPYFTLGEKLGNFVSQMTDGAVKEIVVSYSGDLAEVDTQPLTRYITRGVL-AHH 379

Query: 180 VGA---NIISAPIIIKENAI 196
           +GA   N++++  + KE ++
Sbjct: 380 LGADQVNVVNSMHLAKERSV 399


>gi|304437357|ref|ZP_07397316.1| phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369613|gb|EFM23279.1| phosphoglycerate dehydrogenase [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 563

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 127/208 (61%), Gaps = 2/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT +T+ +++   + + K GV ++NCARGG+++E+ LAE ++ G VA A  DVFE 
Sbjct: 234 VHMPLTKETRGMISMAQMRRMKQGVRLVNCARGGIINEHDLAEAVREGIVAGAAIDVFES 293

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  +PL  +P +   P+LGASTVE+Q  V++ +A  +   L    V  A+NMA +S 
Sbjct: 294 EPLAEDSPLRSVPGIVLTPHLGASTVEAQIGVSVDVAKGIRAALRGEPVLAAVNMAPVSK 353

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           E   +++P++ LA+ LGC    L    I +++++Y+G    +NT  L +A+L G++  + 
Sbjct: 354 EVMRVIRPYIALAEQLGCTACSLAEGPISQVEVVYNGEITEVNTSFLTTAILKGMLNPIL 413

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
               N ++AP + K   I +S I+  ++
Sbjct: 414 ESEINYVNAPSVAKSRGIKVSEIREKET 441


>gi|310642598|ref|YP_003947356.1| d-3-phosphoglycerate dehydrogenase [Paenibacillus polymyxa SC2]
 gi|309247548|gb|ADO57115.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus polymyxa SC2]
          Length = 530

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 107/176 (60%), Gaps = 1/176 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK+++ +      K G+ IINCARGG++DE AL E +  G VA A FDVFE 
Sbjct: 201 VHTPLTPETKHMIARPQFEVMKKGMRIINCARGGVIDEMALVEAIDEGIVAGAAFDVFES 260

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  Q+ P    P +   P+LGASTVE+QE VAI ++ Q+   L D    NA+NM  +  
Sbjct: 261 EPPAQDHPFLSHPKIIVTPHLGASTVEAQENVAIDVSEQVLHILRDEPFKNAVNMPPVPS 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
                ++P+ +L + LG F  Q+ +++++EIQ+ Y G  + ++T  L   +L G++
Sbjct: 321 NVMTQLQPYFSLGEKLGSFAAQITNQAVREIQVDYAGDLSSVDTQPLTRYILKGVL 376


>gi|308069541|ref|YP_003871146.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Paenibacillus polymyxa
           E681]
 gi|305858820|gb|ADM70608.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Paenibacillus polymyxa
           E681]
          Length = 530

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 107/176 (60%), Gaps = 1/176 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK+++ +      K G+ IINCARGG++DE AL E +  G VA A FDVFE 
Sbjct: 201 VHTPLTPETKHMIARPQFEVMKKGMRIINCARGGVIDEMALVEAIDEGIVAGAAFDVFES 260

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  Q+ P    P +   P+LGASTVE+QE VAI ++ Q+   L D    NA+NM  +  
Sbjct: 261 EPPAQDHPFLSHPKIIVTPHLGASTVEAQENVAIDVSEQVLHILRDEPFKNAVNMPPVPS 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
                ++P+ +L + LG F  Q+ +++++EIQ+ Y G  + ++T  L   +L G++
Sbjct: 321 NVMTQLQPYFSLGEKLGSFAAQITNQAVREIQVDYAGDLSSVDTQPLTRYILKGVL 376


>gi|323141567|ref|ZP_08076450.1| phosphoglycerate dehydrogenase [Phascolarctobacterium sp. YIT
           12067]
 gi|322413909|gb|EFY04745.1| phosphoglycerate dehydrogenase [Phascolarctobacterium sp. YIT
           12067]
          Length = 528

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 124/210 (59%), Gaps = 3/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ +LN E ++K K GV I+NCARGG +D  A+AE ++SG +A A  DV+  
Sbjct: 198 IHTPLTKETEKMLNAEAIAKMKDGVRIVNCARGGCMDPEAIAEGVKSGKIAGAAIDVYPT 257

Query: 61  EPALQ--NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  +  NP  GL NV   P+LGAST+E+Q  VA+ +A+ + D L    V  A+NMA I 
Sbjct: 258 EPLTKENNPFLGLFNVVQTPHLGASTIEAQIGVAVDVAYGVIDALEGRPVMTAVNMAPIP 317

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
              A +++P+  LA+ +G     L    I+ +++ Y G+ A   T  L +A L G++  +
Sbjct: 318 KSVAAVIQPYFKLAERMGTVGIYLADGPIKSVEVEYTGALAETETQALTTAFLKGLLNPI 377

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKSG 207
            +   N ++AP I K+  + +  +K +K G
Sbjct: 378 LQESVNFVNAPGIAKKRNLEVKEVKANKPG 407


>gi|148654451|ref|YP_001274656.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus sp. RS-1]
 gi|148566561|gb|ABQ88706.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus sp. RS-1]
          Length = 524

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 118/210 (56%), Gaps = 5/210 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPL + T+N+++   L++ K G  +IN ARGG+VDE AL E ++SGH+A A  D +  
Sbjct: 199 LHVPLIDATRNMIDAARLAQMKRGAYLINAARGGVVDEAALLEAIESGHLAGAALDTYST 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + NPL G P V   P+LGASTVE+Q    + +A  +   L  G    A+N   I  E
Sbjct: 259 EPPVGNPLVGHPRVITLPHLGASTVEAQALTGVDVAEGVLVALAGGSPHYAVNAPYIPPE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV---RV 177
              LV P++ L   LG     L+ + ++  +I Y G  A ++T  +  AVL G++   R 
Sbjct: 319 HRGLVAPYVDLGRRLGMLCAGLVRDPVRNFEIEYRGELATVDTTPVRLAVLQGLLATTRE 378

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKSG 207
            RV    ++AP++ +E  + L+    D++G
Sbjct: 379 ERV--TPVNAPLLARELGLKLTEFSTDEAG 406


>gi|311030775|ref|ZP_07708865.1| D-3-phosphoglycerate dehydrogenase [Bacillus sp. m3-13]
          Length = 524

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/198 (39%), Positives = 111/198 (56%), Gaps = 3/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK + NKEN+ + K GV ++NCARGG++DE AL   L +GHVA A  DVFEV
Sbjct: 198 VHTPLTKETKGLFNKENIPQLKKGVYLVNCARGGIIDEEALLHHLNTGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   + L    +V   P+LGAST E+Q  VA Q++  +  YL    V+ ++N+  I  E
Sbjct: 258 EPPTNHDLVQHEHVIVTPHLGASTKEAQYNVAFQVSKDVLAYLNGQSVNTSINLPTIPKE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++PF  L   LG  + Q     I+EI   Y G      T +L  +++AG +R  RV
Sbjct: 318 IYKKIQPFYQLGKTLGSILSQSAKTPIEEITATYAGVITEWETSILTKSIIAGFLR-NRV 376

Query: 181 GA--NIISAPIIIKENAI 196
               N ++A  I KE  I
Sbjct: 377 DTTVNEVNAATIAKERGI 394


>gi|150402759|ref|YP_001330053.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C7]
 gi|150033789|gb|ABR65902.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C7]
          Length = 523

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 114/197 (57%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KTK+++ K+ ++  KS + I+NCARGGL+DE AL + L SG +  AG DVFE 
Sbjct: 199 LHVPLTPKTKHMIGKDQIALMKSNMVIMNCARGGLIDEAALYDALSSGKIKAAGLDVFEQ 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL  L N+   P+ GAST E+Q      +A Q    L      N +N+ ++  E
Sbjct: 259 EPPKDSPLLTLNNLIGTPHQGASTEEAQLSAGTIVAEQTVKILKGESAENVVNLPMVPTE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           +   +KP+M LA+ +G    Q +  SI+ ++I Y G  A   T ++  + L GI+  +  
Sbjct: 319 KMKKLKPYMILAEKMGSMAIQYLDNSIELLEITYMGGLANEKTEIIKRSFLKGILAPILL 378

Query: 180 VGANIISAPIIIKENAI 196
            G N+++AP+I K   I
Sbjct: 379 AGVNLVNAPVIAKSRNI 395


>gi|327399776|ref|YP_004340645.1| D-3-phosphoglycerate dehydrogenase [Hippea maritima DSM 10411]
 gi|327182405|gb|AEA34586.1| D-3-phosphoglycerate dehydrogenase [Hippea maritima DSM 10411]
          Length = 529

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 120/208 (57%), Gaps = 4/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N+++KE + K K GV +INCARGGL +E AL E L+SG +   G DVFE 
Sbjct: 203 IHTPKTEETYNMIDKEEIEKMKDGVILINCARGGLYNEKALYEGLKSGKIRALGIDVFEN 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP L +PLF   NVF  P+LGA+T ESQ +V   +A  + D L      NA+N+ +   E
Sbjct: 263 EPQLNHPLFEFDNVFATPHLGANTYESQIRVGEGIARSVVDALKGRGYENAVNIKMEEEE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGS-TAVMNTMVLNSAVLAGIVR-VW 178
              L K F+ LA+ +G F+ Q I   I+ + I   G   +  N++ L S+V  GI++ + 
Sbjct: 323 ITELGKQFLGLAERMGSFLSQYIKSFIKRVTIYAHGEIESCTNSLGLFSSV--GILKNMI 380

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
               N ++AP + KE  + + T   DK+
Sbjct: 381 DEHVNYVNAPYLAKERGLEIETKIYDKA 408


>gi|238927354|ref|ZP_04659114.1| phosphoglycerate dehydrogenase [Selenomonas flueggei ATCC 43531]
 gi|238884636|gb|EEQ48274.1| phosphoglycerate dehydrogenase [Selenomonas flueggei ATCC 43531]
          Length = 565

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 127/208 (61%), Gaps = 2/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT +T+ +++   + + K GV ++NCARGG+++E+ LAE ++ G VA A  DVFE 
Sbjct: 236 VHMPLTKETRGMISMAQMRRMKQGVRLVNCARGGIINEHDLAEAVREGIVAGAAIDVFES 295

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  +PL  +P +   P+LGASTVE+Q  V++ +A  +   L    V  A+NMA +S 
Sbjct: 296 EPLAEDSPLRSVPGIVLTPHLGASTVEAQIGVSVDVAKGICAALRGEPVLAAVNMAPVSK 355

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           E   +++P++ LA+ LGC    L    I +++++Y+G    +NT  L +A+L G++  + 
Sbjct: 356 EVMRVIRPYIALAEQLGCTACSLAEGPISQVEVVYNGEITEVNTSFLTTAILKGMLNPIL 415

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
               N ++AP + K   I +S I+  ++
Sbjct: 416 ESEINYVNAPSVAKSRGIKVSEIREKET 443


>gi|159905466|ref|YP_001549128.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C6]
 gi|159886959|gb|ABX01896.1| D-3-phosphoglycerate dehydrogenase [Methanococcus maripaludis C6]
          Length = 523

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/197 (38%), Positives = 113/197 (57%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KTK+++ KE ++  KS + I+NCARGGL+DE AL + L  G +  AG DVFE 
Sbjct: 199 LHVPLTPKTKHMIGKEQIALMKSNMVIMNCARGGLIDEAALYDALSGGKIKAAGLDVFEQ 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL  L N+   P+ GAST E+Q      +A Q    L      N +N+ ++  E
Sbjct: 259 EPPKDSPLLTLNNLIGTPHQGASTEEAQLSAGTIVAEQTVKILKGESAENVVNLPMVPTE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           +   +KP+M LA+ +G    Q +  SI+ ++I Y G  A   T ++  + L GI+  +  
Sbjct: 319 KMKKLKPYMILAEKMGSMAIQYLDNSIELLEITYMGGLANEKTEIIKRSFLKGILAPILL 378

Query: 180 VGANIISAPIIIKENAI 196
            G N+++AP+I K   I
Sbjct: 379 AGVNLVNAPVIAKSRNI 395


>gi|219851104|ref|YP_002465536.1| D-3-phosphoglycerate dehydrogenase [Methanosphaerula palustris
           E1-9c]
 gi|219545363|gb|ACL15813.1| D-3-phosphoglycerate dehydrogenase [Methanosphaerula palustris
           E1-9c]
          Length = 532

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 120/211 (56%), Gaps = 4/211 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T +I+N  +++  K GV IINCARGG++DE AL   L SG +  A  DV+E 
Sbjct: 204 VHTPLMKETTHIINDASIATMKDGVRIINCARGGIIDEQALYRGLVSGKIGGAALDVYEH 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL  L  V   P+LGASTVE+Q  VAI +A Q    L  G   +A+N  +I  +
Sbjct: 264 EPPTDSPLIELDQVIMTPHLGASTVEAQINVAISVAKQCLSVLSGGSARSAVNAPMIPAD 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVM--NTMVLNSAVLAGIV-RV 177
           +   V+PF  LA+ +G  + QL+   ++ I+++Y G       NT  +    L GI+ R+
Sbjct: 324 QLEFVEPFAVLAEKMGRLLLQLVEGRLEAIELVYGGEFVERNSNTRFITRMALKGILDRL 383

Query: 178 WRVGANIISAPIIIKENAIILS-TIKRDKSG 207
             +  NI++A  +  E  I++S T+ R+  G
Sbjct: 384 LHLPVNIVNAEFVAHERGIVVSQTVTRESQG 414


>gi|218441675|ref|YP_002380004.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7424]
 gi|218174403|gb|ACK73136.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7424]
          Length = 527

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 82/212 (38%), Positives = 122/212 (57%), Gaps = 5/212 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T +++N+E L+K K  V IINCARGG++DE+ALAE LQ    A A  DVFE 
Sbjct: 199 LHIPKTPDTTHLINQEALAKMKPNVRIINCARGGVIDEDALAEFLQEHPDAGAALDVFEQ 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ L GLPNV   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  ++ +
Sbjct: 259 EPLGESKLRGLPNVILTPHLGASTAEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGLTPD 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
               ++P++ LA+ LG  + QL    I+++ +   G  A   T  +  A + G++    R
Sbjct: 319 VMEKLRPYLQLAETLGNLVAQLAGGRIEQLTVRLQGDLAANETQPIVVAAIKGLLSEALR 378

Query: 180 VGANIISAPIIIKENAIILSTIK----RDKSG 207
              N ++A I  KE  I +   +    RD SG
Sbjct: 379 ERVNYVNAAIEAKERGIRVIETRDASIRDYSG 410


>gi|225174433|ref|ZP_03728432.1| D-3-phosphoglycerate dehydrogenase [Dethiobacter alkaliphilus AHT
           1]
 gi|225170218|gb|EEG79013.1| D-3-phosphoglycerate dehydrogenase [Dethiobacter alkaliphilus AHT
           1]
          Length = 525

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/197 (42%), Positives = 122/197 (61%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT  TK++++ + L+  K GV IINCARGGL+DE AL E L+SG VA A  DVFE 
Sbjct: 198 MHTPLTKATKHMISHDELAIMKDGVRIINCARGGLIDEEALYEALKSGKVAGAALDVFEE 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL  L NV   P+LGAST E+Q  VA+Q+A Q+ + L    + +A+N+++I  E
Sbjct: 258 EPVTCNPLCELSNVIVTPHLGASTEEAQVNVAVQVAEQVVNALQGEPLVSAVNVSVIPPE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV-WR 179
               VKPF+ L   LG F  Q+ +  ++ ++I+Y G  A   T  L ++ L G++ V  +
Sbjct: 318 TLADVKPFIPLMKKLGSFYTQVFNGQVESVEILYSGEIANYPTTPLTNSFLIGLLSVILQ 377

Query: 180 VGANIISAPIIIKENAI 196
              N ++AP+I K+  I
Sbjct: 378 ETVNYVNAPVIAKQRGI 394


>gi|296123070|ref|YP_003630848.1| D-3-phosphoglycerate dehydrogenase [Planctomyces limnophilus DSM
           3776]
 gi|296015410|gb|ADG68649.1| D-3-phosphoglycerate dehydrogenase [Planctomyces limnophilus DSM
           3776]
          Length = 546

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 117/198 (59%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL+ +T N++  E L+K K GV IINCARGG+++E  LA+ ++SGH+  A  DVF  
Sbjct: 202 VHTPLSPETTNLIGAERLAKMKKGVRIINCARGGIINEAELAQAIESGHIGGAALDVFVK 261

Query: 61  EPAL-QNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    NPL  LP V C P+L AST E+QE VA++ A  M+ +L+   V +A+NMA IS 
Sbjct: 262 EPTPPDNPLLKLPQVLCTPHLAASTDEAQELVAVEAAEIMAGFLVRHEVRHAVNMAPISS 321

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
            E   ++ ++ L   LG  + QL    ++  ++ + G  A   T ++++A  AG++    
Sbjct: 322 AEMADMRIYLDLGLRLGVVLSQLNKSGVRSAKLTFRGEAATKKTKLISNAFAAGLLSSAL 381

Query: 179 RVGANIISAPIIIKENAI 196
               NI++A ++  E  I
Sbjct: 382 AENVNIVNAEMLAHERGI 399


>gi|258517404|ref|YP_003193626.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257781109|gb|ACV65003.1| D-3-phosphoglycerate dehydrogenase [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 526

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 119/197 (60%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T ++ +++N++ ++  K GV IINCARGG++DE AL   ++SG VA A  DVFE 
Sbjct: 200 IHMPKTKESYHLINEKTIAVMKDGVRIINCARGGIIDEEALYNAIKSGKVAGAALDVFEK 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PL+   NV   P+LGAST E+Q  VA+ +A ++   L   VV N +N+  +  +
Sbjct: 260 EPNTESPLYEFNNVIMTPHLGASTEEAQLNVAVDVAKEIVAALKGEVVKNTVNIPSLDAK 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               VKP++ LA  LG F  Q+I+  + +I++IY G  + +    + +A L G++  + +
Sbjct: 320 TMAAVKPYLDLAGRLGNFHAQMITGRVNKIELIYSGELSALEVTPITTAFLKGMLDPILQ 379

Query: 180 VGANIISAPIIIKENAI 196
              N ++A +I K   I
Sbjct: 380 ENVNFVNASVIAKNRGI 396


>gi|91202994|emb|CAJ72633.1| similar to D-3-phosphoglycerate dehydrogenase (PGDH) [Candidatus
           Kuenenia stuttgartiensis]
          Length = 535

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 115/197 (58%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HV L  +TKN++  +  S  K GV IINCARGG++ E  L   +++G VA A  DVFE 
Sbjct: 209 IHVTLNKETKNLITSKEFSLMKKGVQIINCARGGVICEEDLYNAIKTGQVAGAALDVFEE 268

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   N L  L  V   P+LGAST E+Q  VAI+ A QM+  L      NA+N++  S E
Sbjct: 269 EPPKDNKLLQLEEVIATPHLGASTEEAQYAVAIEAAEQMAAALTGKGYKNAVNLSPYSPE 328

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   +K ++ LA+ +G F+ Q+ +  IQ + I+Y G  +  N  ++  +++ G+++    
Sbjct: 329 EYASLKSYLALAEKMGSFLTQINNAGIQTLDIVYTGEISHKNIRIVTDSLIVGLLKPSLE 388

Query: 180 VGANIISAPIIIKENAI 196
            G N++SAP ++ E  I
Sbjct: 389 EGVNLVSAPTLLAERGI 405


>gi|182415332|ref|YP_001820398.1| D-3-phosphoglycerate dehydrogenase [Opitutus terrae PB90-1]
 gi|177842546|gb|ACB76798.1| D-3-phosphoglycerate dehydrogenase [Opitutus terrae PB90-1]
          Length = 529

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 120/206 (58%), Gaps = 6/206 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT+ TK ++++  L K K GV I NCARGG++ E AL   L+SG V  AG DV+E 
Sbjct: 200 VHMPLTDDTKYMIDEAALEKCKKGVRIFNCARGGIIKETALLAALKSGKVGAAGLDVYED 259

Query: 61  EPALQNPLF-GLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  F  LPNV   P+LGAST E+QE V I++A Q++D L  GV+ NA+N+  +  
Sbjct: 260 EPLAKDSEFRSLPNVVLTPHLGASTAEAQESVGIEIAEQIADVLNGGVIRNAVNVPSLDA 319

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
               ++ P++ L   LG  + Q+    I  ++I Y G    ++   +  +V  G +R  R
Sbjct: 320 NTVKVLGPYIDLGTKLGTLVQQISPAQIDLLKITYWGKIVDLDANAITRSVQRGYLR--R 377

Query: 180 VGA---NIISAPIIIKENAIILSTIK 202
           +     N ++AP++++   + +  +K
Sbjct: 378 ISGEEVNFVNAPVLLERLGVKVEVVK 403


>gi|150391963|ref|YP_001322012.1| D-3-phosphoglycerate dehydrogenase [Alkaliphilus metalliredigens
           QYMF]
 gi|149951825|gb|ABR50353.1| D-3-phosphoglycerate dehydrogenase [Alkaliphilus metalliredigens
           QYMF]
          Length = 526

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 120/204 (58%), Gaps = 1/204 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ +E     K GV ++NCARGG+++E ALA+ ++ G VA AG DV   
Sbjct: 200 VHTPKTEETFGMIGEEEFKVAKKGVRVVNCARGGIIEEEALAKAVKEGIVASAGLDVLVN 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   + L  L NV   P+LGA TVE+Q  V + +A ++   L   +V NA+N+  + ++
Sbjct: 260 EPNTTSLLLDLDNVIITPHLGADTVEAQNNVGVTIAQEVFSALKGKMVPNAVNLPTLQYQ 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   +K ++ L ++LG    QL  E+I++I+IIY G+ A M T V+  AVL GI   + +
Sbjct: 320 ELEAMKYYLKLGENLGKLYHQLEKEAIEKIEIIYSGAVADMETAVVTLAVLKGIFEPILK 379

Query: 180 VGANIISAPIIIKENAIILSTIKR 203
              N ++A +I K   I ++  K+
Sbjct: 380 ERVNYVNARLIAKNRGIAVTESKK 403


>gi|297619680|ref|YP_003707785.1| D-3-phosphoglycerate dehydrogenase [Methanococcus voltae A3]
 gi|297378657|gb|ADI36812.1| D-3-phosphoglycerate dehydrogenase [Methanococcus voltae A3]
          Length = 525

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 116/210 (55%), Gaps = 3/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KTK+++ KE L   K    I+NCARGGL+DE AL   L+   +  A  DVFE 
Sbjct: 201 LHVPLTPKTKHMIAKEQLDLMKPNTIIMNCARGGLIDEEALYNALKVNQIRGAALDVFEQ 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL  L NV   P+ GAST E+Q      +A Q    L      N +N+ ++  E
Sbjct: 261 EPPKGNPLLELDNVIGTPHQGASTEEAQISAGTIVARQAIKILKGESAENVVNLPMLPSE 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           +   +KP+M LA+ +G    QL+  +I  I+I Y G  A   T ++  + L GI+  +  
Sbjct: 321 KMNKIKPYMILAEKMGLMAIQLLDHTIDNIEITYLGELATEKTEMIKRSFLRGILSPILL 380

Query: 180 VGANIISAPIIIKENAIILS--TIKRDKSG 207
            G N+++AP++ K   I +S  T+K ++ G
Sbjct: 381 AGVNLVNAPVVAKNRNIKISEGTMKENQYG 410


>gi|150400998|ref|YP_001324764.1| D-3-phosphoglycerate dehydrogenase [Methanococcus aeolicus
           Nankai-3]
 gi|150013701|gb|ABR56152.1| D-3-phosphoglycerate dehydrogenase [Methanococcus aeolicus
           Nankai-3]
          Length = 523

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 114/197 (57%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KTK+++ KE +S  K    I+NCARGGL+DE AL + + +  +  AG DVFE 
Sbjct: 199 LHVPLTPKTKHMIGKEQISLMKPNTIIVNCARGGLIDEEALYDAINNKKIGGAGLDVFEE 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL  L      P+ GASTVE+Q+     +A Q+   L      N +N+  +  +
Sbjct: 259 EPPKDNPLLTLDKFIGTPHQGASTVEAQKSAGTVVAEQVVKILAGKPADNIVNLPRMPTD 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           +   + P+M LA+ +G  I QL+ +S++++++ Y G  A  +T ++  + L G++  +  
Sbjct: 319 KMNKLNPYMALAEKMGNMIIQLLDKSVEKVELTYSGELASEDTEMVKRSFLMGLLSPILL 378

Query: 180 VGANIISAPIIIKENAI 196
            G N+++AP I K   I
Sbjct: 379 AGVNLVNAPTIAKNRNI 395


>gi|251796380|ref|YP_003011111.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. JDR-2]
 gi|247544006|gb|ACT01025.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. JDR-2]
          Length = 530

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 108/176 (61%), Gaps = 1/176 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T++++ K+     K G+ IINCARGG++DE AL E + +G VA A FDVFEV
Sbjct: 201 VHTPLTPETRHMIGKKQFEVMKPGMRIINCARGGIIDELALVEAIDAGIVAGAAFDVFEV 260

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++ P    P +   P+LGASTVE+QE VAI ++ Q+   L +   SNA+NM  I  
Sbjct: 261 EPPTEDHPFLTHPKIIVTPHLGASTVEAQENVAIDVSEQVLHILRNEPFSNAVNMPPIPA 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
                ++P+ +L + LG  + Q+   ++QEI + Y G  A ++T  L   ++ G++
Sbjct: 321 NLQSKLQPYYSLGEKLGSLVAQITEGAVQEITVRYSGELAEVDTQPLTRYIVKGVL 376


>gi|218247173|ref|YP_002372544.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8801]
 gi|257060245|ref|YP_003138133.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8802]
 gi|218167651|gb|ACK66388.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8801]
 gi|256590411|gb|ACV01298.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 8802]
          Length = 525

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 123/212 (58%), Gaps = 5/212 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T +T +++N E L+K K    IINCARGG++DENALA+ + SG +A A  DVFE 
Sbjct: 199 LHVPKTPETAHLINAEALAKMKPTTRIINCARGGIIDENALADAIASGQIAGAALDVFEE 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ L GL NV   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  ++ +
Sbjct: 259 EPLGESKLRGLENVILTPHLGASTAEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGLTPD 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
               ++P++ LA+ LG  +GQL    I+ + +   G  A   +  L  A + G++ +  R
Sbjct: 319 VMEKLRPYLQLAETLGNLVGQLAGGRIERLTVRLQGELATNKSQPLVVASIKGLLSQALR 378

Query: 180 VGANIISAPIIIKENAIIL----STIKRDKSG 207
              N ++A I  +E  I +       +RD SG
Sbjct: 379 ERVNYVNAAIEAQERGIRVIETRDAAQRDYSG 410


>gi|218289859|ref|ZP_03494049.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218239999|gb|EED07185.1| D-3-phosphoglycerate dehydrogenase [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 529

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 73/174 (41%), Positives = 105/174 (60%), Gaps = 1/174 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T ++++   ++  K GV IINCARGG++DE ALAE L++G VA A  DVFE 
Sbjct: 202 VHTPLTKETHHMIDVGRIALMKEGVRIINCARGGIIDEVALAEALEAGRVAGAAIDVFEQ 261

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  + +PL   PNV   P+LGASTVE+QE VAIQ+A ++   L D    +A+N+  +S 
Sbjct: 262 EPLPMDHPLRRCPNVVLTPHLGASTVEAQENVAIQVAEEIVQVLRDDTFEHAVNLPSLSQ 321

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
            +   + P++ LA+ LG F  QL   +   + + Y G  A  +   L   VL G
Sbjct: 322 RQKERLAPYLALAEQLGLFAAQLAQGAPSSMTVRYAGDAADPDGGYLTRTVLKG 375


>gi|124486358|ref|YP_001030974.1| D-3-phosphoglycerate dehydrogenase [Methanocorpusculum labreanum Z]
 gi|124363899|gb|ABN07707.1| D-3-phosphoglycerate dehydrogenase [Methanocorpusculum labreanum Z]
          Length = 527

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 119/201 (59%), Gaps = 3/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T +++NKE+++  K+GV +INCARGG++DE  L + + SG VA A  DVFE 
Sbjct: 200 VHTPLIPSTTHLVNKESIATMKTGVRMINCARGGIIDEKDLYDAIVSGKVAGAALDVFET 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PL  L +V   P+LGASTVE+Q+ VAI +AHQ  D L  G   +A+N  +++ E
Sbjct: 260 EPPTESPLLKLDSVIVTPHLGASTVEAQKNVAISVAHQCIDVLKGGSAKSAVNAPLVTPE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVM--NTMVLNSAVLAGIV-RV 177
               + P+  LA+ +G    Q+   +I E++  Y G  A +  N   +    + G++ +V
Sbjct: 320 VKSKIDPYALLAEKMGSLAAQIADGAITEVEFAYLGEIADLKQNLKYVTRLGIKGMLEQV 379

Query: 178 WRVGANIISAPIIIKENAIIL 198
               ANI++A II +   I +
Sbjct: 380 LHEPANIVNAEIIAQGRGITI 400


>gi|298674284|ref|YP_003726034.1| D-3-phosphoglycerate dehydrogenase [Methanohalobium evestigatum
           Z-7303]
 gi|298287272|gb|ADI73238.1| D-3-phosphoglycerate dehydrogenase [Methanohalobium evestigatum
           Z-7303]
          Length = 525

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 115/197 (58%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT  T+N++N +  +  K GV ++NCARGG+++E+ALAE L+SG VA A  DVF  
Sbjct: 198 VHTPLTKGTENLINADKFALMKDGVRVLNCARGGIINEDALAEALRSGKVAGAAIDVFVE 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PL    NV   P+LGAST E+Q  VA   A ++   L  G V+NA+N+  +  E
Sbjct: 258 EPPFESPLLDFDNVITTPHLGASTEEAQVNVAEAAADEVISALTGGPVNNAINIPTVKPE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
             P + P++ LA+ +G F GQL++ + + +++ Y G     +   +  A L GI+     
Sbjct: 318 MMPALTPYLKLAETMGKFAGQLMTGNYKRVELEYSGDILDKDIKPVTVAALKGILENALG 377

Query: 180 VGANIISAPIIIKENAI 196
            G N ++A  + K   I
Sbjct: 378 PGVNFVNANSLAKSRKI 394


>gi|158522823|ref|YP_001530693.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
 gi|158511649|gb|ABW68616.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus oleovorans Hxd3]
          Length = 532

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 105/175 (60%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVP   +T  +LNK    K K+GV ++NCARGG+VDE  L + L SG VA A  DVF  
Sbjct: 203 VHVPKLKQTVGLLNKAAFEKMKTGVMVLNCARGGIVDEADLYDALMSGRVAAAALDVFVT 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PL  L NV   P+LGAST E+Q  VA   AHQ+ ++L +  V NA+N+  +S +
Sbjct: 263 EPPGEHPLLKLDNVIATPHLGASTKEAQVNVAEAAAHQIIEFLKNNTVINAVNLPAVSGD 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
               + PF TLAD +G  + Q    +I EI+I Y+G    ++   + +A + G++
Sbjct: 323 LLEKLSPFTTLADRMGRLLAQFSGANITEIKIEYNGDFQGLDLAPVTTAAVKGLL 377


>gi|284161805|ref|YP_003400428.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus profundus DSM
           5631]
 gi|284011802|gb|ADB57755.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus profundus DSM
           5631]
          Length = 525

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 122/209 (58%), Gaps = 1/209 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVP T +T+ +++ +     K GV IIN ARGG+VDE AL + L SG VA A  DV+E 
Sbjct: 199 IHVPKTKETEKMISYKEFEIMKDGVYIINAARGGIVDEKALYDALVSGKVAGAALDVYEK 258

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  + NPL  L NV   P++GAST E+Q  V + +A  + ++     V NA+N+  I+ 
Sbjct: 259 EPPDKDNPLLKLENVVTTPHIGASTREAQMMVGMTVAEDIVNFFKGLPVKNAVNLPSIAP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           E+   + PF+ LA+ +G      ++    +++I + G  A  NT ++  A+L G++    
Sbjct: 319 EDYNFLMPFVELAEKIGKIACARLNGVFNKVKITFRGEIAKRNTEIVTRALLKGLLSQIL 378

Query: 180 VGANIISAPIIIKENAIILSTIKRDKSGV 208
            G NI+SAPI+ KE  I++   K ++S V
Sbjct: 379 SGVNIVSAPIVAKERGIVVEQSKIEESHV 407


>gi|150399650|ref|YP_001323417.1| D-3-phosphoglycerate dehydrogenase [Methanococcus vannielii SB]
 gi|150012353|gb|ABR54805.1| D-3-phosphoglycerate dehydrogenase [Methanococcus vannielii SB]
          Length = 523

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/199 (38%), Positives = 109/199 (54%), Gaps = 1/199 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT KTK+++ K      K+   IINCARGGL+DENAL + +  G V  AG DVFE 
Sbjct: 199 LHVPLTTKTKHMIGKTQFDLMKNNTIIINCARGGLIDENALYDAINCGKVKAAGLDVFEE 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  +NPL  L  +   P+ GAST E+Q      +A Q    L      N +N+ ++  E
Sbjct: 259 EPPTKNPLISLNGLIGTPHQGASTEEAQLSAGTIVAEQTVKILKGESAENVVNLPMVPTE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           +   + P++ LA+ +G    Q +  SI  ++I Y G  A   T +L  A L GI+  +  
Sbjct: 319 KMKKLMPYLVLAEKMGSMSIQYLDNSIDIVEITYMGDLAKEKTEMLKRAFLKGILSPILL 378

Query: 180 VGANIISAPIIIKENAIIL 198
            G N+++AP+I K   I L
Sbjct: 379 AGVNLVNAPVIAKNRNIRL 397


>gi|156740285|ref|YP_001430414.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus castenholzii DSM
           13941]
 gi|156231613|gb|ABU56396.1| D-3-phosphoglycerate dehydrogenase [Roseiflexus castenholzii DSM
           13941]
          Length = 524

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 114/210 (54%), Gaps = 5/210 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPL + T+N++N   L++ K G  +IN ARGG+VDE AL E +  GH+A A  D +  
Sbjct: 199 LHVPLIDSTRNLINAMRLAQMKRGAYLINAARGGVVDETALLEAINGGHLAGAALDTYST 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + NPL G P V   P+LGASTVE+Q    + +A  +   L  G    A+N   I  E
Sbjct: 259 EPPVGNPLVGHPRVITLPHLGASTVEAQALTGVDVAEGVLVALSGGSPHYAVNAPYIPPE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV---RV 177
              LV P++ L   LG     L+ + +   +I Y G  A ++T  +  AVL G++   R 
Sbjct: 319 HRGLVAPYVDLGRRLGMLCAGLVHDPVHNFEIEYRGELATVDTTPVRLAVLQGLLAGTRE 378

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKSG 207
            RV    ++API+ +E  + L+    + +G
Sbjct: 379 ERV--TPVNAPILARELGLKLTEFSTEDAG 406


>gi|73668955|ref|YP_304970.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina barkeri str.
           Fusaro]
 gi|72396117|gb|AAZ70390.1| D-3-phosphoglycerate dehydrogenase [Methanosarcina barkeri str.
           Fusaro]
          Length = 523

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 117/197 (59%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+NIL++E  +  K    I+NCARGG+++E ALA+ L+SG +A A  DVF  
Sbjct: 198 VHTPLIKETRNILDEEQFALMKPTTRILNCARGGIINEEALAKALESGKIAGAAIDVFIE 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL    NV   P+LGAST E+Q  VA+ +A +++  L  G   NA+N+  +  E
Sbjct: 258 EPPFNSPLLSFDNVVVTPHLGASTKEAQVNVAVDIAKEVASVLTGGPAKNAINIPSVKPE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV-WR 179
              ++ P++ L++ +G   GQL+  + ++++I Y+G  +  +T  L  + L G++ +   
Sbjct: 318 AMAVLAPYIRLSEIMGKIAGQLVDGNYEKVEIGYNGEISGKDTRPLTVSALKGLLEMALG 377

Query: 180 VGANIISAPIIIKENAI 196
            G N ++AP + K   I
Sbjct: 378 SGVNYVNAPTLAKSRMI 394


>gi|168700983|ref|ZP_02733260.1| phosphoglycerate dehydrogenase [Gemmata obscuriglobus UQM 2246]
          Length = 539

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 81/210 (38%), Positives = 127/210 (60%), Gaps = 4/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP   +TK+++    L   K    ++N ARGG++DE ALAE L +G +A AG DVF V
Sbjct: 201 LHVPGGAETKSMVGARELGLMKKTARVLNVARGGIIDEKALAEALAAGTIAGAGVDVFSV 260

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  NPL   PN+   P+LGAST+E+QE VA++ A  + D+L+ G V+NA+NMA ++ 
Sbjct: 261 EPIAADNPLAKAPNIVITPHLGASTLEAQENVAVEAAQLIKDFLLSGQVANAVNMAAVNP 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
            E   V+P++ LA  LG    Q+   +I++  + Y G  A   T +L +A  AG++  +R
Sbjct: 321 AELAEVRPYVDLARRLGLLQAQVAQGAIRKASLTYRGELAGQKTKLLTAAFTAGMLE-YR 379

Query: 180 V--GANIISAPIIIKENAIILSTIKRDKSG 207
           +  G N+++A ++ ++  I ++     K G
Sbjct: 380 LSEGVNLVNADVLARDRGIEIAESSSPKKG 409


>gi|323489160|ref|ZP_08094392.1| D-3-phosphoglycerate dehydrogenase [Planococcus donghaensis MPA1U2]
 gi|323397047|gb|EGA89861.1| D-3-phosphoglycerate dehydrogenase [Planococcus donghaensis MPA1U2]
          Length = 528

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 106/176 (60%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +TK+++NKE     K GV I+NCARGG++DENAL + ++SG VA A  DVFE 
Sbjct: 202 VHTPLLKETKHLINKEAFEIMKDGVQIVNCARGGIIDENALYDAVKSGKVAGAALDVFEQ 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP +   L  LP +   P+LGAST E+QE VA+ ++  +  Y   G V N++N+  +  E
Sbjct: 262 EPMVDFRLLDLPEIIATPHLGASTFEAQESVAVDVSVDVVSYFTTGTVRNSVNLPSVPKE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR 176
               ++P+  L++ LG F+  L   + +E+ + Y G  A M+   L   +L G+++
Sbjct: 322 IMKKIEPYFDLSERLGAFLTDLAGATAEEVTVRYAGELANMDVRPLTRNMLKGMLK 377


>gi|167036576|ref|YP_001664154.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320115004|ref|YP_004185163.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166855410|gb|ABY93818.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319928095|gb|ADV78780.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 531

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 116/204 (56%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK +L+++   K K GV I+N ARGG++DE AL   ++ G VA AG DV EV
Sbjct: 198 IHLPKTEETKKMLSEKEFKKMKKGVRIVNAARGGIIDEKALYNAIKEGIVAAAGLDVLEV 257

Query: 61  EPA-------LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP          NPL  LPNV   P+LGAST E+QE + I +A ++   L   +  N +N
Sbjct: 258 EPKYNVERQDFNNPLLELPNVVFTPHLGASTYEAQENIGISIAQEVISALNGNLYGNIVN 317

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +  +  +E   +KP+M LA+ +G F  Q+    ++ +++IY G  +  NT ++    L G
Sbjct: 318 LPGVKSDEFSQLKPYMKLAEAMGAFYYQINDTPVRLVEVIYRGEISKTNTDIVTLYALKG 377

Query: 174 IVR-VWRVGANIISAPIIIKENAI 196
            ++ V     ++++A +  KE  I
Sbjct: 378 FLKPVLEEDVSVVNAKLRAKEMGI 401


>gi|325290387|ref|YP_004266568.1| D-3-phosphoglycerate dehydrogenase [Syntrophobotulus glycolicus DSM
           8271]
 gi|324965788|gb|ADY56567.1| D-3-phosphoglycerate dehydrogenase [Syntrophobotulus glycolicus DSM
           8271]
          Length = 527

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 123/208 (59%), Gaps = 2/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVP T  TK++LN+E  ++ K GV IINCARGG++DE AL + L++G V+    D FE 
Sbjct: 198 IHVPFTVDTKHLLNEEAFAQMKKGVRIINCARGGIIDEKALFKALENGIVSGVALDAFEQ 257

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  NPL   P+V C P++   T E+Q +VA+++A ++   L    V+ +LN+  +S 
Sbjct: 258 EPLATDNPLLNRPDVICTPHIANWTHEAQNEVAVRVAREVLAALRAEPVTTSLNIPPVSK 317

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
                +KP++ L + +G     L    I+ I++ Y+G  + ++T +L  A++ G++  + 
Sbjct: 318 ASMETIKPYINLVEKMGVLAVHLAEGRIKSIEMKYNGEVSQVDTKMLTLAIVKGVLNPIL 377

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
           +   N ++AP + K   I +S IK  ++
Sbjct: 378 QEAVNFVNAPEVAKSRGITVSEIKSQET 405


>gi|297616224|ref|YP_003701383.1| D-3-phosphoglycerate dehydrogenase [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297144061|gb|ADI00818.1| D-3-phosphoglycerate dehydrogenase [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 528

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 115/207 (55%), Gaps = 1/207 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T  ++ +  L+  K GV ++NCARGG+++E AL + L+SG VA AG DVF+ 
Sbjct: 202 VHTPKNEETYGMIGERELAMCKDGVRVVNCARGGIINEKALVDALRSGKVASAGLDVFDE 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPLF   NV   P+LGA TVE+Q +V + +A Q+   L   +V N +N+  +  E
Sbjct: 262 EPAYNNPLFEFKNVVVTPHLGADTVEAQRRVGVNIAEQVIMGLKGELVPNVVNLPTVLRE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   ++P++ LA  +G    Q+    +  +++ + G  A   T +L  A L G++  V  
Sbjct: 322 ELETLRPYIDLARAMGSMYYQMEKAPVDRVELGFSGEIANQETGLLTIAFLTGLLSGVMS 381

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
              N ++A I  +E  I +   K DK 
Sbjct: 382 EKINYVNARIKAEERGIKVFEKKEDKK 408


>gi|218516339|ref|ZP_03513179.1| D-3-phosphoglycerate dehydrogenase [Rhizobium etli 8C-3]
          Length = 231

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 84/110 (76%)

Query: 99  MSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGST 158
           M+DYL+ G VSNA+NM  I+ EEAP++KPF+ LAD LG F+GQ+  E I+EI+I+YDG T
Sbjct: 1   MADYLVKGAVSNAINMPSITAEEAPILKPFIRLADVLGAFVGQVTEEPIKEIEILYDGIT 60

Query: 159 AVMNTMVLNSAVLAGIVRVWRVGANIISAPIIIKENAIILSTIKRDKSGV 208
           A MNT  L SA LAG++R      N++SAPI+IKE  I+LS +KRDK+GV
Sbjct: 61  ANMNTRALTSAALAGLIRSQVADVNMVSAPIMIKEKGIVLSEVKRDKTGV 110


>gi|312137068|ref|YP_004004405.1| d-3-phosphoglycerate dehydrogenase [Methanothermus fervidus DSM
           2088]
 gi|311224787|gb|ADP77643.1| D-3-phosphoglycerate dehydrogenase [Methanothermus fervidus DSM
           2088]
          Length = 526

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 120/208 (57%), Gaps = 2/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT +TK+++++  L   K+   IINCARGG++DE AL E L++  +A A  DVFE 
Sbjct: 199 IHVPLTKETKHLISRRELKMMKNSAYIINCARGGIIDEEALIEALENNEIAGAALDVFEE 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL    NV   P++GASTVE+Q   AI +A+++          N +NM  +  E
Sbjct: 259 EPPSDSPLLEFDNVVLTPHIGASTVEAQRDAAIIVANEIKRIFDGKPPQNVINMPSLDRE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTM-VLNSAVLAGIVR-VW 178
              L+KP++ L + +G  I QL  + I+ + ++Y G  +   ++ VL   +L  I+  + 
Sbjct: 319 SFKLLKPYIELCEKMGLMITQLAPDKIKSLNVVYAGEISEFKSLDVLTRTLLQNILNPIL 378

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
               NI++A  I ++  I+++  +R K+
Sbjct: 379 TEPVNIVNAHTIAEKRGIVVTESRRPKA 406


>gi|108803680|ref|YP_643617.1| D-3-phosphoglycerate dehydrogenase [Rubrobacter xylanophilus DSM
           9941]
 gi|108764923|gb|ABG03805.1| D-3-phosphoglycerate dehydrogenase [Rubrobacter xylanophilus DSM
           9941]
          Length = 527

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 114/207 (55%), Gaps = 1/207 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T +T  ++ +E L++ K    +IN ARGG+VDE AL   L+ G +A A  DVF  
Sbjct: 199 LHVPRTPQTTGMVGEEELARMKPTAYLINVARGGIVDETALYNALKQGEIAGAALDVFAE 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LPNV   P+LGAST E+Q++  +  A Q++  L   V  +A+N  + + E
Sbjct: 259 EPTTDSPLFALPNVVVTPHLGASTAEAQDRAGVTAAEQVAAALRGEVPIHAINAPVPAGE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
            A  V  F  L + LG  + QL       ++I Y G     +T +L+ +V  G++ R+  
Sbjct: 319 GAEFVSQFAGLCETLGRLLYQLTDRPGSRLKIEYRGEIGAYDTRLLDVSVQKGLLSRMVH 378

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
              N ++ PI+ KE  + + T K  +S
Sbjct: 379 EPLNYVNTPILAKERGLKVETSKTSES 405


>gi|307152719|ref|YP_003888103.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7822]
 gi|306982947|gb|ADN14828.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7822]
          Length = 525

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 117/197 (59%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T +++N+E L+K K  V IINCARGG++DE+ALAE L +G +  A  DVFE 
Sbjct: 199 LHIPKTQETAHLINREALAKMKPTVRIINCARGGVIDEDALAEFLAAGKIGGAALDVFEQ 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ L  L N+   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  ++ +
Sbjct: 259 EPLGESKLRELTNIILTPHLGASTAEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGLTPD 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
               ++P++ LA+ LG  + QL    I+++ I   G  A   T  +  A + G++ +  R
Sbjct: 319 VMEKLRPYLQLAETLGNLVAQLAGGRIEQLTIRLQGDLASNETQPIVVAAIKGLLSQALR 378

Query: 180 VGANIISAPIIIKENAI 196
              N ++A I  KE  I
Sbjct: 379 ERVNYVNAAIEAKERGI 395


>gi|91774294|ref|YP_566986.1| D-3-phosphoglycerate dehydrogenase [Methanococcoides burtonii DSM
           6242]
 gi|91713309|gb|ABE53236.1| D-3-phosphoglycerate dehydrogenase [Methanococcoides burtonii DSM
           6242]
          Length = 523

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 117/209 (55%), Gaps = 3/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+NIL+K      KS   +INCARGG+++E ALA+  ++G +A A  DVF  
Sbjct: 198 VHTPLIKETRNILDKAQFDMMKSSTRVINCARGGIINEEALADAARNGKIAGAAIDVFTS 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP    P  GL NV   P+LGAST E+Q  VA+ +A ++   L  G   N +N+  +  E
Sbjct: 258 EPPFDCPFIGLDNVIVTPHLGASTEEAQVNVAVSVAEEIISVLNGGSARNTINIPAVKPE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
              ++ P++ LA+ LG    QL+  +  +I+I Y+G  A  +T  +  A L GI+    V
Sbjct: 318 VMAILAPYIGLAETLGSVAAQLLDANYNKIEISYNGEIADKDTRAVTVAALKGILE-DAV 376

Query: 181 GA--NIISAPIIIKENAIILSTIKRDKSG 207
           G+  N ++AP + K   + +   K + SG
Sbjct: 377 GSAVNYVNAPSLAKSRNVEVVESKSETSG 405


>gi|78189340|ref|YP_379678.1| D-3-phosphoglycerate dehydrogenase [Chlorobium chlorochromatii
           CaD3]
 gi|78171539|gb|ABB28635.1| D-3-phosphoglycerate dehydrogenase [Chlorobium chlorochromatii
           CaD3]
          Length = 538

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 79/200 (39%), Positives = 111/200 (55%), Gaps = 2/200 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H  L   T N+L KE LS TK GV I+NCARGG+++E ALAE L SGHVA A  DVF  
Sbjct: 211 IHSALDESTYNLLGKETLSLTKPGVIIVNCARGGIINEVALAEALASGHVAAAALDVFTK 270

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  +PL   P V   P++ AST E QEKVAIQ+A Q+  +  DG++  A+N  I+  
Sbjct: 271 EPIAATHPLLQFPQVIATPHISASTAEGQEKVAIQMAEQIIAWKRDGILEGAINGTIVEL 330

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG-IVRVW 178
            + P    ++ LA+ LG  + Q      + I +   G         L++AVL G + +  
Sbjct: 331 AQLPGAHAYLHLAEKLGATLAQCTPLDGKHITMKTSGEFLYTFHEALSAAVLKGFLAKRH 390

Query: 179 RVGANIISAPIIIKENAIIL 198
               N ++A ++ +E  I L
Sbjct: 391 AKSCNYLNAFLVAQEYGITL 410


>gi|304315109|ref|YP_003850256.1| phosphoglycerate dehydrogenase [Methanothermobacter marburgensis
           str. Marburg]
 gi|302588568|gb|ADL58943.1| phosphoglycerate dehydrogenase [Methanothermobacter marburgensis
           str. Marburg]
          Length = 525

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 118/207 (57%), Gaps = 1/207 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT +TK++++++     K    I+NCARGG++DE AL   L+ G +A A  DVFE 
Sbjct: 201 IHVPLTPETKHLISEDEFKLMKETAFIVNCARGGIIDEEALYRALRDGEIAGAALDVFEE 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   + L  L NV   P++GAST E+Q   AI +A+++      G   N LNM ++  E
Sbjct: 261 EPPEGSSLLELENVVLTPHIGASTAEAQRDAAIIVANEIKTVFQGGSPRNVLNMPVMDQE 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               ++P+  +A+ LG  I Q +  +I+++ + Y G  A M   +L   +L  I+  +  
Sbjct: 321 TYKSLRPYTEIAEKLGSIITQALPGNIEKLDVTYCGELADMQFDILTRTMLQAILNPILT 380

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
              N+I+AP I K+  I+++  +R ++
Sbjct: 381 EPVNLINAPAIAKKRGIVVTEARRSEA 407


>gi|326390875|ref|ZP_08212427.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325993134|gb|EGD51574.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 533

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 116/204 (56%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK +L+++   K K GV I+N ARGG++DE AL   ++ G VA AG DV EV
Sbjct: 198 IHLPKTEETKKMLSEKEFKKMKKGVRIVNVARGGIIDEKALYNAIKEGIVAAAGLDVLEV 257

Query: 61  EPA-------LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP          NPL  LPNV   P++GAST E+QE + I +A ++   L   +  N +N
Sbjct: 258 EPKYNVERQDFNNPLLELPNVVFTPHIGASTYEAQENIGISIAQEVISALNGNLYGNIVN 317

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +  +  +E   +KP+M LA+ +G F  Q+    ++ +++IY G  +  NT ++    L G
Sbjct: 318 LPGVKSDEFSQLKPYMKLAEAMGAFYYQINDTPVRLVEVIYRGEISKTNTDIVTLYALKG 377

Query: 174 IVR-VWRVGANIISAPIIIKENAI 196
            ++ V     ++++A +  KE  I
Sbjct: 378 FLKPVLEEDVSVVNAKLRAKEMGI 401


>gi|167629222|ref|YP_001679721.1| d-3-phosphoglycerate dehydrogenase [Heliobacterium modesticaldum
           Ice1]
 gi|167591962|gb|ABZ83710.1| d-3-phosphoglycerate dehydrogenase [Heliobacterium modesticaldum
           Ice1]
          Length = 526

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 96/159 (60%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T  T  +++    +  K GV I+NCARGG++DE AL + +QSG VA AG DVFE 
Sbjct: 200 VHMPKTKDTYRMISAAQFAIMKEGVRIVNCARGGIIDEQALYDAIQSGKVAAAGLDVFEK 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L  V   P+LGAST E+Q  VAI +A+ +   L    VS A+N+  +  E
Sbjct: 260 EPCTDSPLFALDQVTATPHLGASTKEAQVNVAIDVAYDILRVLRGEAVSAAVNIPAVKQE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTA 159
              + KP++ L + +G ++GQ I   I+++ I + G  A
Sbjct: 320 MMTIFKPYLNLVEKMGSYLGQTIGNRIEKVAITFKGDVA 358


>gi|111023450|ref|YP_706422.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
 gi|110822980|gb|ABG98264.1| phosphoglycerate dehydrogenase [Rhodococcus jostii RHA1]
          Length = 531

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/207 (37%), Positives = 113/207 (54%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK +L  ENL+KTK GV I+N ARGGL+DE ALAE ++SGHV  AG DVFE 
Sbjct: 204 VHLPKTPETKGLLGTENLAKTKKGVVIVNAARGGLIDEAALAEAIKSGHVRAAGLDVFET 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V +A+N++  +  
Sbjct: 264 EPCTDSPLFDLPEVVVTPHLGASTTEAQDRAGTDVAKSVLLALAGDFVPDAVNVSGGAVG 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V P++ +    G  IG L  E    + +   G  A  +  VL  + L G+   V  
Sbjct: 324 EE--VAPWLEIVRKQGVLIGALSGELPVNLSVDVRGELASEDVEVLALSALRGVFSAVIE 381

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
                ++AP + +E  +     K  +S
Sbjct: 382 DAVTFVNAPALAEERGVTAEVTKAAES 408


>gi|116620780|ref|YP_822936.1| D-3-phosphoglycerate dehydrogenase [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223942|gb|ABJ82651.1| D-3-phosphoglycerate dehydrogenase [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 525

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 117/189 (61%), Gaps = 2/189 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHV  T +T+ +L++E  ++ K GV I+NCARG LVDE ALAE L SG VA+A  DVF V
Sbjct: 197 LHVAATPETQGMLSREAFAQMKDGVRIVNCARGELVDEAALAEALASGKVADASLDVFSV 256

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP     PLF L  V   P++G ST E+QE V +++A Q+ +YL  G+ +NA+NM  +S 
Sbjct: 257 EPPPAGFPLFALNGVLATPHIGGSTEEAQEIVGVRIAEQVVEYLTHGMATNAVNMPPMSP 316

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
           E+   + P+ TLAD LG F   + +     +++ Y G  A   T +L +A LAG++ R  
Sbjct: 317 EQFKALSPYATLADRLGNFAAHMATGHPHTVRLHYFGKIADNATSLLRNAGLAGVLSRST 376

Query: 179 RVGANIISA 187
              AN+I+A
Sbjct: 377 SRKANLINA 385


>gi|86157688|ref|YP_464473.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774199|gb|ABC81036.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 528

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 119/204 (58%), Gaps = 2/204 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT +T+N+++ + L++ K G  ++NCARGG+VDE ALA+ L SGH+  A  DVFE 
Sbjct: 201 LHVPLTEQTRNLVDAKVLARMKKGALLVNCARGGIVDERALADALASGHLGGAALDVFEQ 260

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E P   +PLFGL      P++GAST E+Q  VA+ +A Q++ YL  GVV NA+N+  +  
Sbjct: 261 EPPPADHPLFGLDGFVATPHIGASTEEAQSAVAVAVAEQLAAYLNHGVVKNAVNVPGLPR 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           E    + PF+ L + LG    QL  +   E+ +   G  A +    L +  LAG +R   
Sbjct: 321 EILDQLAPFLPLCEKLGSLAAQLAPQGPSEVTVEVAGELAAVPIRPLAARTLAGFLRHHL 380

Query: 179 RVGANIISAPIIIKENAIILSTIK 202
               N +SAP + KE  I +  ++
Sbjct: 381 ETPVNDVSAPAVAKERGIAVREVR 404


>gi|193213940|ref|YP_001995139.1| D-3-phosphoglycerate dehydrogenase [Chloroherpeton thalassium ATCC
           35110]
 gi|193087417|gb|ACF12692.1| D-3-phosphoglycerate dehydrogenase [Chloroherpeton thalassium ATCC
           35110]
          Length = 526

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 111/182 (60%), Gaps = 1/182 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H  L   TKN++ KE +   K GV I+NCARGG+V+E  LAE ++SG VA A  DVF  
Sbjct: 199 IHSSLNESTKNLICKETIEIMKDGVYIVNCARGGIVNEFDLAEAIKSGKVAGAALDVFAQ 258

Query: 61  EPAL-QNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP +  NPL G+  V   P++ AST E+Q KVAIQ+A Q+ ++  +  ++ A+N + I  
Sbjct: 259 EPIVSDNPLIGIERVIMTPHIAASTEEAQVKVAIQIAEQIVEWKNNHRLNGAVNASAIEL 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
            +AP VKPF++L++ LG  I QL ++  + + +   G      + V+ +AVL G + V +
Sbjct: 319 AQAPEVKPFLSLSEKLGVMIAQLATKKPKHLNVWVSGDFLRKFSEVITAAVLKGFLDVVQ 378

Query: 180 VG 181
            G
Sbjct: 379 EG 380


>gi|315453857|ref|YP_004074127.1| D-3-phosphoglycerate dehydrogenase [Helicobacter felis ATCC 49179]
 gi|315132909|emb|CBY83537.1| D-3-phosphoglycerate dehydrogenase [Helicobacter felis ATCC 49179]
          Length = 525

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 110/200 (55%), Gaps = 1/200 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T +I++KE +++ K GV +INCARGGL +E AL E L+S  V   G DVF  
Sbjct: 202 IHTPKNKETIDIIDKEQIAQMKEGVILINCARGGLYNEEALYEALKSQKVRWLGLDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL  L NV+  P++GA+T+ESQE++A+Q        L      NALN+ I   +
Sbjct: 262 EPGTSNPLLDLENVYVTPHIGANTLESQEQIALQAVQATIQALKGSSYPNALNIPIQD-D 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            AP  KP++ LA  LG F  Q+   +   +++   GS       +L  A++  +      
Sbjct: 321 IAPYAKPYLQLAQQLGFFCAQVHKGAWSALELTLAGSICEYGNSLLTFALMGLLKPTLGD 380

Query: 181 GANIISAPIIIKENAIILST 200
             N ++AP I KE  I LST
Sbjct: 381 KINYVNAPFIAKERQIHLST 400


>gi|325294449|ref|YP_004280963.1| D-3-phosphoglycerate dehydrogenase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064897|gb|ADY72904.1| D-3-phosphoglycerate dehydrogenase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 529

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 118/204 (57%), Gaps = 3/204 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++T+N++ K+ + K K GV I+N ARGG++ E+ L E L SG V  A  DVF  
Sbjct: 205 IHTPLTDETRNMITKKEIEKMKDGVIILNIARGGIIKEDDLYEALVSGKVRAAALDVFAK 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N L  LPN+   P++GA+T ESQ  VA+ +A+Q+   L    V  A+N A     
Sbjct: 265 EPATDNILLDLPNIVVTPHIGANTFESQTNVAVIIANQVLAALRGEEVEFAVN-APYDDT 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
            A ++KPFM LA+ LG F  Q+     +EI + Y G     +   L +A L G ++ +  
Sbjct: 324 AAKVLKPFMDLAEKLGLFAVQVACSRSKEIVLEYRGDLG-EDLKPLTTAFLKGFLQNIVD 382

Query: 180 VGANIISAPIIIKENAIILSTIKR 203
           +  N+I+AP + KE  I +  +KR
Sbjct: 383 IPVNLINAPFLAKEKGISIVEVKR 406


>gi|95928509|ref|ZP_01311256.1| D-3-phosphoglycerate dehydrogenase [Desulfuromonas acetoxidans DSM
           684]
 gi|95135299|gb|EAT16951.1| D-3-phosphoglycerate dehydrogenase [Desulfuromonas acetoxidans DSM
           684]
          Length = 528

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 118/211 (55%), Gaps = 12/211 (5%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT +T+ ILN E  +  K G  +INCA GGL++E+ L   L  G  A A  D F  
Sbjct: 200 LHLPLTLETEQILNAETFAMVKPGCRLINCALGGLINEDDLVNALTDGTFAGAALDTFAT 259

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  N L  + NV C P+L A+TV++Q  V +Q AHQ+ D+L +  V NALN+  IS 
Sbjct: 260 EPPAPDNRLLHMDNVICTPHLRAATVDAQTNVTVQAAHQVIDFLTNKTVRNALNVPSISI 319

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDG--STAVMN--TMVLNSAVLAGIV 175
           +    ++P++ +A+ +G F+ QL+      I I Y G  ++  M   TM L    L  I+
Sbjct: 320 DHLEAMRPYLDMAERMGLFLAQLLHMPFNAITIEYSGDLTSHPMEPMTMTLLKGFLTPII 379

Query: 176 --RVWRVGANIISAPIIIKENAIILSTIKRD 204
             R+     N ++A  +++E  I ++  +R+
Sbjct: 380 GNRI-----NYVNATHVVRERGITVTETRRN 405


>gi|152990413|ref|YP_001356135.1| D-3-phosphoglycerate dehydrogenase [Nitratiruptor sp. SB155-2]
 gi|151422274|dbj|BAF69778.1| D-3-phosphoglycerate dehydrogenase [Nitratiruptor sp. SB155-2]
          Length = 529

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 114/208 (54%), Gaps = 1/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N++ +E ++K K GV +INCARGGL +E+AL E L+SG +  AG DVF  
Sbjct: 205 IHTPKTKETINMIGREEIAKMKDGVVLINCARGGLYNEDALYEGLKSGKIKFAGIDVFAK 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N L  L NV   P+LGA+T ESQEK+A   A Q  +        NALN+ I   E
Sbjct: 265 EPATDNKLLELDNVTVTPHLGANTEESQEKIAEGAASQALEAARGISYPNALNLPIKEDE 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P VKP++ L   +G    Q+   + + I++I +G  A     ++  AV+  +      
Sbjct: 325 MPPFVKPYLELTQKMGFLAAQVNKGAFKSIKVIAEGEIADYLKSLITFAVVGVLKESLGE 384

Query: 181 GANIISAPIIIKENAI-ILSTIKRDKSG 207
             N ++A  + KE  I ILS    + SG
Sbjct: 385 SINYVNAEFVAKERGIDILSKKSPEASG 412


>gi|194336592|ref|YP_002018386.1| D-3-phosphoglycerate dehydrogenase [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194309069|gb|ACF43769.1| D-3-phosphoglycerate dehydrogenase [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 526

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 115/200 (57%), Gaps = 2/200 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H  L   T+N+++KE L   K GV I+NCARGG+++E  LAE + SG V+ A  DVFE 
Sbjct: 199 IHSSLNESTRNLISKETLDLMKDGVIIVNCARGGIINEADLAEAILSGKVSAAALDVFET 258

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP +  NPL  L  V   P++ AST E+QEKVAIQ+A Q+ ++   G +  A+N + +  
Sbjct: 259 EPVSPDNPLLKLDQVIATPHIAASTSEAQEKVAIQIADQIVEWKQTGKLKGAVNASAVEL 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
            +AP V+ ++TLA+ LG  + Q+  +   ++ +   G        V+ +A L G + V +
Sbjct: 319 AQAPGVRSYLTLAEKLGATLAQMAPDQANKMTVRTSGEFLHTFNEVITAAALKGFLDVRQ 378

Query: 180 V-GANIISAPIIIKENAIIL 198
               N I+A  + KE  I L
Sbjct: 379 SKDTNYINAFTMAKECGISL 398


>gi|298694992|gb|ADI98214.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED133]
          Length = 534

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 125/204 (61%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N +  +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINSDFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|296140550|ref|YP_003647793.1| D-3-phosphoglycerate dehydrogenase [Tsukamurella paurometabola DSM
           20162]
 gi|296028684|gb|ADG79454.1| D-3-phosphoglycerate dehydrogenase [Tsukamurella paurometabola DSM
           20162]
          Length = 528

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 111/197 (56%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK ++ +E L+KTK GV I+N ARGGLVDE ALA+ + SGHV  AG DVFE 
Sbjct: 201 VHLPKTPETKGLIGRELLAKTKKGVIIVNAARGGLVDEQALADAITSGHVFGAGLDVFET 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V +A+N+   + +
Sbjct: 261 EPCTDSPLFELPQVVVTPHLGASTSEAQDRAGTDVAKSVQLALAGEFVPDAVNVKGGAVD 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V P++ L   LG  +G L     +++ +   G  A  N  +L  + L G+   V  
Sbjct: 321 EE--VAPWLELTRKLGVVLGGLPGPLPEKVGVTVRGELASENVEILQLSALRGLFSAVIE 378

Query: 180 VGANIISAPIIIKENAI 196
                ++AP + +E  +
Sbjct: 379 DAVTFVNAPALAEERGV 395


>gi|83588894|ref|YP_428903.1| D-3-phosphoglycerate dehydrogenase [Moorella thermoacetica ATCC
           39073]
 gi|83571808|gb|ABC18360.1| D-3-phosphoglycerate dehydrogenase [Moorella thermoacetica ATCC
           39073]
          Length = 525

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 125/207 (60%), Gaps = 4/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT  T+++L++E L   K G  ++N ARGG++DE AL E L++GH+A A  DVFE 
Sbjct: 199 VHLPLTKDTRHLLDREKLGLMKQGARVLNVARGGIIDEGALYEALKAGHLAGAALDVFEE 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  Q+PL  L NV   P+LGAST E+Q  VA+++A  +   L    V NA+N+ ++   
Sbjct: 259 EPLGQSPLLELENVIVTPHLGASTREAQVAVAVEVAGDVIRCLQGEPVLNAVNIPVVRGH 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            A ++ P++ LA+ LG F+ QL+   I   +I ++G  A  +   L S+ L G++R    
Sbjct: 319 LAEVLHPYLQLAEKLGSFLSQLMESPILTAEICFNGELAGYDLAPLTSSFLKGLLRPLLA 378

Query: 181 GA-NIISAPIIIKENAIILSTIKRDKS 206
            A N ++AP++ K+  I    I+  KS
Sbjct: 379 EAVNYVNAPLVAKKRGI---RIREKKS 402


>gi|67920676|ref|ZP_00514196.1| D-3-phosphoglycerate dehydrogenase [Crocosphaera watsonii WH 8501]
 gi|67858160|gb|EAM53399.1| D-3-phosphoglycerate dehydrogenase [Crocosphaera watsonii WH 8501]
          Length = 525

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 74/197 (37%), Positives = 114/197 (57%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T +I+NKE+LSK K    IINCARGG +DE+ALAE +  G +A A  DVFE 
Sbjct: 199 LHIPKTKETTHIINKESLSKMKPNARIINCARGGTIDESALAEAIAEGKIAGAALDVFEE 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ L    N+   P+LGAST E+Q  VA+ +A Q+ D L+     +A+N+  ++ +
Sbjct: 259 EPLKESKLREHENIILTPHLGASTAEAQVNVAVDVAEQIRDVLLGLPARSAVNIPGLTPD 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
               ++P++ LA+ LG  +GQL    I+ + +   G  A      +  A + G++ +  R
Sbjct: 319 VMEKMRPYLQLAETLGNLVGQLAGGRIERLTVRLQGELASTKGQPIVVASIKGLLSQALR 378

Query: 180 VGANIISAPIIIKENAI 196
              N ++A I  KE  I
Sbjct: 379 ERVNYVNAAIEAKERGI 395


>gi|283470989|emb|CAQ50200.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 534

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 125/204 (61%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N +  +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINADFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|226365951|ref|YP_002783734.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus opacus B4]
 gi|226244441|dbj|BAH54789.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus opacus B4]
          Length = 531

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 78/207 (37%), Positives = 113/207 (54%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK +L  ENL+KTK GV I+N ARGGL+DE ALAE ++SGHV  AG DVFE 
Sbjct: 204 VHLPKTPETKGLLGTENLAKTKKGVVIVNAARGGLIDEAALAEAIKSGHVRAAGLDVFES 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V +A+N++  +  
Sbjct: 264 EPCTDSPLFDLPEVVVTPHLGASTNEAQDRAGTDVAKSVLLALAGDFVPDAVNVSGGAVG 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V P++ +    G  IG L  E    + +   G  A  +  VL  + L G+   V  
Sbjct: 324 EE--VAPWLEIVRKQGVLIGALSGELPVNLSVDVHGELASEDVEVLALSALRGVFSAVIE 381

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
                ++AP + +E  +     K  +S
Sbjct: 382 DAVTFVNAPALAEERGVTAEVTKAAES 408


>gi|258424138|ref|ZP_05687020.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9635]
 gi|257845759|gb|EEV69791.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9635]
          Length = 534

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 125/204 (61%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N +  +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINADFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|82751311|ref|YP_417052.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus RF122]
 gi|82656842|emb|CAI81271.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus RF122]
          Length = 534

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 125/204 (61%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N +  +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINADFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|49483964|ref|YP_041188.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|253734492|ref|ZP_04868657.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257425837|ref|ZP_05602261.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428503|ref|ZP_05604901.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257436736|ref|ZP_05612780.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282904293|ref|ZP_06312181.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C160]
 gi|282906118|ref|ZP_06313973.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282909033|ref|ZP_06316851.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282914518|ref|ZP_06322304.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282919486|ref|ZP_06327221.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282924864|ref|ZP_06332530.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C101]
 gi|283958473|ref|ZP_06375924.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293503596|ref|ZP_06667443.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510612|ref|ZP_06669317.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M809]
 gi|293537153|ref|ZP_06671833.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|295428293|ref|ZP_06820922.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297590744|ref|ZP_06949382.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|49242093|emb|CAG40792.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|253727546|gb|EES96275.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257271531|gb|EEV03677.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275344|gb|EEV06831.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257284087|gb|EEV14210.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M876]
 gi|282313230|gb|EFB43626.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317296|gb|EFB47670.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C427]
 gi|282321699|gb|EFB52024.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M899]
 gi|282327297|gb|EFB57592.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331410|gb|EFB60924.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282595911|gb|EFC00875.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           C160]
 gi|283790622|gb|EFC29439.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290919998|gb|EFD97066.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095262|gb|EFE25527.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466503|gb|EFF09024.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           M809]
 gi|295127693|gb|EFG57330.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297575630|gb|EFH94346.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MN8]
 gi|302333388|gb|ADL23581.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|315195627|gb|EFU26014.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS00]
 gi|323442972|gb|EGB00594.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus O46]
 gi|329733088|gb|EGG69425.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21193]
          Length = 534

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 125/204 (61%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N +  +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINADFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|15924714|ref|NP_372248.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15927301|ref|NP_374834.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus N315]
 gi|148268202|ref|YP_001247145.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150394270|ref|YP_001316945.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156980041|ref|YP_001442300.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253315102|ref|ZP_04838315.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253732373|ref|ZP_04866538.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|255006509|ref|ZP_05145110.2| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257794107|ref|ZP_05643086.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9781]
 gi|258415811|ref|ZP_05682082.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9763]
 gi|258420640|ref|ZP_05683579.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9719]
 gi|258438290|ref|ZP_05689574.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9299]
 gi|258443748|ref|ZP_05692087.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A8115]
 gi|258445959|ref|ZP_05694135.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6300]
 gi|258448361|ref|ZP_05696478.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6224]
 gi|258454159|ref|ZP_05702130.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5937]
 gi|269203362|ref|YP_003282631.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282893218|ref|ZP_06301452.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8117]
 gi|282927853|ref|ZP_06335464.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A10102]
 gi|295406034|ref|ZP_06815842.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8819]
 gi|296276628|ref|ZP_06859135.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297245040|ref|ZP_06928917.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8796]
 gi|13701519|dbj|BAB42813.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus N315]
 gi|14247496|dbj|BAB57886.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|147741271|gb|ABQ49569.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946722|gb|ABR52658.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus JH1]
 gi|156722176|dbj|BAF78593.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|253723895|gb|EES92624.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|257788079|gb|EEV26419.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9781]
 gi|257839404|gb|EEV63877.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9763]
 gi|257843244|gb|EEV67654.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9719]
 gi|257848334|gb|EEV72325.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A9299]
 gi|257851154|gb|EEV75097.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A8115]
 gi|257855201|gb|EEV78140.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6300]
 gi|257858329|gb|EEV81214.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus A6224]
 gi|257863611|gb|EEV86368.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5937]
 gi|262075652|gb|ACY11625.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282590363|gb|EFB95442.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A10102]
 gi|282764536|gb|EFC04662.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8117]
 gi|285817406|gb|ADC37893.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 04-02981]
 gi|294969031|gb|EFG45052.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8819]
 gi|297178120|gb|EFH37368.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A8796]
 gi|315130640|gb|EFT86626.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS03]
 gi|329727559|gb|EGG64015.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21172]
          Length = 534

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 125/204 (61%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N +  +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINADFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|282911349|ref|ZP_06319151.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282325044|gb|EFB55354.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|312437820|gb|ADQ76891.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH60]
          Length = 534

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 125/204 (61%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N +  +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINADFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|21283395|ref|NP_646483.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49486548|ref|YP_043769.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|297207564|ref|ZP_06923999.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300911645|ref|ZP_07129089.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|21204835|dbj|BAB95531.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49244991|emb|CAG43452.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|296887581|gb|EFH26479.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC 51811]
 gi|300887066|gb|EFK82267.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           TCH70]
          Length = 534

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 125/204 (61%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N +  +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINADFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|307826385|ref|ZP_07656587.1| D-3-phosphoglycerate dehydrogenase [Methylobacter tundripaludum
           SV96]
 gi|307732562|gb|EFO03437.1| D-3-phosphoglycerate dehydrogenase [Methylobacter tundripaludum
           SV96]
          Length = 527

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 119/207 (57%), Gaps = 1/207 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PL  KT+N+++   L+  K    IINCARGGL+DE AL + L++G +A A  DV+E 
Sbjct: 201 LHCPLIEKTRNVIDSAKLAMMKKEAMIINCARGGLIDEAALYDALKNGRIAGAALDVYEN 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL GL N+   P+LGAST E+Q  V++++A Q   +L  G   NALN+  +S E
Sbjct: 261 EPPADSPLLGLDNIVFTPHLGASTSEAQVAVSVEIARQAVTFLKTGEAVNALNLPRVSAE 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E      F+TLA+ LG  +  L ++ I++I++   G  A +    ++ + L G++   + 
Sbjct: 321 ELKKSHEFITLANILGKVLVGLATKPIEKIEVALMGRAAEVEARPVSVSALIGVLSGQFS 380

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
              N ++A  I K   I L   K +++
Sbjct: 381 TPVNRVNAENIAKRQGIALVESKTEET 407


>gi|257431137|ref|ZP_05607514.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257278085|gb|EEV08733.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 68-397]
          Length = 534

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 125/204 (61%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N +  +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINADFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|73662348|ref|YP_301129.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|72494863|dbj|BAE18184.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
          Length = 538

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 121/200 (60%), Gaps = 6/200 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KTK I+ K    K K  + IIN ARGG++DE AL + L    +  A  DVFE 
Sbjct: 201 VHTPLTPKTKGIVGKAFFEKAKPNLQIINVARGGIIDEAALVDALNQNQIQSAAIDVFES 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA ++PL     +   P+LGASTVE+QEKVA+ +A+++ D   +G V NA+N   +++ 
Sbjct: 261 EPATESPLVNHEKIIVTPHLGASTVEAQEKVAVSVANEIVDIFENGNVFNAINAPKMTYS 320

Query: 121 E-APLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--- 176
           E    +KP++ L+   G    QL+ ++ +E+ I Y+G  A+ +T +L   +++G+++   
Sbjct: 321 EINDELKPYIELSQLTGEVGIQLLEKAPRELHIKYEGDIALDDTSLLTRTLVSGVLKQDL 380

Query: 177 VWRVGANIISAPIIIKENAI 196
             RV  N+I+A +++ E  +
Sbjct: 381 AERV--NLINALVLLNEQGV 398


>gi|284929797|ref|YP_003422319.1| D-3-phosphoglycerate dehydrogenase [cyanobacterium UCYN-A]
 gi|284810241|gb|ADB95938.1| D-3-phosphoglycerate dehydrogenase [cyanobacterium UCYN-A]
          Length = 525

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 81/208 (38%), Positives = 121/208 (58%), Gaps = 4/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T +I+NK+ LSK KS   IINCARGG++DE+ALAE + +  +A A  DVFE 
Sbjct: 199 LHIPKTPETAHIINKKALSKMKSTARIINCARGGIIDEDALAEAIINKKIAGAALDVFEK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   + L  L NV   P+LGAST E+Q  VA+ +A Q+ D L+      A+N+  +  +
Sbjct: 259 EPLSNSKLKNLDNVILTPHLGASTTEAQINVAVDVAEQIRDVLLGLSARTAVNIPGLVPD 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
               ++P++ LA+ LG   GQL    I+++ +   G  A M +  +  A + G++ +  R
Sbjct: 319 LVEKIRPYLELAETLGNLAGQLAGGRIEKLTVRLQGELAAMQSQPIVIASIKGLLSQALR 378

Query: 180 VGANIISAPIIIKENAI-ILSTIKRDKS 206
              N ++A I  KE  I I+ T  RD S
Sbjct: 379 ERVNYVNAAIEAKERGIRIIET--RDAS 404


>gi|257125820|ref|YP_003163934.1| D-3-phosphoglycerate dehydrogenase [Leptotrichia buccalis C-1013-b]
 gi|257049759|gb|ACV38943.1| D-3-phosphoglycerate dehydrogenase [Leptotrichia buccalis C-1013-b]
          Length = 530

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 118/205 (57%), Gaps = 1/205 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T +++N EN+ K K GV ++N ARGGL +E+A+AE L+SG +A  G+DV  V
Sbjct: 202 IHTPKTKETIDMINAENIRKLKDGVRLVNAARGGLFNEDAVAEGLRSGKIASFGYDVHTV 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L+   NV   P++GA+T E+Q  V  Q+  Q+ + L   +V  A+N+  I  E
Sbjct: 262 EPRTDCVLYEFDNVVATPHIGATTYEAQRNVGTQVVRQVLNGLRGEIVETAVNLPAIGRE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E  +VKPF+ LA+ LG    Q+    I  + I Y G  A   T +++S  + GI+  V +
Sbjct: 322 EFLIVKPFINLAEKLGKIYFQIEKTPIANVVINYYGEIAGQETALVDSTAMKGILEPVLK 381

Query: 180 VGANIISAPIIIKENAIILSTIKRD 204
              N I+A  + ++  I +S  K++
Sbjct: 382 EEVNYINAKPLAEKRGINISINKKE 406


>gi|268324733|emb|CBH38321.1| D-3-phosphoglycerate dehydrogenase [uncultured archaeon]
          Length = 542

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 117/212 (55%), Gaps = 8/212 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT  T +++ K      K GV +INCARGG++DE+AL E +++G VA A  DVFE 
Sbjct: 208 LHTPLTKDTHHMIGKGEFELMKDGVRVINCARGGILDEDALKEAIKAGKVAGAALDVFEQ 267

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   + L  L  V   P+LGAST E+Q   A+ +A ++   L +  V NALNM  +  E
Sbjct: 268 EPPNNDDLLELEEVIVTPHLGASTTEAQRAAAVVIADEVIGALSNKPVKNALNMLYLEEE 327

Query: 121 EAPLVKPFMTLADHLGCFIGQLI--SESIQEIQIIYDGSTAVM------NTMVLNSAVLA 172
               VKP++ LA+ LG    QLI  S  I++  + Y+G   ++      NT ++  A+L 
Sbjct: 328 LMDSVKPYLVLAEKLGLLSAQLIPKSRRIEQFNVSYEGELGMVEAGIGKNTRMITVALLK 387

Query: 173 GIVRVWRVGANIISAPIIIKENAIILSTIKRD 204
             +  +  G N ++A  I K+  + ++  K +
Sbjct: 388 NFLAWFTDGVNYVNAEAIAKKFGVKVTESKTE 419


>gi|312830102|emb|CBX34944.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ECT-R 2]
          Length = 534

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 125/204 (61%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N +  +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINADFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIGTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|282916984|ref|ZP_06324742.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283770802|ref|ZP_06343694.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
 gi|282319471|gb|EFB49823.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           D139]
 gi|283460949|gb|EFC08039.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus H19]
          Length = 534

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 125/204 (61%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N +  +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINADFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   +K F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--IKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|253576381|ref|ZP_04853711.1| phosphoglycerate dehydrogenase [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844274|gb|EES72292.1| phosphoglycerate dehydrogenase [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 529

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 113/189 (59%), Gaps = 2/189 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK+++ +      K G+ IINCARGG++DE AL E +  G VA A FDVFE 
Sbjct: 200 VHTPLTPETKHMIARPQFEVMKKGMRIINCARGGIIDELALVEAIDQGIVAGAAFDVFEK 259

Query: 61  EPA-LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    +P    P +   P+LGASTVE+QE VAI ++ Q+   L +    NA+NM  ++ 
Sbjct: 260 EPPEADHPFLHHPKIIVTPHLGASTVEAQENVAIDVSEQVLHILRNEPFKNAVNMPPVAA 319

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
                ++P+  L + +G F+ QL +++++EI + Y G  A ++T  L   ++ G++ R +
Sbjct: 320 SVMNKLQPYFGLGEKIGIFLSQLNNQAVKEIHVDYAGDLAEVDTQPLTRYIIKGVLSRHF 379

Query: 179 RVGANIISA 187
               NI+++
Sbjct: 380 GGDVNIVNS 388


>gi|268679255|ref|YP_003303686.1| D-3-phosphoglycerate dehydrogenase [Sulfurospirillum deleyianum DSM
           6946]
 gi|268617286|gb|ACZ11651.1| D-3-phosphoglycerate dehydrogenase [Sulfurospirillum deleyianum DSM
           6946]
          Length = 528

 Score =  130 bits (328), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 109/196 (55%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N+++ + ++K K GV +INCARGGL +E+AL E L+SG +A AG DVF  
Sbjct: 204 IHTPKNKETLNMISHDEIAKMKEGVRLINCARGGLYNEDALYEGLKSGKIAFAGIDVFSK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL  L NV   P+LGA+T+ESQEK+AIQ A             NALN+ I + +
Sbjct: 264 EPATNHPLLDLENVCVTPHLGANTLESQEKIAIQAAENAVSAARGISYPNALNLPIKAED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               +KP++ L   +G    QL   +I+ I++  +G  A     +L   ++  +      
Sbjct: 324 MPASLKPYLELVQKIGFLAAQLNRSAIKSIRLELEGDVAEFGKSLLTFGIVGALSETNTT 383

Query: 181 GANIISAPIIIKENAI 196
             N ++A  + KE  I
Sbjct: 384 TVNYVNAEFVAKEKGI 399


>gi|120403120|ref|YP_952949.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium vanbaalenii
           PYR-1]
 gi|119955938|gb|ABM12943.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium vanbaalenii
           PYR-1]
          Length = 528

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 100/174 (57%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ KE L+KTK GV I+N ARGGL+DE ALA+ + SGHV  AG DVF  
Sbjct: 201 VHLPKTKETAGLIGKEALAKTKPGVIIVNAARGGLIDEAALADAINSGHVRGAGLDVFST 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGASTVE+Q++    +A  +   L    V +A+N+   +  
Sbjct: 261 EPCTDSPLFELPQVVVTPHLGASTVEAQDRAGTDVAASVKLALAGEFVPDAVNVGGGAVG 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V P++ L   LG  +G L SE    +Q+   G  A     VL  + L G+
Sbjct: 321 EE--VAPWLDLVRKLGLLVGVLSSEPPVSLQVQVQGELASEEVEVLKLSALRGL 372


>gi|312898434|ref|ZP_07757824.1| phosphoglycerate dehydrogenase [Megasphaera micronuciformis F0359]
 gi|310620353|gb|EFQ03923.1| phosphoglycerate dehydrogenase [Megasphaera micronuciformis F0359]
          Length = 538

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 117/210 (55%), Gaps = 3/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT +T+ ++  E ++K K GV +IN +RG ++D NALAE L+SG VA A  DVF  
Sbjct: 203 LHTPLTKETRGMIGAEEIAKMKDGVRVINVSRGAVLDINALAEALKSGKVAGAAVDVFPE 262

Query: 61  EPALQ--NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP     NP  G+ NV   P+LGAST+E+QE V++ +A  +   L    V  A+NMA I+
Sbjct: 263 EPLTSDINPFKGMDNVVITPHLGASTIEAQEGVSLDVARSIMAGLKGEPVPTAVNMAPIA 322

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
                 ++P+  L + +G     L    ++EI + Y G  A   T +L +AVL G +  +
Sbjct: 323 PGVYSTIRPYFDLMERMGIMGVYLAEAPMKEITVEYSGKLAETETALLTTAVLKGALNPI 382

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKSG 207
            +   N ++AP + K+  I +  +K    G
Sbjct: 383 LQDAVNFVNAPDLAKQRHISVKEVKTSDHG 412


>gi|323704756|ref|ZP_08116333.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323535682|gb|EGB25456.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 533

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 116/204 (56%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T +I++ E   K K GV I+NCARGGL++E AL + ++ G VA A  DVF+V
Sbjct: 198 IHTPKTEETIDIISHEEFKKVKKGVRIVNCARGGLINEEALYDAVKEGIVAAAALDVFKV 257

Query: 61  EPA-------LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP+         N L  LPNV   P+LGAST+E+Q  V I +A ++   L   +  N +N
Sbjct: 258 EPSYDREKQDFHNKLLELPNVVVTPHLGASTIEAQNNVGISVAKEVITALSGKLYGNIVN 317

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +  +  +E   +KP+M L + +G    Q+     + ++IIY G  + +NT V+    L G
Sbjct: 318 LPDVKADEFGELKPYMKLCEAMGSLYYQISDVPAKTVEIIYRGEISSLNTEVVTLHALKG 377

Query: 174 IVR-VWRVGANIISAPIIIKENAI 196
           +++   + G +I++A +  KE  I
Sbjct: 378 LLKPALKEGISIVNARLRAKEMGI 401


>gi|224372944|ref|YP_002607316.1| D-3-phosphoglycerate dehydrogenase [Nautilia profundicola AmH]
 gi|223588899|gb|ACM92635.1| D-3-phosphoglycerate dehydrogenase [Nautilia profundicola AmH]
          Length = 522

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 118/206 (57%), Gaps = 3/206 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N++ K+ + K K GV +INCARGGL +E  +AE L+SG +A  G DVF  
Sbjct: 201 IHTPKTKETINMITKKEIEKMKDGVVLINCARGGLYNEEDVAEALKSGKIAWLGIDVFNK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++P F L N    P++GA+T ESQE++AIQ A  + + L      NALN+ I +  
Sbjct: 261 EPLTEHPFFELENTSVTPHIGANTKESQERIAIQAAEGIIEALRGSSYPNALNLPINTAN 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               V  ++ L+  +G  + Q+I++SI+++++   G  +  +  VL +  L G+++    
Sbjct: 321 TPEWVIKYLELSQKMGYILSQVINKSIKKVKVNLSGDISKEDKSVL-TFTLVGLLQNITE 379

Query: 181 GANIISAPIIIKENAIILST--IKRD 204
             N ++A  +  E  I+  T  IK D
Sbjct: 380 NVNYVNAEFLATEKGIVTETKEIKND 405


>gi|269121298|ref|YP_003309475.1| D-3-phosphoglycerate dehydrogenase [Sebaldella termitidis ATCC
           33386]
 gi|268615176|gb|ACZ09544.1| D-3-phosphoglycerate dehydrogenase [Sebaldella termitidis ATCC
           33386]
          Length = 528

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/207 (31%), Positives = 123/207 (59%), Gaps = 1/207 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T++T  I++ + + K K  V ++N ARGG+ DE A+A  L+SG +A  GFDV E 
Sbjct: 202 IHTPKTSETLKIISYDQIEKMKDNVRLVNAARGGVFDEAAVAAGLESGKIASYGFDVHEK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PL+   NV   P++GA+T E+QE V  Q+  Q+ + L   +V  A+N+  +  E
Sbjct: 262 EPRSESPLYAFDNVVTTPHIGATTYEAQENVGKQVVKQVINGLNGEIVETAVNLPTMGRE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E  ++KP++   + LG    Q+   +I+ + +IY G+ +   T +++S+ + G++  V +
Sbjct: 322 EFAVIKPYIQFVEKLGKIYYQIKKGAIKFVNLIYYGNISTQETAIIDSSFMKGLLYPVLK 381

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
              N I++ ++ ++  I   +IK+++ 
Sbjct: 382 EEVNYINSLVLAEKRDIKFHSIKKEEK 408


>gi|86608852|ref|YP_477614.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557394|gb|ABD02351.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 526

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 111/198 (56%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T N+ N E     K    +INCARGGLVDE AL E L+SG +A A  DVF  
Sbjct: 199 LHIPKTPETTNLFNAETFRMMKPTARLINCARGGLVDEQALYEALKSGQIAGAALDVFAN 258

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP   +PLF L   V   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  +  
Sbjct: 259 EPLKDSPLFSLGKEVLLTPHLGASTEEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGLQA 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV-W 178
           E    ++P++ LA+ LG  +GQL  + + +++I   G  A  +   +  A L G++ +  
Sbjct: 319 EVLQNLRPYLDLAETLGNLVGQLAGDRVNQLEIRLQGDLAEKDGQPIVIAALKGLLTLAL 378

Query: 179 RVGANIISAPIIIKENAI 196
           R   N ++A I  KE  I
Sbjct: 379 RERVNYVNASIEAKERGI 396


>gi|254444984|ref|ZP_05058460.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobiae bacterium
           DG1235]
 gi|198259292|gb|EDY83600.1| D-3-phosphoglycerate dehydrogenase [Verrucomicrobiae bacterium
           DG1235]
          Length = 545

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 115/203 (56%), Gaps = 1/203 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+PLT+ T+ +++   ++  K GV + NCARGG++DE+AL   L+SG VA AG DV+  
Sbjct: 217 VHMPLTDATRGMIDDAAIATMKDGVRLFNCARGGIIDEDALLRGLESGKVAAAGLDVYTS 276

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  +P      +   P+LGAST E+QE V +++A  ++  L  G + NA+NM  +  
Sbjct: 277 EPPAEDHPFRSQKTLNLTPHLGASTEEAQESVGLEIAESVTSVLRGGGIRNAINMPSLDE 336

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           +    V P++ L   LG  + QL +E +++++I Y G    ++   L   +L G ++   
Sbjct: 337 QTLKTVGPYLELCSALGSLVQQLANEKVEKVKITYSGKVVDLDANSLTRGILKGFLKDVS 396

Query: 180 VGANIISAPIIIKENAIILSTIK 202
              N ++A +I+    + +  +K
Sbjct: 397 SNVNFVNALVIMDRLGLNVDVLK 419


>gi|323440732|gb|EGA98441.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus O11]
          Length = 534

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 124/204 (60%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N +  +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINADFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVA  +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVATSVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|116754525|ref|YP_843643.1| D-3-phosphoglycerate dehydrogenase [Methanosaeta thermophila PT]
 gi|116665976|gb|ABK15003.1| D-3-phosphoglycerate dehydrogenase [Methanosaeta thermophila PT]
          Length = 523

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/198 (33%), Positives = 118/198 (59%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+N++++  +   K  V IINCARGG+++E ALA+ +    +A A  DV+  
Sbjct: 198 VHTPLTPETRNMIDEPQIKMMKPTVRIINCARGGIINEAALAKAVAENRIAGAAVDVYTK 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + NPL     +   P+LGAST E+Q  VA+ +A Q+       + + A+N+  I  E
Sbjct: 258 EPPVGNPLLEQERIITTPHLGASTAEAQINVALAVADQIIAISRGQLPTTAINLISIPPE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
              L++P+M +A+ +G  +GQL +   ++++I+Y GS A  +T ++  A + G++     
Sbjct: 318 TIALMEPYMDIAERMGRLLGQLGTSRFEQLEIVYGGSIAEKDTRLITIAAVKGLLSAIGA 377

Query: 181 GANIISAPIIIKENAIIL 198
            AN++++  ++KE  I L
Sbjct: 378 HANLVNSMALLKEKGIKL 395


>gi|319892782|ref|YP_004149657.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162478|gb|ADV06021.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464187|gb|ADX76340.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus pseudintermedius
           ED99]
          Length = 531

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 122/208 (58%), Gaps = 3/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KTK I+N    ++ K  + IIN ARGG+++ENAL + L    +A A  DVFE 
Sbjct: 202 VHTPLTEKTKGIVNANFFNQAKPNLQIINVARGGIIEENALIDALDQNKIAGAALDVFEN 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA+ +P+   P +   P+LGAST+E+QEKVA+ +A ++ D +    V+NA+N     F 
Sbjct: 262 EPAIDSPVTKHPKIIVTPHLGASTLEAQEKVAVSVAQEIIDIIKHENVANAVNAPSGVFN 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   +KPF+ LA   G    QL+ ++ + ++I Y G  A+ +T ++   ++ G++    +
Sbjct: 322 EDEELKPFVDLAKTTGKVGIQLLPKAPRTLKITYAGDIALDDTSLITRTLVKGVLE-QDM 380

Query: 181 G--ANIISAPIIIKENAIILSTIKRDKS 206
           G   N+I+A +++ E  +  +  K  K 
Sbjct: 381 GDHVNLINALVLLNEQNVTYTIEKTKKK 408


>gi|57652022|ref|YP_186607.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87160337|ref|YP_494364.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88195533|ref|YP_500339.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|151221829|ref|YP_001332651.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|161509939|ref|YP_001575598.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221142358|ref|ZP_03566851.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|258450882|ref|ZP_05698935.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5948]
 gi|262049037|ref|ZP_06021915.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus D30]
 gi|262051787|ref|ZP_06024004.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 930918-3]
 gi|294849885|ref|ZP_06790624.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9754]
 gi|304380684|ref|ZP_07363355.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|57286208|gb|AAW38302.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus COL]
 gi|87126311|gb|ABD20825.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87203091|gb|ABD30901.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|150374629|dbj|BAF67889.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|160368748|gb|ABX29719.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|257861418|gb|EEV84226.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A5948]
 gi|259160281|gb|EEW45308.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus 930918-3]
 gi|259162854|gb|EEW47418.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus D30]
 gi|269941202|emb|CBI49590.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus TW20]
 gi|294823224|gb|EFG39654.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9754]
 gi|302751550|gb|ADL65727.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304340791|gb|EFM06720.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           ATCC BAA-39]
 gi|315197191|gb|EFU27530.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus CGS01]
 gi|320141667|gb|EFW33502.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143821|gb|EFW35594.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|329314397|gb|AEB88810.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329726965|gb|EGG63422.1| phosphoglycerate dehydrogenase [Staphylococcus aureus subsp. aureus
           21189]
          Length = 534

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 124/204 (60%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N    +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINAVFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|284024770|ref|ZP_06379168.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus aureus subsp.
           aureus 132]
          Length = 534

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 124/204 (60%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N    +K K  + IIN ARGG++DE AL + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINAVFFAKAKPSLQIINVARGGIIDEKALIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|158334453|ref|YP_001515625.1| D-3-phosphoglycerate dehydrogenase [Acaryochloris marina MBIC11017]
 gi|158304694|gb|ABW26311.1| D-3-phosphoglycerate dehydrogenase [Acaryochloris marina MBIC11017]
          Length = 527

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/213 (36%), Positives = 121/213 (56%), Gaps = 6/213 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T+N++N E L K KS   IINCARGG++DE+AL + L+SG +A A  DV+  
Sbjct: 199 LHLPKTPETQNLVNAETLGKMKSTARIINCARGGIIDEDALGKALESGQIAAAALDVYAS 258

Query: 61  EPALQNPLFGLP-NVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP   +PL  L  ++   P+LGAST E+Q  VA+ +A Q+ D L+     +A+N+  +  
Sbjct: 259 EPLGDSPLCHLEQDIILTPHLGASTEEAQTNVAVDVAEQIRDVLLGLPARSAVNIPGLRP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           +    +KP+M LA+ LG  +GQL    I+ + +   G  A  ++  +  A L G++    
Sbjct: 319 DVLEKLKPYMLLAETLGNLVGQLAGGRIESLDVRLQGELASNDSQPIVVAALKGLLSPAL 378

Query: 179 RVGANIISAPIIIKENAIILSTIK----RDKSG 207
           R   N ++A I  K+  I +   +    RD SG
Sbjct: 379 RERVNYVNAGIEAKDRGIRVVETRDASVRDYSG 411


>gi|261406015|ref|YP_003242256.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. Y412MC10]
 gi|261282478|gb|ACX64449.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus sp. Y412MC10]
          Length = 530

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 104/176 (59%), Gaps = 1/176 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T++++ +      K G+ I+NCARGG++DE AL E +  G VA A FDVFE 
Sbjct: 201 VHTPLTPETRHMIARPQFEVMKRGMRIVNCARGGIIDERALVEAIDEGIVAGAAFDVFEH 260

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP   + P    P V   P+LGASTVE+QE VAI ++ Q+   L +    NA+N  +++ 
Sbjct: 261 EPPESDHPFLNHPKVIVTPHLGASTVEAQENVAIDVSEQVLHILRNEPFKNAVNFPLVAA 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
                ++P+ +L + LG    Q+ + +++EI + Y G  A ++T  L   ++ G++
Sbjct: 321 SVMNKLQPYFSLGEKLGSVAAQITAHAVKEIHVDYAGELAEVDTQALTRYIVKGVL 376


>gi|329929876|ref|ZP_08283552.1| phosphoglycerate dehydrogenase [Paenibacillus sp. HGF5]
 gi|328935854|gb|EGG32315.1| phosphoglycerate dehydrogenase [Paenibacillus sp. HGF5]
          Length = 530

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 104/176 (59%), Gaps = 1/176 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T++++ +      K G+ I+NCARGG++DE AL E +  G VA A FDVFE 
Sbjct: 201 VHTPLTPETRHMIARPQFEVMKRGMRIVNCARGGIIDERALVEAIDEGIVAGAAFDVFEH 260

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP   + P    P V   P+LGASTVE+QE VAI ++ Q+   L +    NA+N  +++ 
Sbjct: 261 EPPESDHPFLNHPKVIVTPHLGASTVEAQENVAIDVSEQVLHILRNEPFKNAVNFPLVAA 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
                ++P+ +L + LG    Q+ + +++EI + Y G  A ++T  L   ++ G++
Sbjct: 321 SVMNKLQPYFSLGEKLGSVAAQITAHAVKEIHVDYAGELAEVDTQALTRYIVKGVL 376


>gi|304317984|ref|YP_003853129.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779486|gb|ADL70045.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 533

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 114/204 (55%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T +I++ E   K K GV I+NCARGGL++E AL   ++ G VA A  DVF+V
Sbjct: 198 IHTPKTEETIDIISDEEFKKVKKGVRIVNCARGGLINEEALYNAVKEGIVAAAALDVFKV 257

Query: 61  EPA-------LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP+         N L  LPNV   P+LGASTVE+Q  V I +A ++   L   +  N +N
Sbjct: 258 EPSYDREKQDFHNKLLELPNVVVTPHLGASTVEAQNNVGISVAKEVITALNGKLYGNIVN 317

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +  I  +E   +KP+M L + +G    Q+  +    +++I+ G  +  NT V+    L G
Sbjct: 318 LPDIKADEFGELKPYMKLCEAMGALYYQINDDPASSVEVIFRGDISHHNTEVVTLHALKG 377

Query: 174 IVR-VWRVGANIISAPIIIKENAI 196
           ++R   + G +I++A +  KE  I
Sbjct: 378 LLRPALKEGISIVNARLRAKEMGI 401


>gi|254412600|ref|ZP_05026373.1| D-3-phosphoglycerate dehydrogenase [Microcoleus chthonoplastes PCC
           7420]
 gi|196180335|gb|EDX75326.1| D-3-phosphoglycerate dehydrogenase [Microcoleus chthonoplastes PCC
           7420]
          Length = 527

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/198 (38%), Positives = 115/198 (58%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T +++N E L+  K    IINC+RGG++DE AL+E L++G +A A  DVFE 
Sbjct: 199 LHIPKTPETTHLINAEALATMKPTARIINCSRGGVIDEAALSEALKTGKIAGAALDVFES 258

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++PL  L   V   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  +S 
Sbjct: 259 EPLGESPLRELGKEVILTPHLGASTAEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGLSS 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
                +KP+M LA+ LG  + QL    I+++ +   G  A  N+  L  A L G++ +  
Sbjct: 319 NVLEQLKPYMRLAETLGNLVSQLAGGRIEQLNVRLQGELATNNSQPLVVASLKGLLSQAL 378

Query: 179 RVGANIISAPIIIKENAI 196
           R   N ++A I  KE  I
Sbjct: 379 RERVNYVNASIEAKERGI 396


>gi|20808958|ref|NP_624129.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter
           tengcongensis MB4]
 gi|20517622|gb|AAM25733.1| Phosphoglycerate dehydrogenase and related dehydrogenases
           [Thermoanaerobacter tengcongensis MB4]
          Length = 533

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 113/204 (55%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK ++ ++   K K GV I+N ARGG++DE AL   ++ G VA  G DV EV
Sbjct: 198 IHIPKTEETKKMIGEKEFKKMKKGVRIVNAARGGIIDEKALYNAIKEGIVAAVGLDVLEV 257

Query: 61  EPA-------LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP          NPL  LPNV   P+LGAST E+QE ++I +A ++   L   +  N +N
Sbjct: 258 EPKYNVEHQDFHNPLLELPNVVFTPHLGASTYEAQENISIAIAQEVISALNGNLYGNIVN 317

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +  +  +E   +KP+M LA+ LG    Q+     + I++IY G  A  NT ++    + G
Sbjct: 318 LPGLKSDEFSRLKPYMKLAEVLGALYYQINETPAKLIEVIYRGEVAKSNTEIVTLYAIKG 377

Query: 174 IVR-VWRVGANIISAPIIIKENAI 196
            ++ +     ++++A +  KE  I
Sbjct: 378 FLKPILEEDVSVVNAKLRAKEMGI 401


>gi|54026192|ref|YP_120434.1| D-3-phosphoglycerate dehydrogenase [Nocardia farcinica IFM 10152]
 gi|54017700|dbj|BAD59070.1| putative D-3-phosphoglycerate dehydrogenase [Nocardia farcinica IFM
           10152]
          Length = 532

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 108/199 (54%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK +L+KE L+ TK GV I+N ARGGL+DE ALA+ + SGHV  AG DVFE 
Sbjct: 204 VHLPKTPETKGLLSKEKLALTKKGVIIVNAARGGLIDEQALADAITSGHVRAAGIDVFET 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V  A+N+    +S
Sbjct: 264 EPCTDSPLFELPQVVVTPHLGASTTEAQDRAGTDVAKSVLLALAGEFVPGAVNVTGGAVS 323

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
            E    V P++ +    G  +G L  E    +++   G  A  +  VL  + L GI    
Sbjct: 324 DE----VAPWLEIVRKQGALVGALSDELPVSVEVQVRGELAAEDVAVLELSALRGIFSAL 379

Query: 179 -RVGANIISAPIIIKENAI 196
                  ++AP + KE  I
Sbjct: 380 VEDQVTFVNAPALAKERGI 398


>gi|288932457|ref|YP_003436517.1| D-3-phosphoglycerate dehydrogenase [Ferroglobus placidus DSM 10642]
 gi|288894705|gb|ADC66242.1| D-3-phosphoglycerate dehydrogenase [Ferroglobus placidus DSM 10642]
          Length = 527

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 117/199 (58%), Gaps = 4/199 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVP T +T+ +++ E   K K  V I+NCARGG+VDE+AL E L+SG V  A  DV+E 
Sbjct: 199 VHVPKTKETEKMISYEEFRKMKDNVIIVNCARGGIVDEDALYEALKSGKVYMAALDVYEK 258

Query: 61  EPA-LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    +PLF L NV   P++GAST E+Q+ V + +A  + +      V NA+N+  +  
Sbjct: 259 EPPNFNHPLFKLENVITTPHIGASTKEAQKSVGMIIARDIINLYKGLPVINAVNLPSLKP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           E+   + P++TLA+ +G      +  + +E++I Y G  A  +T  +  A+L G++    
Sbjct: 319 EDFEYLMPYITLAEKMGKIASARLGGNFKEVKITYRGKLANKDTAYVARALLKGLLETI- 377

Query: 180 VGANI--ISAPIIIKENAI 196
           +GANI  +S+  I K+  I
Sbjct: 378 LGANINLVSSMPIAKQRGI 396


>gi|220917793|ref|YP_002493097.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219955647|gb|ACL66031.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 528

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 116/204 (56%), Gaps = 2/204 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT +T+N+++ + L++ K G  ++NCARGG+VDE ALA+ L SGH+  A  DVFE 
Sbjct: 201 LHVPLTEQTRNLVDAKVLARMKKGALLVNCARGGIVDERALADALASGHLGGAALDVFEQ 260

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E P   +PL GL      P++GAST E+Q  VA+ +A Q++ YL  GVV NA+N+  +  
Sbjct: 261 EPPPADHPLLGLDGFVATPHIGASTEEAQSAVAVAVAEQLAAYLNHGVVKNAVNVPGLPR 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           E    + PF+ L + LG    QL  +   E+ +   G  A      L +  LA  +R   
Sbjct: 321 EIMDQIAPFLPLCEKLGSLAAQLAPQGPSEVTVEVAGELAAAPIRPLAARTLAAFLRHHL 380

Query: 179 RVGANIISAPIIIKENAIILSTIK 202
               N +SAP + KE  I +  ++
Sbjct: 381 ETPVNDVSAPAVAKERGIAVREVR 404


>gi|256380010|ref|YP_003103670.1| D-3-phosphoglycerate dehydrogenase [Actinosynnema mirum DSM 43827]
 gi|255924313|gb|ACU39824.1| D-3-phosphoglycerate dehydrogenase [Actinosynnema mirum DSM 43827]
          Length = 532

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 101/174 (58%), Gaps = 1/174 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK ++  E L+KTK GV ++N ARGGL+DE+ALAE +QSG V  AG DVF  
Sbjct: 204 IHLPKTPETKGLIGAEQLAKTKRGVIVVNAARGGLIDEDALAEAVQSGQVGGAGIDVFAT 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLFGLPNV   P+LGAST E+Q++    +A  +   L    V +A+N+      
Sbjct: 264 EPTTASPLFGLPNVVVTPHLGASTSEAQDRAGTDVAKSVLLALAGDFVPDAVNVQGGGVV 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
               V+P++ L   LG  +  L +++   + +   G  +  +  VL  A L G+
Sbjct: 324 GE-EVRPYLPLVQKLGTVVAALSAKAPTSVTLEVRGELSNEDVSVLPLAALRGV 376


>gi|257054946|ref|YP_003132778.1| D-3-phosphoglycerate dehydrogenase [Saccharomonospora viridis DSM
           43017]
 gi|256584818|gb|ACU95951.1| D-3-phosphoglycerate dehydrogenase [Saccharomonospora viridis DSM
           43017]
          Length = 531

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 100/174 (57%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T+ I+    LSK K GV I+N ARGGLVDENALAE L+ G VA AG DVF  
Sbjct: 204 IHLPKTPETQGIIGATALSKVKPGVLIVNAARGGLVDENALAEALREGRVAGAGIDVFVE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LPNV   P+LGAST E+Q++    +A  +   L    V +A+N+   +  
Sbjct: 264 EPTTSSPLFELPNVVVTPHLGASTREAQDRAGTDVARSVLLALRGDFVPDAVNVTGGAVS 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V+P++ L   LG  +    +++   + +I  G  A  +  VL  A L G+
Sbjct: 324 EE--VRPYLGLTQKLGTVLSAFSAKAPSSVSVIASGELASEDVSVLQLAALRGV 375


>gi|183981728|ref|YP_001850019.1| D-3-phosphoglycerate dehydrogenase SerA1 [Mycobacterium marinum M]
 gi|183175054|gb|ACC40164.1| D-3-phosphoglycerate dehydrogenase SerA1 [Mycobacterium marinum M]
          Length = 528

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/207 (37%), Positives = 111/207 (53%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +L KE L+KTK GV I+N ARGGL+DE+ALAE + SGHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLLGKEALAKTKPGVIIVNAARGGLIDESALAEAITSGHVRGAGLDVFAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V +A+N+A  +  
Sbjct: 261 EPCTDSPLFELPQVVVTPHLGASTAEAQDRAGTDVAASVKLALAGEFVPDAVNIAGGAVN 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   V P++ LA  LG     L  E    + +   G  A  +  VL  + L G+      
Sbjct: 321 EE--VAPWLDLACKLGVLAAALSDEPPVSLSVQARGELASEDVEVLKLSALRGLFSAVVE 378

Query: 181 G-ANIISAPIIIKENAIILSTIKRDKS 206
           G    ++AP +  E  + +   K  +S
Sbjct: 379 GPVTFVNAPALAAERGVSVEISKASES 405


>gi|284045014|ref|YP_003395354.1| D-3-phosphoglycerate dehydrogenase [Conexibacter woesei DSM 14684]
 gi|283949235|gb|ADB51979.1| D-3-phosphoglycerate dehydrogenase [Conexibacter woesei DSM 14684]
          Length = 541

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 117/209 (55%), Gaps = 3/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P+T +T+  LN E  ++ K GV I+NCARG LVD+ AL + L SG VA A  DVF  
Sbjct: 206 IHLPVTPETQGWLNAEAFAQMKDGVRIVNCARGELVDDAALKDALDSGKVAGAALDVFPS 265

Query: 61  EPALQNPLF-GLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    PLF G  NV   P+LGAST E+Q++  +Q A Q+   L  G V+ A+N+  I+ 
Sbjct: 266 EPITDYPLFDGYANVVVTPHLGASTAEAQDRAGVQTAEQVIAALTGGTVTTAVNIPAIAA 325

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS-ESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
           E+  ++ PF+ L   LG     L    SI  +++ + G     +T +L+ AVL G++   
Sbjct: 326 EDMEVLGPFVPLCQVLGKLAVSLADGSSIDRLELEFFGRIGERDTRLLSVAVLQGVLTGH 385

Query: 179 -RVGANIISAPIIIKENAIILSTIKRDKS 206
                N ++AP I +E  I +   K+  S
Sbjct: 386 TEEDVNQVNAPSIAEERGIEVVETKKATS 414


>gi|126657695|ref|ZP_01728849.1| phosphoglycerate dehydrogenase [Cyanothece sp. CCY0110]
 gi|126620912|gb|EAZ91627.1| phosphoglycerate dehydrogenase [Cyanothece sp. CCY0110]
          Length = 525

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 119/212 (56%), Gaps = 5/212 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T +++NKE  SK K    +INCARGG +DE+ALAE +  G +A A  DVFE 
Sbjct: 199 LHIPKTPETTHVINKEAFSKMKPTARLINCARGGTIDEDALAEAIAEGKIAGAALDVFEE 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ L    N+   P+LGAST E+Q  VA+ +A Q+ D L+     +A+N+  ++ +
Sbjct: 259 EPLGESKLRDYENIILTPHLGASTAEAQVNVAVDVAEQIRDVLLGLPARSAVNIPGLTPD 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
               ++P++ LA+ LG  +GQL    I+ + +   G  A +    +  A + G++ +  R
Sbjct: 319 VMEKMRPYLQLAETLGNLVGQLAGGRIERLTVRLQGELASIKGQPIVVASIKGLLSQALR 378

Query: 180 VGANIISAPIIIKENAIILSTIK----RDKSG 207
              N ++A I  KE  + +   +    RD SG
Sbjct: 379 ERVNYVNAAIEAKERGVRIIETRDASLRDYSG 410


>gi|239637958|ref|ZP_04678919.1| phosphoglycerate dehydrogenase [Staphylococcus warneri L37603]
 gi|239596521|gb|EEQ79057.1| phosphoglycerate dehydrogenase [Staphylococcus warneri L37603]
          Length = 531

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 106/177 (59%), Gaps = 1/177 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KTK I+      KTK  + IIN ARGG++DE+AL   L    ++ A  DVFE 
Sbjct: 202 VHTPLTPKTKGIVGDNFFKKTKPNLQIINVARGGIIDEDALINALDHAQISRAAIDVFEH 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP L +PL     +   P+LGASTVE+QEKVA+ +++++ D L  G V +A+N   +   
Sbjct: 262 EPPLDSPLIKHDKIIVTPHLGASTVEAQEKVAVSVSNEIIDILTKGTVEHAVNAPKMDMN 321

Query: 121 EAPL-VKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR 176
           E    VK +++LA  +G F  QL+  +  E+ I Y G  A ++T +++  +++ I++
Sbjct: 322 EVDQNVKDYLSLATTIGEFGIQLLEGAPSEVTITYGGDVAKIDTSLISRTIVSNILK 378


>gi|172037049|ref|YP_001803550.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. ATCC 51142]
 gi|171698503|gb|ACB51484.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. ATCC 51142]
          Length = 525

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 118/212 (55%), Gaps = 5/212 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T +++NKE L K K    IINCARGG +DE+ALAE +  G +A A  DVFE 
Sbjct: 199 LHIPKTPETTHLINKEALGKMKPTARIINCARGGTIDEDALAEAIAEGKIAGAALDVFEE 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ L    N+   P+LGAST E+Q  VA+ +A Q+ D L+     +A+N+  ++ +
Sbjct: 259 EPLGESKLRNYDNIILTPHLGASTAEAQVNVAVDVAEQIRDVLLGLPARSAVNIPGLTPD 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
               ++P++ LA+ LG  +GQL    I+ + +   G  A      +  A + G++ +  R
Sbjct: 319 VMEKMRPYLQLAETLGNLVGQLAGGRIERLTVRLQGELASTKGQPIVVASIKGLLSQALR 378

Query: 180 VGANIISAPIIIKENAIILSTIK----RDKSG 207
              N ++A I  KE  + +   +    RD SG
Sbjct: 379 ERVNYVNAAIEAKERGVRIIETRDASIRDYSG 410


>gi|227499137|ref|ZP_03929272.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus sp. D21]
 gi|226904584|gb|EEH90502.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus sp. D21]
          Length = 529

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 115/203 (56%), Gaps = 1/203 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N+L      K K GV ++NCARGGL +E  LAE ++ G VA  G DV   
Sbjct: 204 IHTPKTEETVNMLGAAEWKKCKKGVRVVNCARGGLYNEQDLAEAVKEGIVASVGLDVVVD 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL G+P     P+LGAST E+Q+KV + +A ++ + L   +V NA+N+  I+  
Sbjct: 264 EPNPISPLIGMPQCVVTPHLGASTFEAQDKVGLAIAEEVINVLGGKMVPNAVNLPAIAAT 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   ++ ++ L D LG    QL    +  ++I+Y+G+ A   T ++  ++L G++  V R
Sbjct: 324 ELEDLRGYLALGDALGKLYYQLKKAPVDRLEIVYEGAAAQQETQMVTRSILQGLLSPVLR 383

Query: 180 VGANIISAPIIIKENAIILSTIK 202
              N+++A +  +   I ++  K
Sbjct: 384 ERVNMVNAELAAETRGITVTEGK 406


>gi|76800791|ref|YP_325799.1| D-3-phosphoglycerate dehydrogenase [Natronomonas pharaonis DSM
           2160]
 gi|76556656|emb|CAI48227.1| phosphoglycerate dehydrogenase [Natronomonas pharaonis DSM 2160]
          Length = 526

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 119/209 (56%), Gaps = 6/209 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+N+L +  L+K + G  ++NCARGG++DE ALA  ++ G VA A  DVF  
Sbjct: 199 IHTPLTPETENMLGEAELAKMEGG-YVVNCARGGIIDEPALAAAVEDGTVAGAALDVFAE 257

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP   + PL  + +V   P+LGAST  +QE VA+  A Q+        V NALN   +  
Sbjct: 258 EPLPDDSPLLDVEDVIVTPHLGASTEAAQENVAVSTAEQVVAAFNGEPVMNALNAPSMDE 317

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--V 177
              P V+P++ LA+  G    QL+   ++ +++ Y+G  A  +  ++ ++ L G+     
Sbjct: 318 SAFPRVEPYIDLAETAGKIAVQLLDSRVENVEVTYEGDIASEDVELVTASALKGVFEPLE 377

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
           W+V  N ++AP I +E  I +S  KR ++
Sbjct: 378 WQV--NAVNAPSIAEERGIGVSETKRRQA 404


>gi|196248716|ref|ZP_03147416.1| amino acid-binding ACT domain protein [Geobacillus sp. G11MC16]
 gi|196211592|gb|EDY06351.1| amino acid-binding ACT domain protein [Geobacillus sp. G11MC16]
          Length = 310

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/191 (36%), Positives = 112/191 (58%), Gaps = 3/191 (1%)

Query: 18  LSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNVFCA 77
           ++KTK GV +INCARGG++DE AL   L+SGHVA    DVFE EP   +PL    NV   
Sbjct: 1   MAKTKKGVYLINCARGGIIDEQALIPFLESGHVAGVALDVFEQEPPGDHPLLAFSNVIAT 60

Query: 78  PYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPFMTLADHLGC 137
           P+LGASTVE+Q  VA Q+A ++  ++    V++++N+  +S +    ++ F  L   LG 
Sbjct: 61  PHLGASTVEAQLNVATQVAEELLHFVEGQPVTSSINLPALSKDVYEKIQSFYHLGRKLGL 120

Query: 138 FIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRVGA--NIISAPIIIKENA 195
              Q ++  +QE+ + Y G+ A + T  +  ++LAG ++  RV +  N ++A ++ KE  
Sbjct: 121 IASQFMNIPVQELSVTYAGTVADLETTYITRSLLAGFLQ-PRVASTVNEVNAAMVAKERG 179

Query: 196 IILSTIKRDKS 206
           I       D++
Sbjct: 180 ITYGEKFSDET 190


>gi|159897613|ref|YP_001543860.1| D-3-phosphoglycerate dehydrogenase [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890652|gb|ABX03732.1| D-3-phosphoglycerate dehydrogenase [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 524

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 110/204 (53%), Gaps = 2/204 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PL + T+N+ + + LS+ K G  IINCARGG++DE AL E L+SGH+  A  DVF  
Sbjct: 199 LHIPLIDATRNLFDAQRLSQMKKGSYIINCARGGVIDEEALFEALESGHLGGAALDVFAK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP    P+   P     P+LGAST E+Q   A  +A  + D L       A+N   ++ E
Sbjct: 259 EPP-TGPIVTHPKAIVLPHLGASTEEAQALTAADVAEGIVDVLAGRSPRYAVNAPFVAPE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E  +V P++ L   L     QL+    Q  QI+Y+G+ A + +  +  AVL G++     
Sbjct: 318 EWAIVGPYLDLGRKLARLSTQLVDLPAQSYQIVYNGALAGLTSEPIKLAVLQGLLEGGSE 377

Query: 181 G-ANIISAPIIIKENAIILSTIKR 203
           G    ++AP + +E  + ++   R
Sbjct: 378 GRVTPVNAPFLARERGLTINETHR 401


>gi|197123004|ref|YP_002134955.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. K]
 gi|196172853|gb|ACG73826.1| D-3-phosphoglycerate dehydrogenase [Anaeromyxobacter sp. K]
          Length = 528

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 116/204 (56%), Gaps = 2/204 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT +T+N+++ + L++ K G  ++NCARGG+VDE ALA+ L SGH+  A  DVFE 
Sbjct: 201 LHVPLTEQTRNLVDAKVLARMKKGALLVNCARGGIVDERALADALASGHLGGAALDVFEQ 260

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E P   +PL GL      P++GAST E+Q  VA+ +A Q++ YL  GVV NA+N+  +  
Sbjct: 261 EPPPADHPLLGLDGFVATPHIGASTEEAQSAVAVAVAEQLAAYLNHGVVKNAVNVPGLPR 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           E    + PF+ L + LG    QL  +   E+ +   G  A      L +  LA  +R   
Sbjct: 321 EIMDQLAPFLPLCEKLGSLAAQLAPQGPSEVTVEVAGELAAAPIRPLAARTLAAFLRHHL 380

Query: 179 RVGANIISAPIIIKENAIILSTIK 202
               N +SAP + KE  I +  ++
Sbjct: 381 ETPVNDVSAPAVAKERGIAVREVR 404


>gi|315646394|ref|ZP_07899512.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus vortex V453]
 gi|315278037|gb|EFU41357.1| D-3-phosphoglycerate dehydrogenase [Paenibacillus vortex V453]
          Length = 530

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 63/176 (35%), Positives = 104/176 (59%), Gaps = 1/176 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T++++ +      K G+ I+NCARGG++DE AL E +  G VA A FDVFE 
Sbjct: 201 VHTPLTPETRHMIARPQFEVMKRGMRIVNCARGGIIDERALVEAIDEGIVAGAAFDVFEH 260

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP   + P    P V   P+LGAST+E+QE VAI ++ Q+   L +    NA+N  +++ 
Sbjct: 261 EPPESDHPFLTHPKVIVTPHLGASTIEAQENVAIDVSEQVLHILRNEPFKNAVNFPLVAA 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
                ++P+ +L + LG    Q+ + +++EI + Y G  A ++T  L   ++ G++
Sbjct: 321 SVMNKLQPYFSLGEKLGSVAAQITAHAVKEIHVDYAGELAEVDTQALTRYIVKGVL 376


>gi|295696411|ref|YP_003589649.1| D-3-phosphoglycerate dehydrogenase [Bacillus tusciae DSM 2912]
 gi|295412013|gb|ADG06505.1| D-3-phosphoglycerate dehydrogenase [Bacillus tusciae DSM 2912]
          Length = 527

 Score =  128 bits (322), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 73/210 (34%), Positives = 115/210 (54%), Gaps = 3/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+++++    +  K GV I+NCARGG++DE AL   L+ G V  A  DVFE 
Sbjct: 201 VHTPLTKETRHMISGPQFALMKKGVRILNCARGGIIDEKALLAALEDGTVGGAALDVFEE 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL     V   P+LGASTVE+Q  VAI +  ++ + L D    NA+N+  +  E
Sbjct: 261 EPPKDNPLLASNRVIATPHLGASTVEAQINVAIDVGEEILNILHDRPFKNAVNLPSLPAE 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               V+P++ L + LG  I Q+ +  +  I++ Y G+ A      ++  +L GI+  +  
Sbjct: 321 VMRAVQPYLALGEKLGQLISQIAAGRLYAIEVTYGGAVAEREVAPVSRTILKGILS-YHH 379

Query: 181 G--ANIISAPIIIKENAIILSTIKRDKSGV 208
           G   N ++AP I +   I ++  K  +  V
Sbjct: 380 GDEVNYVNAPFIAETLGIKVTETKTGRHKV 409


>gi|166367810|ref|YP_001660083.1| D-3-phosphoglycerate dehydrogenase [Microcystis aeruginosa
           NIES-843]
 gi|166090183|dbj|BAG04891.1| D-3-phosphoglycerate dehydrogenase [Microcystis aeruginosa
           NIES-843]
          Length = 525

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 120/212 (56%), Gaps = 5/212 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T +T++++ +E L K K  V IINC+RGG++DE AL E L+SG +A A  DVFE 
Sbjct: 199 LHVPKTPETQHLIGRETLPKMKPTVRIINCSRGGIIDELALIEALESGRIAGAALDVFEQ 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ L  L NV   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  ++ +
Sbjct: 259 EPLGESRLRELSNVILTPHLGASTTEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGLTPD 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
               ++P++ LA+ +G  + QL       + +   G  A  ++  L  A + G++ +  R
Sbjct: 319 VMEKLRPYLQLAETMGNLVSQLAGGRCDSLNVRLQGELATKDSQPLVIAAIKGLLSQALR 378

Query: 180 VGANIISAPIIIKENAIILSTIK----RDKSG 207
              N ++A I  KE  I +   +    RD SG
Sbjct: 379 ERVNYVNAAIEAKERGIRVIETRDASTRDYSG 410


>gi|34558837|gb|AAQ75181.1| D-3-phosphoglycerate dehydrogenase [Alvinella pompejana epibiont
           7G3]
          Length = 529

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 111/206 (53%), Gaps = 3/206 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ ++ + K + GV +INCARGGL DE AL   L+SG +A AG DVFE 
Sbjct: 205 IHTPKTKETIGMVGEKEIEKMRDGVILINCARGGLYDEKALYNGLKSGKIAMAGIDVFEK 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPL  L N+   P+LGA+T ESQ  +A+Q A             NALN+ I   +
Sbjct: 265 EPATNNPLLDLDNITVTPHLGANTKESQRNIAVQSAESAILSAKGISYPNALNLPIKEND 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               +KP+  L   +G  + Q   E +++I++I +G  +     +    V+  +      
Sbjct: 325 IPDSIKPYFELIQKMGNILAQATREKVEKIKVITEGEVSKYIDSITTFGVVGILKESLED 384

Query: 181 GANIISAPIIIKENAIILSTIKRDKS 206
           G N ++A  I KE  I   TI+++KS
Sbjct: 385 GVNYVNAEFIAKEVGI---TIEKEKS 407


>gi|297584460|ref|YP_003700240.1| D-3-phosphoglycerate dehydrogenase [Bacillus selenitireducens
           MLS10]
 gi|297142917|gb|ADH99674.1| D-3-phosphoglycerate dehydrogenase [Bacillus selenitireducens
           MLS10]
          Length = 536

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 117/208 (56%), Gaps = 3/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +++ E L K K    ++NCARGG++DE+AL + ++ G +  A  DV+E 
Sbjct: 210 VHTPLTKETKGMISTERLKKMKKNAYLLNCARGGIIDEDALYQAIKQGDIKGAAVDVYEE 269

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL  L  V   P++ AST E+Q  VA Q+A ++ DYL      +ALN+  I  +
Sbjct: 270 EPAKNHPLTELDEVITTPHIAASTDEAQLNVAEQVAVEILDYLKGKPAPHALNLPHIDAD 329

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   + P  +L   LG    QL  E ++E+++ Y G  +   T + N + LAG  +  RV
Sbjct: 330 EFEKMAPITSLTKVLGETATQLFREPVKEVEMHYAGELSHQETGLFNRSFLAGFFK-HRV 388

Query: 181 GA--NIISAPIIIKENAIILSTIKRDKS 206
            +  N ++A  I KE  I +S    ++S
Sbjct: 389 DSYVNEVNAVAIAKEREINVSEKHTNES 416


>gi|34557674|ref|NP_907489.1| D-3-phosphoglycerate dehydrogenase [Wolinella succinogenes DSM
           1740]
 gi|34483391|emb|CAE10389.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Wolinella succinogenes]
          Length = 528

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 111/211 (52%), Gaps = 8/211 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++ KE ++K K GV +INCARG L +E AL E LQSG +  AG DVF  
Sbjct: 204 IHTPKNKETINLIGKEEIAKMKDGVILINCARGNLYNEEALYEGLQSGKIRWAGLDVFNK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPL  LPNV+  P++GA+T+ESQEK+AIQ A    +        NALN+ I   E
Sbjct: 264 EPATNNPLLDLPNVYVTPHIGANTLESQEKIAIQAAEAAIEAARGSNYPNALNLPIKESE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               VKP++ L   +G F  Q     I   +II +G      +  ++S    G+V     
Sbjct: 324 LPLFVKPYLELVQKMGFFATQANKAPIHSFKIIAEGEI----SQYIDSLSTFGLVGALNA 379

Query: 181 G----ANIISAPIIIKENAIILSTIKRDKSG 207
                 N ++AP +  E  I L +  +   G
Sbjct: 380 SLGDKVNYVNAPYVATERGIELKSESKSAQG 410


>gi|307265064|ref|ZP_07546624.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306919862|gb|EFN50076.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 533

 Score =  127 bits (320), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK ++ ++   K K GV I+N ARGG++DE AL   ++ G VA AG DV EV
Sbjct: 198 IHLPKTEETKKMIGEKEFKKMKKGVRIVNAARGGIIDEKALYSAIKEGIVAAAGLDVLEV 257

Query: 61  EPA-------LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP          NPL  LPNV    +LGAST E+QE + I +A ++   L   +  N +N
Sbjct: 258 EPKYNVERQDFHNPLLELPNVVFTLHLGASTYEAQENIGISIAQEVISALNGNLYGNIVN 317

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +  +  +E   +KP+M LA+ +G    Q+    ++ +++IY G  +  NT ++    L G
Sbjct: 318 LPGVKSDEFSQLKPYMRLAEAMGALYYQINDTPVRLVEVIYRGEISRTNTEIVTLYALKG 377

Query: 174 IVR-VWRVGANIISAPIIIKENAI 196
            ++ V     ++++A +  KE  I
Sbjct: 378 FLKPVLEEDVSVVNAKLRAKEMGI 401


>gi|325675891|ref|ZP_08155575.1| phosphoglycerate dehydrogenase [Rhodococcus equi ATCC 33707]
 gi|325553862|gb|EGD23540.1| phosphoglycerate dehydrogenase [Rhodococcus equi ATCC 33707]
          Length = 530

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 100/174 (57%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +LN E L+K K GV I+N ARGGL+DE+AL + L +G V  AG DVFE 
Sbjct: 204 VHLPKTKETAGLLNAERLAKAKDGVIIVNAARGGLIDEDALYDALVNGKVRAAGLDVFET 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   + LF L NV   P+LGAST E+Q++    +A  +   L    V +A+N++     
Sbjct: 264 EPCTDSKLFDLDNVVVTPHLGASTSEAQDRAGTDVAKSVLLALAGEFVPDAVNVSGGPVG 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V P++ L   LG   G L  E++Q +Q++  G  +  N  +L  A L G+
Sbjct: 324 EE--VAPWLELVRKLGLLAGTLSPEAVQNVQVVASGELSAENVDILGLAALRGL 375


>gi|296127708|ref|YP_003634960.1| D-3-phosphoglycerate dehydrogenase [Brachyspira murdochii DSM
           12563]
 gi|296019524|gb|ADG72761.1| D-3-phosphoglycerate dehydrogenase [Brachyspira murdochii DSM
           12563]
          Length = 534

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 120/207 (57%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T NI+NK+N+SK K+   IINC+RGGLV+E  L   L++G +A A  DVF  
Sbjct: 199 LHIPKTPETNNIINKDNMSKMKNTAIIINCSRGGLVNEEDLKNALENGTIAAAAVDVFVN 258

Query: 61  EPALQN-PL--FGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP ++  PL  +   N+   P+LGAST E+Q  VA+ +A Q+   L  G   +A+N+  +
Sbjct: 259 EPKIETCPLTQYKNNNLILTPHLGASTKEAQINVALDVAKQIKQVLSGGYTESAVNIPSL 318

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + E+   VK +M +A++ G  I QL +  I+ ++I   G    ++   L  A+L G +  
Sbjct: 319 NPEKLEPVKDYMKIAENAGEMIMQLANGKIKSLEITAQGDLIDLDIQPLEVAILKGALSY 378

Query: 178 WRVGANIISAPIIIKENAIILSTIKRD 204
                N ++AP + K+  I + T+K +
Sbjct: 379 MFQDVNYVNAPYLAKQRGIEVKTVKSE 405


>gi|289579412|ref|YP_003478039.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter italicus
           Ab9]
 gi|289529125|gb|ADD03477.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter italicus
           Ab9]
          Length = 533

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK ++ ++   K K GV I+N ARGG++DE AL   ++ G VA AG DV EV
Sbjct: 198 IHLPKTEETKKMIGEKEFKKMKKGVRIVNAARGGIIDEKALYNAIKEGIVAAAGLDVLEV 257

Query: 61  EPA-------LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP          NPL  LPNV    +LGAST E+QE + I +A ++   L   +  N +N
Sbjct: 258 EPKYNVERQDFHNPLLELPNVVFTLHLGASTYEAQENIGISIAQEVISALNGNLYGNIVN 317

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +  +  +E   +KP+M LA+ +G    Q+    ++ +++IY G  +  NT ++    L G
Sbjct: 318 LPGVKSDEFSQLKPYMRLAEAMGALYYQINETPVRLVEVIYRGEISRTNTEIVTLYALKG 377

Query: 174 IVR-VWRVGANIISAPIIIKENAI 196
            ++ V     ++++A +  KE  I
Sbjct: 378 FLKPVLEEDVSVVNAKLRAKEMGI 401


>gi|312140491|ref|YP_004007827.1| d-3-phosphoglycerate dehydrogenase [Rhodococcus equi 103S]
 gi|311889830|emb|CBH49147.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus equi 103S]
          Length = 530

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 100/174 (57%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +LN E L+K K GV I+N ARGGL+DE+AL + L +G V  AG DVFE 
Sbjct: 204 VHLPKTKETAGLLNAERLAKAKDGVIIVNAARGGLIDEDALYDALVNGKVRAAGLDVFET 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   + LF L NV   P+LGAST E+Q++    +A  +   L    V +A+N++     
Sbjct: 264 EPCTDSKLFDLDNVVVTPHLGASTSEAQDRAGTDVAKSVLLALAGEFVPDAVNVSGGPVG 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V P++ L   LG   G L  E++Q +Q++  G  +  N  +L  A L G+
Sbjct: 324 EE--VAPWLELVRKLGLLAGTLSPEAVQNVQVVASGELSAENVDILGLAALRGL 375


>gi|282924414|ref|ZP_06332087.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9765]
 gi|282592915|gb|EFB97918.1| phosphoglycerate dehydrogenase [Staphylococcus aureus A9765]
          Length = 534

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 123/204 (60%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT KTK ++N    +K K  + IIN ARGG++DE  L + L  G ++ A  DVFE 
Sbjct: 203 LHTPLTPKTKGLINAVFFAKAKPSLQIINVARGGIIDEKVLIKALDEGQISRAAIDVFEH 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EPA  +PL     +   P+LGASTVE+QEKVAI +++++ + LIDG V++A+N   M + 
Sbjct: 263 EPATDSPLVAHDKIIVTPHLGASTVEAQEKVAISVSNEIIEILIDGTVTHAVNAPKMDLS 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + ++   VK F+ L+  +G    QL+  +   I+I Y G  A +++ +L   ++  I++ 
Sbjct: 323 NIDDT--VKSFINLSQTVGELAIQLMYNAPSSIKITYGGDLASIDSSLLTRTIITHILK- 379

Query: 178 WRVG--ANIISAPIIIKENAIILS 199
             +G   NII+A +++ +  + L+
Sbjct: 380 DDLGPEVNIINALMLLNQQQVTLN 403


>gi|331270622|ref|YP_004397114.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           BKT015925]
 gi|329127172|gb|AEB77117.1| D-3-phosphoglycerate dehydrogenase [Clostridium botulinum
           BKT015925]
          Length = 530

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 115/197 (58%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  I+ +  ++  K+GV ++N ARG L+DE AL   L++G +   G DV + 
Sbjct: 202 IHTPRTKETIGIIGEREVALMKNGVRLVNAARGKLMDEEALYNGLKNGKIKSVGLDVHDK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PL+  PNV   P++GA+T+E+QE V + +A Q+ + +   +V NA+N+  IS  
Sbjct: 262 EPRFESPLYEFPNVTVTPHIGATTIEAQENVGLTIAKQVINGIKGEIVPNAVNLPGISMG 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   +KP++ L + LG    QL +ES++ + I Y G  A  +   +  A L G++  +  
Sbjct: 322 ELKELKPYIELIEKLGKLYYQLNNESVKYVDITYWGEIAKFDVDSMERAFLKGLLEPISN 381

Query: 180 VGANIISAPIIIKENAI 196
              N I+A I+ ++N I
Sbjct: 382 DRVNYINARIVAEQNGI 398


>gi|297545554|ref|YP_003677856.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296843329|gb|ADH61845.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 533

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK ++ ++   K K GV I+N ARGG++DE AL   ++ G VA AG DV EV
Sbjct: 198 IHLPKTEETKKMIGEKEFKKMKKGVRIVNAARGGIIDEKALYNAIKEGIVAAAGLDVLEV 257

Query: 61  EPA-------LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP          NPL  LPNV    +LGAST E+QE + I +A ++   L   +  N +N
Sbjct: 258 EPKYNVERQDFHNPLLELPNVVFTLHLGASTYEAQENIGISIAQEVISALNGNLYGNIVN 317

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +  +  +E   +KP+M LA+ +G    Q+    ++ +++IY G  +  NT ++    L G
Sbjct: 318 LPGVKSDEFSQLKPYMRLAEAMGALYYQINETPVRLVEVIYRGEISRTNTEIVTLYALKG 377

Query: 174 IVR-VWRVGANIISAPIIIKENAI 196
            ++ V     ++++A +  KE  I
Sbjct: 378 FLKPVLEEDVSVVNAKLRAKEMGI 401


>gi|294496187|ref|YP_003542680.1| D-3-phosphoglycerate dehydrogenase [Methanohalophilus mahii DSM
           5219]
 gi|292667186|gb|ADE37035.1| D-3-phosphoglycerate dehydrogenase [Methanohalophilus mahii DSM
           5219]
          Length = 523

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 110/197 (55%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+NIL+ E     K    +INCARGG+++E+AL + L+   +A A  DVF  
Sbjct: 198 VHTPLTKETRNILDTEEFDLMKPTARVINCARGGIINEDALGKALKDNKIAGAAIDVFTN 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP +     GL N    P+LGAST E+Q  VA+ +A ++   L  G   + +N+  I  E
Sbjct: 258 EPPVNCSFVGLENAVVTPHLGASTEEAQVNVAVSVAEEVISVLNGGPARSTINIPSIKPE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               ++P++ LA+ LG  + QL+  + ++++I Y G  A  +T  L  A L G+++ +  
Sbjct: 318 IMSTIRPYLELAETLGSAVSQLMDGNYEKVEIAYKGDVAGKDTRHLTLAALKGVLKTIMG 377

Query: 180 VGANIISAPIIIKENAI 196
              N ++AP I K   I
Sbjct: 378 ASVNYVNAPSIAKSRDI 394


>gi|159027379|emb|CAO90566.1| serA [Microcystis aeruginosa PCC 7806]
          Length = 525

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 121/212 (57%), Gaps = 5/212 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T +T++++ +E ++K K  V IINC+RGG++DE AL E L+SG +A A  DVFE 
Sbjct: 199 LHVPKTPETQHLIGRETIAKMKPTVRIINCSRGGIIDELALIEALESGRIAGAALDVFEQ 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ L  L NV   P+LGAST E+Q  VA+ +A Q+ D L+     +A+N+  ++ +
Sbjct: 259 EPLGESRLRELSNVILTPHLGASTTEAQVGVAVDVAEQIRDVLLGLPARSAVNIPGLTPD 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
               ++P++ LA+ +G  + QL       + +   G  A  ++  L  A + G++ +  R
Sbjct: 319 VMEKLRPYLQLAETMGNLVSQLAGGRCDSLNVRLQGELATKDSQPLVVAAIKGLLSQALR 378

Query: 180 VGANIISAPIIIKENAIILSTIK----RDKSG 207
              N ++A I  KE  I +   +    RD SG
Sbjct: 379 ERVNYVNAAIEAKERGIRVIETRDASTRDYSG 410


>gi|86606026|ref|YP_474789.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. JA-3-3Ab]
 gi|86554568|gb|ABC99526.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. JA-3-3Ab]
          Length = 527

 Score =  127 bits (319), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 112/199 (56%), Gaps = 3/199 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T +T N+ N E     K    +INCARGGLVDE AL E L+SG +A A  DVF  
Sbjct: 199 LHVPKTPETTNLFNAETFRMMKPTARLINCARGGLVDEQALYEALKSGQIAGAALDVFAD 258

Query: 61  EP-ALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP +  +PL  L   +   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  + 
Sbjct: 259 EPLSKDSPLLSLGKEILLTPHLGASTEEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGLQ 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV- 177
            E    +KP++ LA+ LG  +GQL  + + +++I   GS A  +   +  A L G++ + 
Sbjct: 319 AEVLQSLKPYLDLAETLGNLVGQLAGDRVSQLEIRLQGSLAEKDGQPIVIAALKGLLTLA 378

Query: 178 WRVGANIISAPIIIKENAI 196
            R   N ++A I  KE  I
Sbjct: 379 LRERVNYVNASIEAKERGI 397


>gi|114565585|ref|YP_752739.1| D-3-phosphoglycerate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114336520|gb|ABI67368.1| D-3-phosphoglycerate dehydrogenase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 530

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 103/175 (58%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T +++++  L   K GV ++NCARGG++ E AL + L+S  V  AG DVFE 
Sbjct: 202 VHTPRNEETMHMIDERILGLAKEGVRVVNCARGGIIKEEALLKGLESKKVLSAGLDVFEK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA+ NPLF   +V   P+LGA T E+Q++V   +A Q+   L   +V N +N+  +  +
Sbjct: 262 EPAIDNPLFQFKSVVVTPHLGADTFEAQKRVGENIAEQVIKALKGEIVPNLVNLPAMLKD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
           E   +KP++TLA+ LG    Q+   ++  +++ Y G  +   T +L  A L G++
Sbjct: 322 ELEYLKPYITLAEKLGNIYYQMEKSAVSRVELTYSGPISSNETEILTVAFLKGLL 376


>gi|167040920|ref|YP_001663905.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X514]
 gi|300913871|ref|ZP_07131188.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307725445|ref|YP_003905196.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
 gi|166855160|gb|ABY93569.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X514]
 gi|300890556|gb|EFK85701.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X561]
 gi|307582506|gb|ADN55905.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter sp. X513]
          Length = 531

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 114/204 (55%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK +L+++   K K GV I+N ARGG++DE AL   ++ G VA AG DV EV
Sbjct: 198 IHLPKTEETKKMLSEKEFKKMKKGVRIVNAARGGIIDEKALYNAIKEGIVAAAGLDVLEV 257

Query: 61  EPA-------LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP          NPL  LPNV    ++GAST E+QE + I +A ++   L   +  N +N
Sbjct: 258 EPKYNVERQDFHNPLLELPNVVFTLHIGASTYEAQENIGISIAQEVISALNGNLYGNIVN 317

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +  +  +E   +KP+M LA+ +G    Q+    ++ +++IY G  +  NT ++    L G
Sbjct: 318 LPGVKSDEFSQLKPYMKLAEAMGALYYQINDTPVRLVEVIYRGEISRTNTDIVTLYALKG 377

Query: 174 IVR-VWRVGANIISAPIIIKENAI 196
            ++ V     ++++A +  KE  I
Sbjct: 378 FLKPVLEEDVSVVNARLRAKEMGI 401


>gi|256751636|ref|ZP_05492511.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|256749445|gb|EEU62474.1| D-3-phosphoglycerate dehydrogenase [Thermoanaerobacter ethanolicus
           CCSD1]
          Length = 531

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 114/204 (55%), Gaps = 8/204 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK +L+++   K K GV I+N ARGG++DE AL   ++ G VA AG DV EV
Sbjct: 198 IHLPKTEETKKMLSEKEFKKMKRGVRIVNAARGGIIDEKALYNAIKEGIVAAAGLDVLEV 257

Query: 61  EPA-------LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP          NPL  LPNV    ++GAST E+QE + I +A ++   L   +  N +N
Sbjct: 258 EPKYNVERQDFHNPLLELPNVVFTLHIGASTYEAQENIGISIAQEVISALNGNLYGNIVN 317

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +  +  +E   +KP+M LA+ +G    Q+    ++ +++IY G  +  NT ++    L G
Sbjct: 318 LPGVKSDEFSQLKPYMKLAEAMGALYYQINDTPVRLVEVIYRGEISRTNTDIVTLYALKG 377

Query: 174 IVR-VWRVGANIISAPIIIKENAI 196
            ++ V     ++++A +  KE  I
Sbjct: 378 FLKPVLEEDVSVVNARLRAKEMGI 401


>gi|220908749|ref|YP_002484060.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7425]
 gi|219865360|gb|ACL45699.1| D-3-phosphoglycerate dehydrogenase [Cyanothece sp. PCC 7425]
          Length = 652

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 113/198 (57%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T++++  E L++ K    IINCARGG++DE AL E L+ G +A A  DVFE 
Sbjct: 325 LHLPKTPETQHLIKAETLARMKPTARIINCARGGIIDEAALVEALKEGKIAGAALDVFEN 384

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++PL  L   V   P+LGAST E+Q  VAI +A Q+ D  +   V +A+N+  +  
Sbjct: 385 EPLGESPLLSLGKEVVLTPHLGASTEEAQTNVAIDVAEQIRDLFLGKPVRSAVNIPGLRP 444

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           +    +KP++ LA+ LG  +GQL    I+ + +   G  A  ++  +  A L G++    
Sbjct: 445 DVLEKLKPYLQLAETLGNLVGQLAGGRIEALDVRLQGELASNDSQPIVVAALKGLLTPAL 504

Query: 179 RVGANIISAPIIIKENAI 196
           R   N ++A I  KE  I
Sbjct: 505 RERVNFVNAAIEAKERGI 522


>gi|322379237|ref|ZP_08053628.1| D-3-phosphoglycerate dehydrogenase [Helicobacter suis HS1]
 gi|321148377|gb|EFX42886.1| D-3-phosphoglycerate dehydrogenase [Helicobacter suis HS1]
          Length = 524

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 109/199 (54%), Gaps = 1/199 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T NI++ E +++ K GV +INCARGGL +E AL   L+S  +   G DVF  
Sbjct: 201 IHTPKNQETINIIDAEQIAQMKEGVILINCARGGLYNETALYNALKSHKIRWLGLDVFSK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + NPL  L NV+  P++GA+T+ESQE++A+Q      + L      NALN+ I    
Sbjct: 261 EPGINNPLLDLENVYVTPHIGANTLESQEQIALQAIQAALEALRGSSYPNALNIPIQE-N 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            AP  KP+++L   LG    Q+  ++   +++I  G     +  +L  A++  +      
Sbjct: 320 IAPYAKPYLSLTQKLGFLCSQINKDACNGLELILAGPIKEYSNSLLTFALMGLLKPTLGE 379

Query: 181 GANIISAPIIIKENAIILS 199
             N ++AP I KE  I LS
Sbjct: 380 KVNYVNAPFIAKERNITLS 398


>gi|206901901|ref|YP_002251552.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
 gi|206741004|gb|ACI20062.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus thermophilum
           H-6-12]
          Length = 525

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 123/207 (59%), Gaps = 5/207 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT +TKN++ K+ L   K    +INCARGGLVDE+AL E+L+   +A A  DVF+ 
Sbjct: 202 LHLPLTQETKNLIGKKELEMMKPTAYLINCARGGLVDEDALYEVLKEKKIAGAALDVFKN 261

Query: 61  EPA-LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    NPL  L NV   P+LGAST E+QEKVA+ +A  +  +    +VS+A+N+ I   
Sbjct: 262 EPINPDNPLLTLDNVVLTPHLGASTQEAQEKVALIVAEDIIRFFKGEMVSHAVNLPI--- 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           + +P + PF+ L + LG  + Q+ + + +E++I   G  A      L SAV+ G +  + 
Sbjct: 319 QISPDILPFVKLGEKLGKLLAQITNANPEELEIKICGDLAQKIETSLASAVVKGFLEPIL 378

Query: 179 RVGANIISAPIIIKENAIILSTIKRDK 205
               N+I+A  + K+  + +  ++ ++
Sbjct: 379 GEDVNLINAMAMAKDRRLKIVEVRTEE 405


>gi|113954952|ref|YP_731454.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9311]
 gi|113882303|gb|ABI47261.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9311]
          Length = 528

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 120/211 (56%), Gaps = 7/211 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N E L   KS   I+NCARGG+VDE A+AE ++SG +A AG DVF  
Sbjct: 199 LHIPRTPDTENLVNAELLRTMKSTARIVNCARGGIVDEPAIAEAIESGVIAGAGLDVFAS 258

Query: 61  EPALQN-PLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  Q+ PL  +   +   P+LGAST E+QE VA+ +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLAQDSPLRAVERGLVLTPHLGASTEEAQENVAVDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
            E    +KP + LA+ LG  + QL    IQE+++   G  A   +  L  A L G++   
Sbjct: 319 AEIMERLKPHLQLAETLGLLVSQLSGGQIQELEVRLQGEFASHPSQPLVVAALKGLLSTA 378

Query: 179 ---RVGANIISAPIIIKENAIILSTIKRDKS 206
              R+  N ++A +  K   I +  IK D S
Sbjct: 379 LGDRI--NYVNASLEAKGRGIHVLEIKDDAS 407


>gi|300870001|ref|YP_003784872.1| D-3-phosphoglycerate dehydrogenase [Brachyspira pilosicoli 95/1000]
 gi|300687700|gb|ADK30371.1| D-3-phosphoglycerate dehydrogenase [Brachyspira pilosicoli 95/1000]
          Length = 534

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 118/207 (57%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T NI+NK+NL K K    IINC+RGGLV+E  L + L++G +A A  DVF  
Sbjct: 199 LHIPKTPETNNIINKDNLCKMKKNAIIINCSRGGLVNEEDLKQALENGTIAAAAVDVFVN 258

Query: 61  EPALQN-PL--FGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP ++  PL  +   N+   P+LGAST E+Q  VA+ +A Q+   L  G   +A+N+  +
Sbjct: 259 EPKIETCPLVEYKNDNLILTPHLGASTKEAQINVALDVAKQIKQVLSGGYTESAVNIPSL 318

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + E+   VK +M +A++ G  I Q+ +  I+  +I   G    ++   L  AVL G +  
Sbjct: 319 NPEKLEPVKDYMKIAENAGEMIMQISTGKIKSFEITAQGELINLDIQPLEVAVLKGALSS 378

Query: 178 WRVGANIISAPIIIKENAIILSTIKRD 204
                N ++AP + K+  I + TIK +
Sbjct: 379 MLQDVNYVNAPYLAKQRGIEVKTIKSE 405


>gi|217966485|ref|YP_002351991.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 6724]
 gi|217335584|gb|ACK41377.1| D-3-phosphoglycerate dehydrogenase [Dictyoglomus turgidum DSM 6724]
          Length = 525

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 107/176 (60%), Gaps = 4/176 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  TKN++ K+ L   K    +INCARGGLVDE+AL E+L+   +A A  DVF+ 
Sbjct: 202 LHLPLTQDTKNLIGKKELEMMKPTAYLINCARGGLVDEDALYEILKEKKIAGAALDVFKN 261

Query: 61  EPA-LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    NPL  L NV   P+LGAST E+QEKVA+ +A ++  +    +VS+A+N+ I   
Sbjct: 262 EPINPDNPLLTLDNVVLTPHLGASTQEAQEKVALIVAEEIIRFFKGEMVSHAVNLPI--- 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
           + +P + PF  L + LG  + Q+ + + +E++I   G  A      L SAV+ G +
Sbjct: 319 QISPEIMPFAKLGEKLGKLLAQITNANPEELEIQICGDLAQRIETSLASAVVKGFL 374


>gi|284049355|ref|YP_003399694.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus fermentans DSM
           20731]
 gi|283953576|gb|ADB48379.1| D-3-phosphoglycerate dehydrogenase [Acidaminococcus fermentans DSM
           20731]
          Length = 529

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 105/174 (60%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N++ KE L K K GV ++NCARGGL +E A+A+ ++ G VA  G DV   
Sbjct: 204 IHTPKTEETINMIGKEELKKCKKGVRLVNCARGGLYNEQAVADAIKEGQVASIGLDVLVD 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL GL      P+LGA TVE+Q+KV I +A ++ + L   +V NA+N+  +  +
Sbjct: 264 EPKPISPLIGLEQCVLTPHLGADTVEAQDKVGISIAQEVVNVLNGQMVPNAVNLPALHPQ 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   +  ++ L + LG    Q+  + + +++++Y+G  A + T ++  ++L G+
Sbjct: 324 ELEGMMGYLQLGECLGKLYYQMEKDPVDKVEVVYEGPAANLETTLITRSILKGL 377


>gi|260889453|ref|ZP_05900716.1| phosphoglycerate dehydrogenase [Leptotrichia hofstadii F0254]
 gi|260860864|gb|EEX75364.1| phosphoglycerate dehydrogenase [Leptotrichia hofstadii F0254]
          Length = 530

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 117/205 (57%), Gaps = 1/205 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T +++N EN+ K K GV ++N ARGGL +E A+AE L+SG +A  G+DV  V
Sbjct: 202 IHTPKTKETVDMINAENIHKLKDGVRLVNAARGGLFNEEAVAEGLRSGKIASFGYDVHTV 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  +  L+   N    P++GA+T E+Q  V  Q+  Q+ + L   +V  A+N+  I  E
Sbjct: 262 EPRSECILYEFENAITTPHIGATTYEAQRNVGTQVVKQVLNGLRGEIVETAVNLPAIGRE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E  +VKPF+ LA+ LG    Q+    I  + + Y G  A   T +++S  + GI+  V +
Sbjct: 322 EFLIVKPFINLAEKLGKIYFQIEKTPITNVVLNYYGEIAEQETALVDSTAIKGILEPVLK 381

Query: 180 VGANIISAPIIIKENAIILSTIKRD 204
              N I++  + ++  I +S  K++
Sbjct: 382 EEVNYINSKPLAEKRGINISINKKE 406


>gi|111225204|ref|YP_715998.1| D-3-phosphoglycerate dehydrogenase [Frankia alni ACN14a]
 gi|111152736|emb|CAJ64480.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Frankia alni ACN14a]
          Length = 530

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 111/200 (55%), Gaps = 8/200 (4%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  + L++TK GV I+N ARGGLVDE ALAE + SGHV  AG DVF  
Sbjct: 199 IHLPKTPETLGLIGADELARTKPGVIIVNAARGGLVDEAALAESVASGHVGGAGIDVFVT 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM---AII 117
           EP   +PLFGL NV   P+LGAST E+Q+K  + +A  +   L    V +A+N+    ++
Sbjct: 259 EPTTASPLFGLDNVVVTPHLGASTQEAQDKAGLAVARSVRLALQGEFVPDAVNVQAGGVV 318

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VR 176
           + +    V+P + LA+ LG     L       I +   G  AV +  VL  A L G+   
Sbjct: 319 AED----VRPGLPLAEKLGQLFSGLAGGLAAAITVEVRGEIAVHDVSVLQLAALKGVFTD 374

Query: 177 VWRVGANIISAPIIIKENAI 196
           V       ++AP++ KE  +
Sbjct: 375 VIEEQVTYVNAPLLAKERGV 394


>gi|118617543|ref|YP_905875.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium ulcerans Agy99]
 gi|118569653|gb|ABL04404.1| D-3-phosphoglycerate dehydrogenase SerA1 [Mycobacterium ulcerans
           Agy99]
          Length = 528

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 111/207 (53%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +L KE L+KTK GV I+N ARGGL+DE+ALAE + SG+V  AG DVF  
Sbjct: 201 VHLPKTPETAGLLGKEALAKTKPGVIIVNAARGGLIDESALAEAITSGYVRGAGLDVFAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V +A+N+A  +  
Sbjct: 261 EPCTDSPLFELPQVVVTPHLGASTAEAQDRAGTDVAASVKLALAGEFVPDAVNIAGGAVN 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   V P++ LA  LG     L  E    + +   G  A  +  VL  + L G+      
Sbjct: 321 EE--VAPWLDLACKLGVLAAALSDEPPVSLSVQAGGELASEDVEVLKLSALRGLFSAVVE 378

Query: 181 G-ANIISAPIIIKENAIILSTIKRDKS 206
           G    ++AP +  E  + +   K  +S
Sbjct: 379 GPVTFVNAPALAAERGVSVEISKASES 405


>gi|307352504|ref|YP_003893555.1| D-3-phosphoglycerate dehydrogenase [Methanoplanus petrolearius DSM
           11571]
 gi|307155737|gb|ADN35117.1| D-3-phosphoglycerate dehydrogenase [Methanoplanus petrolearius DSM
           11571]
          Length = 528

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 120/209 (57%), Gaps = 3/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +TK+++NK++++  K GV IINCARGG+++E+ L + + +G VA A  DV+E 
Sbjct: 200 VHTPLIKETKHLINKKSIAVMKDGVRIINCARGGIINESDLYDAIVAGKVAGAALDVYEN 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   + +  L  V   P+LGASTVE+Q  VA+ +A Q  + L  G     +N  +IS +
Sbjct: 260 EPPKDSKIITLDEVITTPHLGASTVEAQLNVAVSVAKQCIEVLKGGSAKFVVNAPMISPD 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVM--NTMVLNSAVLAGIVR-V 177
           +   + P++ L  ++G  + QL+   I+ ++I Y G  A     +  +    L GI+  +
Sbjct: 320 QQDRIDPYVKLVRNMGSLLIQLVEGRIESVEIEYGGKAAEFGSGSKYITRMALKGILDPI 379

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
            +   NI++A +  KE  I +S +  DKS
Sbjct: 380 LQTPVNIVNAELAAKERGIRVSEVITDKS 408


>gi|327401404|ref|YP_004342243.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus veneficus SNP6]
 gi|327316912|gb|AEA47528.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus veneficus SNP6]
          Length = 523

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 117/205 (57%), Gaps = 2/205 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVP T +T+ ++++E ++  K G  +INCARGGLVDE AL + L+ G +A A  DV+E 
Sbjct: 199 IHVPKTKETEGLISREKIAIMKDGAYLINCARGGLVDEKALYDALKEGKLAGAALDVYEK 258

Query: 61  EPA-LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    NPLF L NV   P+LGAST E+Q  V + +A+++ +      V NA+N+  +  
Sbjct: 259 EPPDANNPLFTLENVVTTPHLGASTKEAQISVGMTVANEIINMAKGLPVRNAVNLPSMDA 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
            E   + P++ LA+ +G      +  +++ ++I + G  A + T  +  A+L G++    
Sbjct: 319 REYEYIMPYLKLAEKMGRLAASRL-RAVRSVRITFRGRLAEVKTEFVTRALLKGLLEGIV 377

Query: 180 VGANIISAPIIIKENAIILSTIKRD 204
              N++SA  + +E  I +   + D
Sbjct: 378 SNINLVSALPVARERGIAIEETRGD 402


>gi|170077862|ref|YP_001734500.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7002]
 gi|169885531|gb|ACA99244.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7002]
          Length = 525

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 120/208 (57%), Gaps = 4/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T +T +++ +E+++K K    I+NCARGG+VDE A+A+ +Q G +  A  DVFE 
Sbjct: 199 LHVPKTPETTHLIGEESIAKMKPTTRIVNCARGGVVDEAAVAKAIQEGRLGGAALDVFEE 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ L  L NV   P+LGAST E+Q  VA+ +A Q+ D ++     +A+N+  ++  
Sbjct: 259 EPLGESELRALDNVVLTPHLGASTAEAQVNVAVDVAEQIRDVILGLPARSAVNIPGLNAN 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               ++P++ LA+ LG  +GQL    I+++ +   G  A      L  A L G++    R
Sbjct: 319 VMEKLRPYLQLAETLGNMVGQLAGGRIEKLNVTLQGDLAEKEAKPLVVAALKGLLSPALR 378

Query: 180 VGANIISAPIIIKENAI-ILSTIKRDKS 206
              N ++A I  KE  I I+ T  RD+S
Sbjct: 379 ERVNYVNAEIEAKERGIRIIET--RDES 404


>gi|282895559|ref|ZP_06303693.1| D-3-phosphoglycerate dehydrogenase [Raphidiopsis brookii D9]
 gi|281199399|gb|EFA74263.1| D-3-phosphoglycerate dehydrogenase [Raphidiopsis brookii D9]
          Length = 526

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 112/198 (56%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P   KT N++N + L K K    IINCARGG++DE ALA+ +++G +A A  DVF+ 
Sbjct: 199 LHIPKHRKTTNLINAKTLGKMKPTTRIINCARGGIIDELALADAIKNGKIAGAALDVFQS 258

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP   +PL  L   +   P+LGAST E+Q  V+I +A Q+ D L+     +A+N+  +  
Sbjct: 259 EPLGDSPLRSLGKEIILTPHLGASTTEAQVNVSIDVAEQIRDVLLGLPARSAVNIPGLGP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
           +    +KP+M LA+ LG  +GQL    I+ + +   G  A   +  L  A L G++ +  
Sbjct: 319 DIIEELKPYMQLAETLGNLVGQLAGGRIETLNVKLQGDLATNKSQPLVVAALKGLLYQAL 378

Query: 179 RVGANIISAPIIIKENAI 196
           R   N ++A I  KE  I
Sbjct: 379 RERVNYVNATIEAKERGI 396


>gi|282899725|ref|ZP_06307688.1| D-3-phosphoglycerate dehydrogenase [Cylindrospermopsis raciborskii
           CS-505]
 gi|281195340|gb|EFA70274.1| D-3-phosphoglycerate dehydrogenase [Cylindrospermopsis raciborskii
           CS-505]
          Length = 526

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 113/198 (57%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T N++N + L K K    IINCARGG++DE ALA+ +++G +A A  DVF+ 
Sbjct: 199 LHIPKTPETTNLINAKTLGKMKPTTRIINCARGGIIDELALADAIKNGKIAGAALDVFQS 258

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP   +PL  L   +   P+LGAST E+Q  V+I +A Q+ D L+     +A+N+  +  
Sbjct: 259 EPLGDSPLRSLGKEIILTPHLGASTTEAQVNVSIDVAEQIRDVLLGLPARSAVNIPGLGP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
           +    +KP+M LA+ LG  +GQL    I+ + +   G  A   +  L  A L G++ +  
Sbjct: 319 DIIEELKPYMQLAETLGNLVGQLAGGRIETLNVKLQGDLATNKSQPLVVAALKGLLYQAL 378

Query: 179 RVGANIISAPIIIKENAI 196
           R   N ++A I  KE  I
Sbjct: 379 RERVNYVNATIEAKERGI 396


>gi|254422032|ref|ZP_05035750.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7335]
 gi|196189521|gb|EDX84485.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. PCC 7335]
          Length = 526

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 116/199 (58%), Gaps = 4/199 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T N++N ++L+K K    IINCARGG++DE ALA+ L  G +A A  DV+  
Sbjct: 199 LHIPKTPDTANLINADSLAKMKPSARIINCARGGIIDEAALAQALNDGVIAGAALDVYSE 258

Query: 61  EPALQNPL--FGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  ++PL   G P V   P+LGAST E+Q  VA+ +A Q+ D L++    +A+N+  + 
Sbjct: 259 EPLGESPLRAVGKPLVLT-PHLGASTAEAQVNVAVDVAEQIRDVLLELPARSAVNIPGLR 317

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RV 177
            +    ++P++ LA+ LG F+GQL    I+E+ I   G  A  +T  +  A L G++   
Sbjct: 318 PDVLEKLRPYLNLAETLGNFVGQLAGGRIEELNIKLQGELAQNDTKPVVVAALKGLLSNA 377

Query: 178 WRVGANIISAPIIIKENAI 196
            +   N ++A I  KE  I
Sbjct: 378 LQERVNYVNASIEAKERGI 396


>gi|322368216|ref|ZP_08042785.1| D-3-phosphoglycerate dehydrogenase [Haladaptatus paucihalophilus
           DX253]
 gi|320552232|gb|EFW93877.1| D-3-phosphoglycerate dehydrogenase [Haladaptatus paucihalophilus
           DX253]
          Length = 527

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 118/205 (57%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ +++ E L++ + G  I+NCARGG++DE+ALAE +  G +A A  DVF  
Sbjct: 199 VHTPLTPETEGLISTEELAQVEGG-YIVNCARGGVIDEDALAEAVADGVLAGAAVDVFAE 257

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    NPL  + +V   P+LGAST  +QE VA   A Q+   L +  V NALN   +  
Sbjct: 258 EPLPKDNPLLDVDDVILTPHLGASTEAAQENVATSTADQVVAALREEPVINALNAPSVEE 317

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--V 177
              P V+P++ LA+  G    QL+ E I+ I++ Y+G  A     ++ ++   G+ +   
Sbjct: 318 SAFPRVRPYIELAETAGKIATQLLDERIERIEVNYEGDIAEEEVDLVTASAQKGVFQPLE 377

Query: 178 WRVGANIISAPIIIKENAIILSTIK 202
           W+V  N ++AP I +E  + ++  K
Sbjct: 378 WQV--NAVNAPQIAEERGVEVTESK 400


>gi|319790479|ref|YP_004152112.1| D-3-phosphoglycerate dehydrogenase [Thermovibrio ammonificans HB-1]
 gi|317114981|gb|ADU97471.1| D-3-phosphoglycerate dehydrogenase [Thermovibrio ammonificans HB-1]
          Length = 533

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 113/204 (55%), Gaps = 2/204 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++T+N++ K  + K K GV ++N ARGG+++E  L E L SG V  A  DVF  
Sbjct: 207 VHTPLTDETRNMITKREIEKMKDGVILLNIARGGIINEKDLYEALVSGKVRAAAVDVFSK 266

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N L   PN+   P++GA+T ESQ  VA+ +A+Q+   L    V  A+N       
Sbjct: 267 EPATDNILLDAPNIVVTPHIGANTFESQTNVAVIIANQVLAALRGEEVEFAVNAPFEDTT 326

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
            A  +KP+M LA+ LG F  Q+     +EI + + G         + +A L G + +V  
Sbjct: 327 AAKNLKPYMELAEKLGLFAVQVACSRSKEIVLEFRGELG-EEVKPITTAFLKGYLQKVVD 385

Query: 180 VGANIISAPIIIKENAIILSTIKR 203
           +  N+I+AP + KE  I +  ++R
Sbjct: 386 IPVNLINAPFLAKEKGISVVEVRR 409


>gi|86742318|ref|YP_482718.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. CcI3]
 gi|86569180|gb|ABD12989.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. CcI3]
          Length = 529

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 108/197 (54%), Gaps = 2/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  + L++T+ GV I+N ARGGLVDE ALAE ++SG V  AG DVF  
Sbjct: 199 IHLPKTPETLGLIGTDELARTRPGVIIVNAARGGLVDEAALAEAVRSGQVGGAGIDVFAK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLFGL NV   P+LGAST E+Q+K  + +A  +   L    V +A+N+      
Sbjct: 259 EPTTASPLFGLDNVVVTPHLGASTQEAQDKAGLAVARSVRLALQGEFVPDAVNVQAGGVV 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVWR 179
              L +P + LA+ LG     L       I +   G  AV +  VL  AVL G+   V  
Sbjct: 319 AEDL-RPGLPLAEKLGQLFSGLAGSLAAAITVEVRGEIAVHDVSVLQLAVLKGVFTDVTE 377

Query: 180 VGANIISAPIIIKENAI 196
                ++AP++ KE  +
Sbjct: 378 EQVTYVNAPLLAKERGV 394


>gi|224370615|ref|YP_002604779.1| D-3-phosphoglycerate dehydrogenase [Desulfobacterium autotrophicum
           HRM2]
 gi|223693332|gb|ACN16615.1| SerA1 [Desulfobacterium autotrophicum HRM2]
          Length = 526

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 102/175 (58%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVP    T ++L+K+  S  K+GV IINCARGG+++E  L + + S  VA A  DVFE 
Sbjct: 200 IHVPKIEATTHLLDKQAFSMMKTGVMIINCARGGIIEEKDLYDAIVSKKVAGAALDVFEK 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   NPL  L  V   P+LGAST E+Q  VA+ +A+Q+  YL    + NA+N+  ++ E
Sbjct: 260 EPPKDNPLLTLDEVIATPHLGASTKEAQTNVAVAVANQIIAYLKRDTIINAVNVPSVTGE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
               +KP++ LA+ +G    QL+    +EI I Y G+   +N   +  A L G +
Sbjct: 320 LLTKLKPYLFLAEKMGLMQSQLVKGPFKEIVIEYAGNFFDLNLKPVTLAALRGFL 374


>gi|319956089|ref|YP_004167352.1| d-3-phosphoglycerate dehydrogenase [Nitratifractor salsuginis DSM
           16511]
 gi|319418493|gb|ADV45603.1| D-3-phosphoglycerate dehydrogenase [Nitratifractor salsuginis DSM
           16511]
          Length = 530

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 102/196 (52%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ KE ++K K GV +INCARGGL DE AL E L+SG +A AG DVF  
Sbjct: 205 IHTPKTEETIGMIGKEEIAKMKDGVILINCARGGLYDEEALYEGLKSGKIAMAGIDVFSK 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA+ NPL  L NV   P+LGA+T ESQ  +A+Q A             NALN+ I   E
Sbjct: 265 EPAIDNPLLDLNNVTVTPHLGANTRESQRNIAVQAAENAIAAAKGIAYPNALNLPIRENE 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               V PF+ L   +G    Q+     + I++I +G  +     +   A +  +      
Sbjct: 325 LPEFVMPFLELTQKIGYMSAQVAKSGAKAIKVIAEGPVSEYIDSLTTFATVGVMSEALAD 384

Query: 181 GANIISAPIIIKENAI 196
             N ++A  + KE  I
Sbjct: 385 SINYVNAEYVAKEREI 400


>gi|315636539|ref|ZP_07891775.1| phosphoglycerate dehydrogenase [Arcobacter butzleri JV22]
 gi|315479188|gb|EFU69885.1| phosphoglycerate dehydrogenase [Arcobacter butzleri JV22]
          Length = 528

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 108/199 (54%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T ++++ + + K K GV +INCARGGL +E AL E L+SG +A AG DVF+ 
Sbjct: 204 IHTPKNKETIDMISFDEIKKMKDGVVLINCARGGLYNEEALYENLKSGKIAMAGIDVFKK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPL  LPN+    +LGA+T ESQ+++AIQ A+   +        NALN+ I   +
Sbjct: 264 EPATSNPLLDLPNITVTAHLGANTKESQKEIAIQAANNAIESARGIAYPNALNLPIDESK 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P VKP++ L   +   + Q+    I+ I +  +G  A     +   A L  +      
Sbjct: 324 IPPFVKPYIELTQKMAFLLAQISKSEIRSINVSAEGELADYLDSLQTFATLGILAVSCGS 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  I KE  I LS
Sbjct: 384 EVNYVNANFIAKEKGIDLS 402


>gi|157738251|ref|YP_001490935.1| D-3-phosphoglycerate dehydrogenase [Arcobacter butzleri RM4018]
 gi|157700105|gb|ABV68265.1| D-3-phosphoglycerate dehydrogenase [Arcobacter butzleri RM4018]
          Length = 528

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 108/199 (54%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T ++++ + + K K GV +INCARGGL +E AL E L+SG +A AG DVF+ 
Sbjct: 204 IHTPKNKETIDMISFDEIKKMKDGVVLINCARGGLYNEEALYENLKSGKIAMAGIDVFKK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  NPL  LPN+    +LGA+T ESQ+++AIQ A+   +        NALN+ I   +
Sbjct: 264 EPATSNPLLDLPNITVTAHLGANTKESQKEIAIQAANNAIESARGIAYPNALNLPIDESK 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P VKP++ L   +   + Q+    I+ I +  +G  A     +   A L  +      
Sbjct: 324 IPPFVKPYIELTQKMAFLLAQISKSEIRSINVSAEGELADYLDSLQTFATLGILAVSCGS 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  I KE  I LS
Sbjct: 384 EVNYVNANFIAKEKGIDLS 402


>gi|297798490|ref|XP_002867129.1| hypothetical protein ARALYDRAFT_491252 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297312965|gb|EFH43388.1| hypothetical protein ARALYDRAFT_491252 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 603

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  ILN E  +K K GV I+N ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 260 LHMPLTPTTSKILNDETFAKMKKGVRIVNVARGGVIDEDALVRALDSGIVAQAALDVFTK 319

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  + L     V   P+LGAST+E+QE VAI++A  +   L   + + A+N  ++S 
Sbjct: 320 EPPAKDSKLVQHERVTVTPHLGASTMEAQEGVAIEIAEAVVGALNGELAATAVNAPMVSA 379

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +KP++ LA+ LG    QL++    ++ ++I Y  + A   ++T +L + +  GI+
Sbjct: 380 EVLTELKPYVVLAEKLGRLAVQLVAGGSGVKNVKITYASARATDDLDTRLLRAMITKGII 439

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + LS
Sbjct: 440 EPISDVYVNLVNADFTAKQRGLRLS 464


>gi|312135806|ref|YP_004003144.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor owensensis
           OL]
 gi|311775857|gb|ADQ05344.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor owensensis
           OL]
          Length = 531

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 116/215 (53%), Gaps = 8/215 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N+++++   K K GV I+NCARGG+++EN L   ++ G VA A  DV E 
Sbjct: 199 IHTPKTKETYNLISEKEFKKMKKGVRIVNCARGGVINENDLYNAIKEGIVAAAALDVLEK 258

Query: 61  EPALQ-------NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP  +       NPL  L NV   P+LGAST E+Q  VA+ +A +++  L  G+  NA+N
Sbjct: 259 EPNFELEKQDYYNPLLELDNVVITPHLGASTQEAQVNVAVSVAKEVAAVLKGGIAKNAVN 318

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +     E    + P++ LA+ +G    Q       +I+IIY G      T  L  A+L G
Sbjct: 319 LPAFEKERLEEIMPYLELAEAMGKIFIQAERTFANKIEIIYSGQIDEKTTTWLTRALLKG 378

Query: 174 IVRVW-RVGANIISAPIIIKENAIILSTIKRDKSG 207
            +    +   N +++ ++ KE  I +   K+++SG
Sbjct: 379 YLEFSVQDTVNYVNSQLLAKEQGIEVIESKKEESG 413


>gi|289549238|ref|YP_003474226.1| D-3-phosphoglycerate dehydrogenase [Thermocrinis albus DSM 14484]
 gi|289182855|gb|ADC90099.1| D-3-phosphoglycerate dehydrogenase [Thermocrinis albus DSM 14484]
          Length = 530

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 77/210 (36%), Positives = 114/210 (54%), Gaps = 5/210 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++T+N++ K  L   K G  +INCARGG+V E  L   L++G ++  G DVF V
Sbjct: 202 IHAPLTHETRNMITKRELEMMKDGAVLINCARGGIVKEEDLLWALETGKLSGVGLDVFSV 261

Query: 61  EPALQ---NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP        L   PNV  +P++GA+T ESQE VA+ +A Q+   L    V   +N    
Sbjct: 262 EPPSHEFIKKLSAFPNVSLSPHIGANTYESQENVAVIVAQQVIKALRGQTVEYVVNAPFP 321

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR- 176
                 L+KP + LA+ +G F+ Q   E IQE+ I   G  A  +   + SAVL GI+R 
Sbjct: 322 DLSVLTLIKPHLDLAEKMGKFLVQWAGEGIQEVHIEVRGDIA-PHFHPIASAVLMGILRE 380

Query: 177 VWRVGANIISAPIIIKENAIILSTIKRDKS 206
           V     NII+A  + ++  I +  +  ++S
Sbjct: 381 VVDFPINIINASYVARDRGIKVEELTSEES 410


>gi|224105607|ref|XP_002313870.1| predicted protein [Populus trichocarpa]
 gi|222850278|gb|EEE87825.1| predicted protein [Populus trichocarpa]
          Length = 543

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  ILN E   K K GV I+N ARGG++DE+AL   L +G VA+A  DVF V
Sbjct: 200 LHMPLTPATAKILNDETFVKMKKGVRIVNVARGGVIDEDALVRALDAGIVAQAALDVFTV 259

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  Q+  L     V   P+LGAST+E+QE VAI++A  +   L   + S A+N  ++  
Sbjct: 260 EPPPQDSKLVQHERVTVTPHLGASTMEAQEGVAIEIAEAVVGALKGELASTAVNAPMVPA 319

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +KPF+ LA+ LG    QL+S    ++++++ Y  + A   ++T VL + +  G++
Sbjct: 320 EVLTELKPFVELAEKLGRLAVQLVSGGSGVKDVKVTYASARAPDDLDTRVLRAMITKGLI 379

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + +S
Sbjct: 380 EPISSVFVNLVNADFSAKQRGLRIS 404


>gi|225619505|ref|YP_002720762.1| D-3-phosphoglycerate dehydrogenase [Brachyspira hyodysenteriae WA1]
 gi|225214324|gb|ACN83058.1| D-3-phosphoglycerate dehydrogenase [Brachyspira hyodysenteriae WA1]
          Length = 534

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 118/207 (57%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T NI+NK+NL K K+   IINC+RGGLV+E  L   L++G +A A  DVF  
Sbjct: 199 LHIPKTPETNNIINKDNLCKMKNTAIIINCSRGGLVNEEDLKNALENGTIAAAAVDVFVN 258

Query: 61  EPALQN-PL--FGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP ++  PL  +   N+   P+LGAST E+Q  VA+ +A Q+   L  G   +A+N+  +
Sbjct: 259 EPKIETCPLVEYKKDNLILTPHLGASTKEAQINVALDVAKQIKQVLSGGYTESAVNIPSL 318

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + E+   VK +M ++++ G  I Q  +  I+ ++I   G    ++   L  A+L G +  
Sbjct: 319 NPEKLEPVKDYMKISENAGEMIMQTANGKIKSLEITAQGDLINLDIQPLEVAILKGALSY 378

Query: 178 WRVGANIISAPIIIKENAIILSTIKRD 204
                N ++AP + K+  I + TIK +
Sbjct: 379 MFQDVNYVNAPYLAKQRGIEVKTIKSE 405


>gi|330684332|gb|EGG96064.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU121]
          Length = 531

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 67/177 (37%), Positives = 106/177 (59%), Gaps = 1/177 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KTK I+ +   +  K  + IIN ARGG++DE+AL + L    ++ A  DVFE 
Sbjct: 202 VHTPLTPKTKGIVGENFFNLAKPNLQIINVARGGIIDEDALIKALDQSQISRAAIDVFEH 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP L +PL     +   P+LGASTVE+QEKVA+ +++++ D L  G V +A+N   +   
Sbjct: 262 EPPLDSPLIKHDKIIVTPHLGASTVEAQEKVAVSVSNEIIDILTKGTVEHAVNAPKMDMN 321

Query: 121 EAPL-VKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR 176
           E    VK +++LA  +G F  QL+  +  E+ I Y G  A ++T +++  V+  I++
Sbjct: 322 EVDQNVKDYLSLATTIGEFGIQLLEGAPSEVTITYGGDVAKIDTSLISRTVVTHILK 378


>gi|302872524|ref|YP_003841160.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575383|gb|ADL43174.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 531

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 116/215 (53%), Gaps = 8/215 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N+++++   K K GV I+NCARGG+++EN L   ++ G VA A  DV E 
Sbjct: 199 IHTPKTKETYNLISEKEFKKMKKGVRIVNCARGGVINENDLYNAIKEGIVAAAALDVLEK 258

Query: 61  EPALQ-------NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP  +       NPL  L NV   P+LGAST E+Q  VA+ +A +++  L  G+  NA+N
Sbjct: 259 EPNFELEKQDYYNPLLELDNVVITPHLGASTQEAQVNVAVSVAREVAAVLKGGIAKNAVN 318

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +     E    + P++ LA+ +G    Q       +I+I+Y G      T  L  A+L G
Sbjct: 319 LPAFEKERLEEIMPYLELAEAMGKIFIQAERTFANKIEIVYSGQIDEKTTTWLTRALLKG 378

Query: 174 IVRVW-RVGANIISAPIIIKENAIILSTIKRDKSG 207
            +    +   N +++ ++ KE  I +   K+++SG
Sbjct: 379 YLEFSVQDTVNYVNSQLLAKEQGIEVIESKKEESG 413


>gi|302780109|ref|XP_002971829.1| hypothetical protein SELMODRAFT_412481 [Selaginella moellendorffii]
 gi|300160128|gb|EFJ26746.1| hypothetical protein SELMODRAFT_412481 [Selaginella moellendorffii]
          Length = 625

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 125/213 (58%), Gaps = 6/213 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT+ T+ I N E  +K K GV IIN ARGG++DE AL + L +G VA+A  DVFE 
Sbjct: 278 LHMPLTDDTRGIFNDETFAKVKKGVRIINVARGGVIDEAALIKALDNGTVAQAALDVFEQ 337

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  N +    NV   P+LGASTVE+QE VA+++A  +   L   + + A+N  ++S 
Sbjct: 338 EPPAKDNKVVQHENVIVTPHLGASTVEAQEGVAVEIAEAVVGALRGELSATAVNAPMVSS 397

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           +    + P+++LA+ LG    QL++    ++++ I Y  + +   ++T +L + ++ G+V
Sbjct: 398 KVLTELAPYVSLAEKLGKLAVQLVAGGGGVKDVTISYTSARSPDDLDTRLLRAMIVKGLV 457

Query: 176 R-VWRVGANIISAPIIIKENAIILSTIKRDKSG 207
             V     N+++A  + K+  I +S  +    G
Sbjct: 458 EPVSNAFINLVNADYVAKQRGIRISEERHPAEG 490


>gi|288919125|ref|ZP_06413464.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EUN1f]
 gi|288349469|gb|EFC83707.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EUN1f]
          Length = 529

 Score =  124 bits (311), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 110/200 (55%), Gaps = 8/200 (4%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L++ K GV I+N ARGGLVDE ALAE + SG V  AG DV+  
Sbjct: 199 IHLPKTPETLGLIGAEQLARVKPGVIIVNAARGGLVDEAALAEAVSSGRVGGAGLDVYVK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM---AII 117
           EP   +PLFGL NV   P+LGAST E+Q+K  + +A  +   L    V +A+N+    ++
Sbjct: 259 EPTTSSPLFGLENVVVTPHLGASTQEAQDKAGLAVAKSVRLALSGEFVPDAVNVQAGGVV 318

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VR 176
           + +    V+P + LA+ LG     L       I +   G  AV +  VL  AVL G+   
Sbjct: 319 AED----VRPGLPLAEKLGQLFSGLAGGVAAAITVEVRGEVAVHDVSVLQLAVLKGVFTD 374

Query: 177 VWRVGANIISAPIIIKENAI 196
           +       ++AP+I KE  +
Sbjct: 375 IVEEQVTYVNAPLIAKERGV 394


>gi|288559935|ref|YP_003423421.1| phosphoglycerate dehydrogenase SerA [Methanobrevibacter ruminantium
           M1]
 gi|288542645|gb|ADC46529.1| phosphoglycerate dehydrogenase SerA [Methanobrevibacter ruminantium
           M1]
          Length = 524

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 111/208 (53%), Gaps = 2/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT +T++ ++ E     K    I NCARGG++DE+AL E L +G +  AG DV+E 
Sbjct: 199 IHVPLTPETEHSISTEQFKMMKDTALIFNCARGGVIDEDALYEALVNGEILGAGLDVYEK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N LF L N+ C P++ AST E+Q   AI +A+++      G+  N +NM  ++  
Sbjct: 259 EPATNNKLFELDNIVCTPHIAASTKEAQRDAAIIVANEVITLFKGGMPKNIINMPRMNNS 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVL-NSAVLAGIVR-VW 178
           E      ++ L + LG FI Q  S  I +++I Y G    + +  L    +L GI+  V 
Sbjct: 319 EFEETNDYLELCEKLGSFITQATSSPINKLEITYKGEINKLPSKDLFTRTILQGILNPVT 378

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKS 206
               N ++A  + K   I ++    D S
Sbjct: 379 ETAVNAVNATTVAKARGISITEAVSDDS 406


>gi|289432486|ref|YP_003462359.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. GT]
 gi|288946206|gb|ADC73903.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. GT]
          Length = 526

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 106/197 (53%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T +TK ++  + L   K  V +IN +RGG++DE ALA+ ++  H+  A  DVF  
Sbjct: 199 LHVPMTGQTKGLIGPKELEMMKPTVRLINTSRGGIIDEEALAKAVKEKHIGGAAIDVFSK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ LF   N+   P+LGAST E+QE     +  Q+ D         A+N   IS E
Sbjct: 259 EPCTESCLFECDNIIVTPHLGASTAEAQELATSDVVKQVIDVFEGRPARYAVNAPYISAE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
             P+V PFM +A  +G  + QL    ++ + I Y G  A  +T  L + VL GI+  +  
Sbjct: 319 SLPVVGPFMPVARTVGSLVSQLTDGHMKNVTIKYCGELAAYDTTALKALVLGGILEHISE 378

Query: 180 VGANIISAPIIIKENAI 196
              N+++A I+  +  +
Sbjct: 379 ERVNVVNADIVASQRGL 395


>gi|118471239|ref|YP_886720.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium smegmatis str.
           MC2 155]
 gi|118172526|gb|ABK73422.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium smegmatis str.
           MC2 155]
          Length = 528

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 97/174 (55%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +L KE L+KTK GV I+N ARGGL+DE ALA+ + SGHV  AG DV+  
Sbjct: 201 VHLPKTKETAGLLGKEALAKTKKGVIIVNAARGGLIDEQALADAITSGHVRGAGLDVYAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V +A+N+      
Sbjct: 261 EPCTDSPLFDLPQVVVTPHLGASTAEAQDRAGTDVAASVKLALAGEFVPDAVNVGGGVVG 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V P++ L   LG  +G L       +Q+   G  A  +  +L  + L G+
Sbjct: 321 EE--VAPWLELVRKLGLLVGALADAPPVSLQVQVRGELASEDVEILKLSALRGL 372


>gi|72161018|ref|YP_288675.1| D-3-phosphoglycerate dehydrogenase [Thermobifida fusca YX]
 gi|71914750|gb|AAZ54652.1| D-3-phosphoglycerate dehydrogenase [Thermobifida fusca YX]
          Length = 528

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 109/207 (52%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T  T  ++ +E L K K  V IIN ARGG+VDE AL   L+ G VA AG DVF  
Sbjct: 201 IHLPKTKDTIGLIGEEELRKVKPTVRIINAARGGIVDETALYHALKEGRVAGAGLDVFAK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L NV  AP+LGAST E+QEK   Q+A  +   L    V +A+N+      
Sbjct: 261 EPCTDSPLFELENVVVAPHLGASTHEAQEKAGTQVARSVKLALAGEFVPDAVNIQGKGVA 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVWR 179
           E   +KP + L + LG  +  L   +I  +++   G     +  V+  A L G+   +  
Sbjct: 321 ED--IKPGLPLTEKLGRILAALADGAITRVEVEVRGEIVAHDVKVIELAALKGLFTDIVE 378

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
                ++AP++ KE  I +S    ++S
Sbjct: 379 EAVTYVNAPLVAKERGIEVSLTTEEES 405


>gi|145224813|ref|YP_001135491.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium gilvum PYR-GCK]
 gi|315445143|ref|YP_004078022.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. Spyr1]
 gi|145217299|gb|ABP46703.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium gilvum PYR-GCK]
 gi|315263446|gb|ADU00188.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. Spyr1]
          Length = 528

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 98/174 (56%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L+KTK GV I+N ARGGL+DE ALA+ + SGHV  AG DVF  
Sbjct: 201 VHLPKTKETAGLIGTEALAKTKPGVIIVNAARGGLIDEQALADAITSGHVRGAGLDVFST 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGASTVE+Q++    +A  +   L    V +A+N+   +  
Sbjct: 261 EPCTDSPLFELPQVVVTPHLGASTVEAQDRAGTDVAASVKLALAGEFVPDAVNVGGGAVG 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V P++ L   LG  +G L +E    + +   G  A     VL  + L G+
Sbjct: 321 EE--VAPWLDLVRKLGLLVGALSAELPTNLCVQVRGELASEEVEVLRLSALRGL 372


>gi|168002445|ref|XP_001753924.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162694900|gb|EDQ81246.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 523

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 124/213 (58%), Gaps = 6/213 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  I N E+  K K GV I+N ARGG++DE AL   L +G VA+A  DVF V
Sbjct: 180 LHMPLTPTTDKIFNDESFGKCKKGVRIVNVARGGVIDEPALVRALDAGIVAQAALDVFTV 239

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  + + L    NV   P+LGAST+E+QE VA+++A  ++  L   + + A+N  ++  
Sbjct: 240 EPPKEGDALVNHENVIVTPHLGASTMEAQEGVAVEIAEAVAGALAGELSATAVNAPMVPA 299

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTA--VMNTMVLNSAVLAGIV 175
           E    + P++TLA+ LG    QL+S    +++++++Y  + A   ++T +L + +  G++
Sbjct: 300 EVITELAPYVTLAERLGRLAVQLVSGGAGVKQVKVVYRSARADDDLDTRLLRAMITKGLI 359

Query: 176 R-VWRVGANIISAPIIIKENAIILSTIKRDKSG 207
             V     N+++A  + K+  + +S  ++   G
Sbjct: 360 EPVSSAFINLVNADYVAKQRGLKISEERQPTDG 392


>gi|219850460|ref|YP_002464893.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aggregans DSM
           9485]
 gi|219544719|gb|ACL26457.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aggregans DSM
           9485]
          Length = 525

 Score =  124 bits (310), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 69/203 (33%), Positives = 112/203 (55%), Gaps = 6/203 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPL   T+N+ ++E + + K G  +IN +RGG+VDE AL E L SGH+A A  DV+  
Sbjct: 199 LHVPLIESTRNLFDRERIMQMKRGSYLINASRGGIVDEVALVEALDSGHLAGAALDVYAQ 258

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E P   +PL G P V   P++GAST E+Q     ++A  +   L  G    A+N   ++ 
Sbjct: 259 EPPPADSPLIGHPKVITVPHIGASTKEAQLSAGTEMAAGVVTALTGGTPRYAVNAPFVAP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV---R 176
           E   +++P++ L   LG  +  L+ E ++   +   G  A M+T  +  AVL G++    
Sbjct: 319 EAWNVLQPYLNLGRLLGTLVMHLVKEPVRSYDLELGGELAEMDTQPVRLAVLQGLLAASS 378

Query: 177 VWRVGANIISAPIIIKENAIILS 199
           + R+    ++APII +E  + ++
Sbjct: 379 IERI--TPVNAPIIARERGLRMT 399


>gi|37521708|ref|NP_925085.1| D-3-phosphoglycerate dehydrogenase [Gloeobacter violaceus PCC 7421]
 gi|35212706|dbj|BAC90080.1| D-3-phosphoglycerate dehydrogenase [Gloeobacter violaceus PCC 7421]
          Length = 526

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 112/204 (54%), Gaps = 2/204 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T +T +++N++ L+  K    IINCARGGL+DE AL   L+ G +A A  DVFE 
Sbjct: 199 LHVPRTPETTHLINEKTLASMKPTARIINCARGGLIDEQALYVALKEGRIAGAALDVFEN 258

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++PL  L   V   P+LGAST E+Q  VAI +A Q+ D L+      A+N+  +  
Sbjct: 259 EPLGESPLCALGREVILTPHLGASTEEAQTNVAIDVAEQIRDVLLGLPARTAVNIPGLRA 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
           E    +KP++ LAD LG  +GQL    +  + I   G  A  +   +  A L G++    
Sbjct: 319 EVLQELKPYLELADTLGNLVGQLAGGRVDALDIRLQGILAAKDAQPIVVAALKGLLTPAL 378

Query: 179 RVGANIISAPIIIKENAIILSTIK 202
           R   N ++A +  KE  I ++  +
Sbjct: 379 RERVNFVNALLEAKERGIRVTETR 402


>gi|312792696|ref|YP_004025619.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312179836|gb|ADQ40006.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 531

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 117/215 (54%), Gaps = 8/215 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N+++++   K K GV I+NCARGG+++EN L   ++ G VA A  DV E 
Sbjct: 199 IHTPKTKETYNLISEKEFKKMKKGVRIVNCARGGVINENDLYNAIKEGIVAAAALDVLEK 258

Query: 61  EPALQ-------NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP  +       NPL  L NV   P+LGAST E+Q  VA+ +A +++  L  G+  NA+N
Sbjct: 259 EPNFELEKQDYYNPLLELDNVVITPHLGASTQEAQVNVAVSVAKEVAAVLKGGIAKNAVN 318

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +     E+   + P++ LA+ +G    Q       +I+I+Y G      T  L  A+L G
Sbjct: 319 LPAFEKEKLEEIMPYLELAEAMGKIFIQAERTFANKIEIVYSGQIDEKATTWLTRALLKG 378

Query: 174 IVRVW-RVGANIISAPIIIKENAIILSTIKRDKSG 207
            +    +   N +++ ++ KE  I +   K+++SG
Sbjct: 379 YLEFSVQDTVNYVNSQLLAKEQGIEVIESKKEESG 413


>gi|312878276|ref|ZP_07738197.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311794944|gb|EFR11352.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 531

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 117/215 (54%), Gaps = 8/215 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N+++++   K K GV I+NCARGG+++EN L   ++ G VA A  DV E 
Sbjct: 199 IHTPKTKETYNLISEKEFKKMKKGVRIVNCARGGVINENDLYNAIKEGIVAAAALDVLEK 258

Query: 61  EPALQ-------NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP  +       NPL  L NV   P+LGAST E+Q  VA+ +A +++  L  G+  NA+N
Sbjct: 259 EPNFELEKQDFYNPLLELDNVVITPHLGASTQEAQVNVAVSVAKEVAAVLKGGIAKNAVN 318

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +     E+   + P++ LA+ +G    Q       +I+I+Y G      T  L  A+L G
Sbjct: 319 LPAFEKEKLEEIMPYLELAEAMGKIFIQAERAFANKIEIVYSGQIDDKATTWLTRALLKG 378

Query: 174 IVRVW-RVGANIISAPIIIKENAIILSTIKRDKSG 207
            +    +   N +++ ++ KE  I +   K+++SG
Sbjct: 379 YLEFSVQDTVNYVNSQLLAKEQGIEVIESKKEESG 413


>gi|118443172|ref|YP_879194.1| D-3-phosphoglycerate dehydrogenase [Clostridium novyi NT]
 gi|118133628|gb|ABK60672.1| D-3-phosphoglycerate dehydrogenase [Clostridium novyi NT]
          Length = 530

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 112/197 (56%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  I+    +   K GV ++N ARG L+DE+AL   L+SG +   G DV  V
Sbjct: 202 IHTPRTKETIGIIGDREIELMKDGVRLVNAARGKLMDEDALYRGLKSGKIKSVGLDVHAV 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PL+  PNV   P++GA+T E+Q+ V + +A Q+ + +   +V NA+N+  I+  
Sbjct: 262 EPRHESPLYEFPNVTVTPHIGATTFEAQQNVGLTIAQQVINGIKGEIVPNAVNLPGINRL 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   +KP++ L + LG    QL SE ++ + + Y G+    +   L  A L G+++ V  
Sbjct: 322 ELKDLKPYIELVEKLGKLYYQLNSEPVKYVDVTYWGNVTKFDVDALEIAFLKGLLQPVSN 381

Query: 180 VGANIISAPIIIKENAI 196
              N I+A I+ ++N I
Sbjct: 382 DRVNYINARIVAEQNGI 398


>gi|302524967|ref|ZP_07277309.1| phosphoglycerate dehydrogenase [Streptomyces sp. AA4]
 gi|302433862|gb|EFL05678.1| phosphoglycerate dehydrogenase [Streptomyces sp. AA4]
          Length = 532

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 102/174 (58%), Gaps = 1/174 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK +++ E L KTK GV I+N ARGGL+ E ALA+ ++SGHV  AG DVF  
Sbjct: 204 IHLPKTPETKGLIDAEALKKTKPGVIIVNAARGGLIVEEALADAVRSGHVGGAGIDVFVT 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PLF LPNV   P+LGAST E+Q++    +A  +   L    V +A+N++     
Sbjct: 264 EPTTESPLFNLPNVVVTPHLGASTAEAQDRAGTDVARSVLLALRGDFVPDAVNVS-GGGA 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
               V+P+++L   LG  +  L  ++   + +   G  +  +T VL  A L G+
Sbjct: 323 VGEHVRPYLSLTQKLGQVLTALNPKAPTSLTVEVKGEISSEDTAVLKLAALRGL 376


>gi|167044704|gb|ABZ09375.1| putative D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding
           domain protein [uncultured marine microorganism
           HF4000_APKG7H23]
          Length = 491

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 106/197 (53%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT  T+ +L      + K GV IIN ARGGLV+E  L E L+SG VA A  DVF  
Sbjct: 165 IHTPLTATTQQLLGPAQFQQLKHGVRIINAARGGLVNEQLLLEALESGRVAGAALDVFVE 224

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  Q+PL   P V   P+LGAST E+Q +VA+++A Q+   L        +N+  I  E
Sbjct: 225 EPPKQSPLLQHPRVVLTPHLGASTEEAQTEVALEIADQVLAVLAGSSAQYTVNVPYIPEE 284

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
               + PF+ +A  LG    QL     + + + Y G  A  +T +L +A L GI+  +  
Sbjct: 285 VREALAPFIPVATFLGKVAIQLAEGQFESLTLSYSGEIAHYDTSLLKAAALVGILGHISS 344

Query: 180 VGANIISAPIIIKENAI 196
              N+++AP+  ++  +
Sbjct: 345 ERVNLVNAPVFAQQRGV 361


>gi|309791398|ref|ZP_07685905.1| D-3-phosphoglycerate dehydrogenase [Oscillochloris trichoides DG6]
 gi|308226531|gb|EFO80252.1| D-3-phosphoglycerate dehydrogenase [Oscillochloris trichoides DG6]
          Length = 525

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 117/203 (57%), Gaps = 6/203 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT+ T+N+ +   +++ K G  +IN +RGG+VDE ALAE + +G +  A  DVF  
Sbjct: 199 IHVPLTDGTRNLFSAARIAQMKPGSFLINASRGGIVDEAALAEAINAGRMGGAALDVFNS 258

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  +P+ G P +   P++GAST E+Q     ++A  ++  L       A+N   ++ 
Sbjct: 259 EPPAADSPVLGNPKIITVPHIGASTAEAQTSAGTEVAEGVATALTGATPRYAVNAPFVAP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV-- 177
           E   +++P+++LA ++G  I Q+I E ++  ++ Y G  A ++T  +  AVL G++    
Sbjct: 319 ESWAVLQPYLSLARNMGSLIMQMIQEPVRSYELEYCGELADVDTQPVRLAVLEGLLSANS 378

Query: 178 -WRVGANIISAPIIIKENAIILS 199
             RV    ++AP+I +   + +S
Sbjct: 379 SERV--TPVNAPVIARNRGMRIS 399


>gi|119356910|ref|YP_911554.1| D-3-phosphoglycerate dehydrogenase [Chlorobium phaeobacteroides DSM
           266]
 gi|119354259|gb|ABL65130.1| D-3-phosphoglycerate dehydrogenase [Chlorobium phaeobacteroides DSM
           266]
          Length = 526

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/200 (34%), Positives = 109/200 (54%), Gaps = 2/200 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H  L   T+N++  +  +  K GV I+NCARGG+++E  LAE + SG V  A  DVFE 
Sbjct: 199 IHSSLNESTRNLIANDTFALMKQGVIIVNCARGGIINEADLAEAIASGKVGAAALDVFET 258

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  Q NPL  L  V   P++ AST E+Q KVA+Q+A Q+ ++   G +  A+N + +  
Sbjct: 259 EPVQQDNPLLKLERVVATPHIAASTNEAQVKVAVQIAEQIVEWKQKGKLEGAVNASAVEL 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
            + P V+ ++ LA+ LG  + QL +    +I +   G      + V+ +A L G + + +
Sbjct: 319 AQTPGVRSYLALAEKLGATLAQLTAIQANKIVVTTSGEFLQKFSEVITAAALKGFLDIRQ 378

Query: 180 V-GANIISAPIIIKENAIIL 198
               N I+   + KE  I L
Sbjct: 379 TKDTNYINVFTMAKETGITL 398


>gi|154174389|ref|YP_001407860.1| D-3-phosphoglycerate dehydrogenase [Campylobacter curvus 525.92]
 gi|112803368|gb|EAU00712.1| phosphoglycerate dehydrogenase [Campylobacter curvus 525.92]
          Length = 525

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 111/207 (53%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N++ ++ ++K K GV +INCARGGL +E AL E L+SG VA AG DVF  
Sbjct: 202 IHTPKTKETTNMIGRDEIAKMKDGVRLINCARGGLYNEEALEEALKSGKVAFAGIDVFTK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL  L NV   P+LGA+T+ESQ  +A++   Q           NALN+ I + +
Sbjct: 262 EPATSHPLLELDNVSVTPHLGANTLESQRNIAVEAVEQAISAARAISYPNALNLPIKTED 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P ++P++ L   +     Q+  ++I+ I+I  +G        +L  A++  +      
Sbjct: 322 LPPFIEPYVDLVSKMAFLGAQINKKAIKAIRIEAEGQIGEFANSMLTFALVGVLKESLGD 381

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N ++A  I  E  I    I   +SG
Sbjct: 382 AINYVNAKFICDEKGIANEAIIVPQSG 408


>gi|168028593|ref|XP_001766812.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682021|gb|EDQ68443.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 565

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 124/213 (58%), Gaps = 6/213 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  I N E+  K K GV IIN ARGG++DE AL   L +G VA+A  DVF V
Sbjct: 223 LHMPLTPTTDKIFNDESFGKCKKGVRIINVARGGVIDEPALVRALDAGIVAQAALDVFTV 282

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  + + L    NV   P+LGAST+E+QE VA+++A  ++  L   + + A+N  ++  
Sbjct: 283 EPPPEGDALVNHENVIVTPHLGASTMEAQEGVAVEIAEAVAGALAGELSATAVNAPMVPA 342

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTA--VMNTMVLNSAVLAGIV 175
           E    + P+++LA+ LG    QL+S    +++++++Y  + A   ++T +L + +  G++
Sbjct: 343 EVITELAPYVSLAERLGRLAVQLVSGGAGVKQVKVVYRSARADDDLDTRLLRAMITKGLI 402

Query: 176 R-VWRVGANIISAPIIIKENAIILSTIKRDKSG 207
             V     N+++A  + K+  + +S  ++   G
Sbjct: 403 EPVSSAFINLVNADYVAKQRGLKISEERQPTDG 435


>gi|148642517|ref|YP_001273030.1| D-3-phosphoglycerate dehydrogenase [Methanobrevibacter smithii ATCC
           35061]
 gi|148551534|gb|ABQ86662.1| D-3-phosphoglycerate dehydrogenase, SerA [Methanobrevibacter
           smithii ATCC 35061]
          Length = 524

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 115/209 (55%), Gaps = 3/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT +TK++++ +     K    I NCARGG++DE+AL E L +  +  A  DV+E 
Sbjct: 198 IHVPLTPETKHLISTKEFEIMKDTAFIANCARGGIIDEDALYEALSNDKIGGAALDVYEE 257

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  LF L N+   P++ AST E+Q   AI +A ++ D +  G   N LN+  I  
Sbjct: 258 EPPAKDCKLFELDNIVLTPHIAASTKEAQRDAAIIVADEIIDLINGGTPQNVLNLPRIDR 317

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGS-TAVMNTMVLNSAVLAGIVRVW 178
                V P++ L + LG FI Q ++  I+EI++IY G  + + N  +L   VL G V  +
Sbjct: 318 NTYQEVTPYLELCEKLGSFISQAVNGKIKEIEVIYSGELSKIDNLEMLTRTVLQGAVNPF 377

Query: 179 RVG-ANIISAPIIIKENAIILSTIKRDKS 206
                  ++A I+ K   II++  K + S
Sbjct: 378 LSSPVTAVNASIVAKNRGIIVTEGKTENS 406


>gi|222445984|ref|ZP_03608499.1| hypothetical protein METSMIALI_01632 [Methanobrevibacter smithii
           DSM 2375]
 gi|261349477|ref|ZP_05974894.1| phosphoglycerate dehydrogenase [Methanobrevibacter smithii DSM
           2374]
 gi|222435549|gb|EEE42714.1| hypothetical protein METSMIALI_01632 [Methanobrevibacter smithii
           DSM 2375]
 gi|288861840|gb|EFC94138.1| phosphoglycerate dehydrogenase [Methanobrevibacter smithii DSM
           2374]
          Length = 524

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 115/209 (55%), Gaps = 3/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT +TK++++ +     K    I NCARGG++DE+AL E L +  +  A  DV+E 
Sbjct: 198 IHVPLTPETKHLISTKEFEIMKDTAFIANCARGGIIDEDALYEALSNDKIGGAALDVYEE 257

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  LF L N+   P++ AST E+Q   AI +A ++ D +  G   N LN+  I  
Sbjct: 258 EPPAKDCKLFELDNIVLTPHIAASTKEAQRDAAIIVADEIIDLINGGTPQNVLNLPRIDR 317

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGS-TAVMNTMVLNSAVLAGIVRVW 178
                V P++ L + LG FI Q ++  I+EI++IY G  + + N  +L   VL G V  +
Sbjct: 318 NTYQEVTPYLELCEKLGSFISQAVNGKIKEIEVIYSGELSKIDNLEMLTRTVLQGAVNPF 377

Query: 179 RVG-ANIISAPIIIKENAIILSTIKRDKS 206
                  ++A I+ K   II++  K + S
Sbjct: 378 LSSPVTAVNASIVAKNRGIIVTEGKTENS 406


>gi|213964733|ref|ZP_03392933.1| phosphoglycerate dehydrogenase [Corynebacterium amycolatum SK46]
 gi|213952926|gb|EEB64308.1| phosphoglycerate dehydrogenase [Corynebacterium amycolatum SK46]
          Length = 531

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 110/200 (55%), Gaps = 3/200 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + + E L K K G  IIN ARGGLVDE ALA+ +++G++  AGFDV+  
Sbjct: 204 IHLPKTRETAGMFDAELLGKAKKGQIIINAARGGLVDEQALADAIKAGNIRGAGFDVYAT 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLFGLP   CAP+LGASTVE+Q++    +A  +   L    V +A+N++  +  
Sbjct: 264 EPCTDSPLFGLPETVCAPHLGASTVEAQDRAGTDVAKSVLLALAGEFVPDAVNVSGGAVG 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW-R 179
           E   V  ++ LA  LG   G L+  +   +++   G     +  VL  A + G+  +   
Sbjct: 324 EE--VALWLELARELGLVAGGLLEGAPAAVEVTARGELHTEDVNVLGMAAIRGLFSLMVE 381

Query: 180 VGANIISAPIIIKENAIILS 199
                ++AP I +E  +  +
Sbjct: 382 EPVTFVNAPRIAEERGVTFT 401


>gi|110598440|ref|ZP_01386712.1| D-3-phosphoglycerate dehydrogenase [Chlorobium ferrooxidans DSM
           13031]
 gi|110339974|gb|EAT58477.1| D-3-phosphoglycerate dehydrogenase [Chlorobium ferrooxidans DSM
           13031]
          Length = 526

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 109/200 (54%), Gaps = 2/200 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H  L   T+N++++      K GV I+NCARGG+++E  LAE ++SG V  A  DVFE 
Sbjct: 199 IHSSLNESTRNLISEGTFELMKQGVIIVNCARGGIINEADLAEAIESGKVRAAALDVFET 258

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    NPL  L  V   P++ AST E+QEKVA+Q+A Q+ ++   G +  A+N + +  
Sbjct: 259 EPVKADNPLLKLERVIVTPHIAASTNEAQEKVAVQIAEQIVEWKRRGKLEGAVNASAVEL 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
            +AP V  ++ LA+ LG  + QL      ++ +   G        V+ +A L G + V +
Sbjct: 319 AQAPGVSAYLALAEKLGATLAQLAPSQANKMTVFTSGEFLHKFNEVITAAALKGFLDVRQ 378

Query: 180 V-GANIISAPIIIKENAIIL 198
               N I+A  + KE  I L
Sbjct: 379 SKDTNYINAFTMAKECGIGL 398


>gi|226305887|ref|YP_002765847.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus erythropolis PR4]
 gi|229493419|ref|ZP_04387208.1| phosphoglycerate dehydrogenase [Rhodococcus erythropolis SK121]
 gi|226185004|dbj|BAH33108.1| D-3-phosphoglycerate dehydrogenase [Rhodococcus erythropolis PR4]
 gi|229319735|gb|EEN85567.1| phosphoglycerate dehydrogenase [Rhodococcus erythropolis SK121]
          Length = 530

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 111/207 (53%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++N E L+K K GV I+N ARGGL+DE+AL + L SG V  AG DVF  
Sbjct: 204 VHLPKTKETAGLINAERLAKAKDGVIIVNAARGGLIDEDALYDALVSGKVRGAGLDVFST 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   + LF L NV   P+LGAST E+Q++  I +A  +   L    V  A+N++     
Sbjct: 264 EPCTDSKLFELDNVVVTPHLGASTSEAQDRAGIDVAKSVLLALAGEFVPEAVNVSGGPVG 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   V P++ L   LG     L  E++Q +Q++  G  +     +L  A L G+      
Sbjct: 324 EE--VAPWLELVRKLGLLAATLSPEAVQTVQVVATGELSAETVDILGLAALRGVFSASSD 381

Query: 181 GA-NIISAPIIIKENAIILSTIKRDKS 206
            A   ++AP + ++  + +S  K  ++
Sbjct: 382 EAVTFVNAPALAEQRGVTVSVEKHSEA 408


>gi|298491116|ref|YP_003721293.1| D-3-phosphoglycerate dehydrogenase ['Nostoc azollae' 0708]
 gi|298233034|gb|ADI64170.1| D-3-phosphoglycerate dehydrogenase ['Nostoc azollae' 0708]
          Length = 526

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/198 (35%), Positives = 113/198 (57%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T N++N + L+K K    IINCARGG++DE+ALA  ++ G +  A  DVF+ 
Sbjct: 199 LHIPKTPETTNLINAKTLAKMKPTARIINCARGGIIDESALAAAIKEGKIGGAALDVFDS 258

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++ L  L  ++   P+LGAST E+Q  VAI +A Q+ D ++     +A+N+  +  
Sbjct: 259 EPLGESELRSLGKDIILTPHLGASTTEAQVNVAIDVAEQIRDVILGLPARSAVNIPGLGP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
           +    +KP+M LA+ LG  +GQL    ++ + +   G  A   +  L  A L G++ +  
Sbjct: 319 DILEELKPYMQLAETLGNLVGQLAGGRVETLTVKLQGELATNKSQPLVVAALKGLLYQAL 378

Query: 179 RVGANIISAPIIIKENAI 196
           R   N ++A I  KE  I
Sbjct: 379 RERVNYVNASIEAKERGI 396


>gi|118463523|ref|YP_883011.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium avium 104]
 gi|254776268|ref|ZP_05217784.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium avium subsp.
           avium ATCC 25291]
 gi|118164810|gb|ABK65707.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium avium 104]
          Length = 528

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 107/197 (54%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++K+ L+KTK GV I+N ARGGLVDE ALA+ ++SGHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLIDKDALAKTKPGVIIVNAARGGLVDEAALADAVRSGHVRAAGLDVFSK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V +A+N+A  +  
Sbjct: 261 EPCTDSPLFELPQVVVTPHLGASTTEAQDRAGTDVAASVKLALAGEFVPDAVNVAGGTVN 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
           E   V P++ L   LG     L       + +   G  A  +  VL  + L G+      
Sbjct: 321 EE--VAPWLDLVRKLGLLAATLSDGPPVSLSVQVRGELASEDVEVLKLSALRGLFSAVVE 378

Query: 181 GA-NIISAPIIIKENAI 196
           G    ++AP + +E  +
Sbjct: 379 GPVTFVNAPALAEERGV 395


>gi|224417936|ref|ZP_03655942.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|253827274|ref|ZP_04870159.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|313141477|ref|ZP_07803670.1| d-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|253510680|gb|EES89339.1| D-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
 gi|313130508|gb|EFR48125.1| d-3-phosphoglycerate dehydrogenase [Helicobacter canadensis MIT
           98-5491]
          Length = 527

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 114/198 (57%), Gaps = 4/198 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T NI++KE ++K K+GV +INCARGGL +E+AL E L+SG V  AG DVF  
Sbjct: 204 IHTPKNKETINIIDKEQIAKMKNGVILINCARGGLYNEDALFEALESGKVRWAGIDVFTK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N L  LPN++  P++GA+T+ESQEK+AI+ A    +        NALN+ I   E
Sbjct: 264 EPATSNKLLDLPNIYVTPHIGANTLESQEKIAIEAAEAALESARGSSFPNALNLPIKETE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               +K ++ L   +  F  Q+    I+ I++   G  +   +  L++  L GI+    +
Sbjct: 324 LPDFMKAYLELVQKMAFFAIQVNKNEIRSIKLEAQGEVSEYLSS-LSTFALVGILNA-TI 381

Query: 181 G--ANIISAPIIIKENAI 196
           G   N ++AP + KE  +
Sbjct: 382 GDKVNYVNAPYVAKERGV 399


>gi|222530091|ref|YP_002573973.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor bescii DSM
           6725]
 gi|222456938|gb|ACM61200.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor bescii DSM
           6725]
          Length = 531

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 117/215 (54%), Gaps = 8/215 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N+++++   K K GV I+NCARGG+++EN L   ++ G VA A  DV E 
Sbjct: 199 IHTPKTKETYNLISEKEFKKMKKGVRIVNCARGGVINENDLYIAIKEGIVAAAALDVLEK 258

Query: 61  EPALQ-------NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP  +       NPL  L NV   P+LGAST E+Q  VA+ +A +++  L  G+  NA+N
Sbjct: 259 EPNFELEKQEYHNPLLELDNVVITPHLGASTQEAQVNVAVSVAKEVAAVLKGGIAKNAVN 318

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +     E+   + P++ LA+ +G    Q       +I+I+Y G      T  L  A+L G
Sbjct: 319 LPAFEKEKLEEIMPYLELAEAMGKIFIQAERAFANKIEIVYSGQIDEKATTWLTRALLKG 378

Query: 174 IVRVW-RVGANIISAPIIIKENAIILSTIKRDKSG 207
            +    +   N +++ ++ KE  I +   K+++SG
Sbjct: 379 YLEFSVQDNVNYVNSQLLAKEQGIEVIESKKEESG 413


>gi|87123644|ref|ZP_01079494.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9917]
 gi|86168213|gb|EAQ69470.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9917]
          Length = 528

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 120/211 (56%), Gaps = 7/211 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N E L   K    ++NCARGG+VDE A+AE + +G +A AG DVF  
Sbjct: 199 LHIPRTPDTENLVNAELLRSMKPTARLVNCARGGIVDEAAIAEAINTGVIAGAGLDVFAS 258

Query: 61  EP-ALQNPLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP A+++PL  +   +   P+LGAST E+QE VAI +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLAVESPLRAVERGLVLTPHLGASTEEAQENVAIDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
            E    +KP + LA+ LG  + QL    +QE+++   G  A   +  L  A L G++   
Sbjct: 319 AEIMERLKPHLQLAETLGLLVSQLSGGQVQELEVRLQGEFAEHPSQPLVVAALKGLLSSA 378

Query: 179 ---RVGANIISAPIIIKENAIILSTIKRDKS 206
              R+  N ++A +  K   I +  IK D S
Sbjct: 379 LGERI--NYVNAALEAKGRGIHVLEIKDDAS 407


>gi|224060560|ref|XP_002300235.1| predicted protein [Populus trichocarpa]
 gi|118485917|gb|ABK94804.1| unknown [Populus trichocarpa]
 gi|222847493|gb|EEE85040.1| predicted protein [Populus trichocarpa]
          Length = 597

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  ILN E  +K K GV I+N ARGG++DE+AL   L +G VA+A  DVF V
Sbjct: 254 LHMPLTPATAKILNDETFAKMKKGVRIVNVARGGVIDEDALVRALDAGIVAQAALDVFTV 313

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  Q+  L     V   P+LGAST E+QE VAI++A  +   L   + S ++N  ++  
Sbjct: 314 EPPPQDSKLVQHERVTVTPHLGASTKEAQEGVAIEIAEAVVGALKGELASTSVNAPMVPA 373

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +KP++ LA+ LG    QL+S    ++++++ Y  + A   ++T VL + +  G++
Sbjct: 374 EVLTELKPYVELAEKLGRLAVQLVSGGSGVKDVKVTYASARAPDDLDTRVLRAMITKGLI 433

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + +S
Sbjct: 434 EPISSVFVNLVNADFSAKQRGLRIS 458


>gi|25027935|ref|NP_737989.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium efficiens
           YS-314]
 gi|259506328|ref|ZP_05749230.1| phosphoglycerate dehydrogenase [Corynebacterium efficiens YS-314]
 gi|23493218|dbj|BAC18189.1| putative D-3-phosphoglycerate dehydrogenase [Corynebacterium
           efficiens YS-314]
 gi|259166108|gb|EEW50662.1| phosphoglycerate dehydrogenase [Corynebacterium efficiens YS-314]
          Length = 530

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 109/197 (55%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + + E L+K K G  IIN ARGGLVDE ALA+ ++SGH+  AGFDV+E 
Sbjct: 204 IHLPKTKETAGMFDAELLAKAKKGQIIINAARGGLVDEQALADAIESGHIRGAGFDVYET 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V++A+N++     
Sbjct: 264 EPCTDSPLFKLPQVVVTPHLGASTEEAQDRAGTDVADSVLKALAGEFVADAVNVSGGKVG 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V  +M LA  LG   G+L+  +   +++   G  +  +   L  + + G+   +  
Sbjct: 324 EE--VALWMELARKLGLLAGKLVDGAPVSLEVTARGELSSEDVSALGLSAVRGLFSGIIE 381

Query: 180 VGANIISAPIIIKENAI 196
                ++AP I +E  +
Sbjct: 382 EPVTFVNAPRIAEERGV 398


>gi|256372302|ref|YP_003110126.1| D-3-phosphoglycerate dehydrogenase [Acidimicrobium ferrooxidans DSM
           10331]
 gi|256008886|gb|ACU54453.1| D-3-phosphoglycerate dehydrogenase [Acidimicrobium ferrooxidans DSM
           10331]
          Length = 527

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 66/175 (37%), Positives = 106/175 (60%), Gaps = 2/175 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P + +T  ++    L+K K G+ I+N +RGG++DE ALAE +  GHVA A  DVF  
Sbjct: 200 IHLPKSKETVGLVGAALLAKAKPGIRIVNASRGGIIDEAALAEAIARGHVAGAALDVFAE 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +P+ GL  V   P+LGAST E+Q K  + +A Q+   L +  V  A+N  + + E
Sbjct: 260 EPPTNSPIVGLDQVVLTPHLGASTAEAQSKAGVTIAEQVLLALANEFVPFAVN--VNAGE 317

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            + LV+ F+ LA+ LG  +G +  +  ++++I Y+G  A  +T + + AVL GI+
Sbjct: 318 ASELVRSFLPLAEALGVLLGAIEGKLPEQLEIAYEGELASEDTRLASLAVLRGIL 372


>gi|224476814|ref|YP_002634420.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421421|emb|CAL28235.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 530

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 120/209 (57%), Gaps = 4/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KTK ++ KE   + K  + IIN ARGG++DE  L E L  G +A A  DVF  
Sbjct: 201 VHTPLTAKTKGMIGKEFFEQAKPQLQIINVARGGIIDEEELVEALDKGLIARAAIDVFTH 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF- 119
           EPA  +PL     V   P+LGASTVE+QEKVA+ ++++++++   G V +A+N   + F 
Sbjct: 261 EPATNSPLVKHDKVIVTPHLGASTVEAQEKVAVSVSNEIAEFFHTGNVRHAINAPKMIFG 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           EE   ++ ++ L D  G    QL+ ++ +E++I + G     +T +L   +  G++    
Sbjct: 321 EEDKELQDYIDLCDMAGKVCIQLLGKAPRELKIKFSGQLVKEDTNILTRTIAKGVLS-QD 379

Query: 180 VG--ANIISAPIIIKENAIILSTIKRDKS 206
           +G   N++++  ++ E  ++ +  K  KS
Sbjct: 380 LGDRVNLVNSLFLLNEQNVVYNVEKDAKS 408


>gi|242081631|ref|XP_002445584.1| hypothetical protein SORBIDRAFT_07g021980 [Sorghum bicolor]
 gi|241941934|gb|EES15079.1| hypothetical protein SORBIDRAFT_07g021980 [Sorghum bicolor]
          Length = 619

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 120/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PL   T  I N E+ +K K+GV IIN ARGG++DE+AL   L SG VA+A  DVF V
Sbjct: 275 LHMPLIPTTSKIFNDESFAKMKTGVRIINVARGGVIDEDALVRALDSGKVAQAALDVFTV 334

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++ +  L  NV   P+LGASTVE+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 335 EPPAKDSMLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVVGALRGELAATAVNAPMVPA 394

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P+++LA+ LG    QL++    I+ ++++Y  +     ++T +L + V  G+V
Sbjct: 395 EIMSELAPYVSLAEKLGRLAVQLVAGESGIKGVKVVYTTARGPDDLDTRLLRAMVTKGLV 454

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             V     N+++A    K+  + ++
Sbjct: 455 EPVSSTFVNLVNADYAAKQRGLRIT 479


>gi|116789697|gb|ABK25346.1| unknown [Picea sitchensis]
          Length = 622

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T+ I N E  +K K G  I+N ARGG++DE+AL + L +G VA+A  DVF V
Sbjct: 279 LHMPLTPSTEKIFNDETFAKMKKGARIVNVARGGVIDEDALVKALDAGIVAQAALDVFTV 338

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L     V   P+LGAST+E+QE VA+++A  +   L   + + A+N  ++  
Sbjct: 339 EPPEKDSKLVNHEKVIVTPHLGASTMEAQEGVAVEIAEAVVGALKGELAATAVNAPMVPA 398

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTA--VMNTMVLNSAVLAGIV 175
           E    + PF+TLA+ LG    QL++    ++ +++ Y  + A   ++T VL + +  GI+
Sbjct: 399 EVLSELAPFITLAEKLGRLAVQLVAGGSGVKSVKVTYSSARAGDDLDTRVLRAMITKGII 458

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +     N+++A  I ++  + LS
Sbjct: 459 EPISSAFVNLVNADFIARQRGLRLS 483


>gi|15235282|ref|NP_195146.1| EDA9 (embryo sac development arrest 9); ATP binding [Arabidopsis
           thaliana]
 gi|2911042|emb|CAA17552.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|7270370|emb|CAB80137.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|17380672|gb|AAL36166.1| putative phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|23297595|gb|AAN12903.1| putative phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 603

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 118/205 (57%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  ILN E  +K K GV I+N ARGG++DE+AL   L +G VA+A  DVF  
Sbjct: 260 LHMPLTPTTSKILNDETFAKMKKGVRIVNVARGGVIDEDALVRALDAGIVAQAALDVFTK 319

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  + L     V   P+LGAST+E+QE VAI++A  +   L   + + A+N  ++S 
Sbjct: 320 EPPAKDSKLVQHERVTVTPHLGASTMEAQEGVAIEIAEAVVGALNGELAATAVNAPMVSA 379

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +KP++ LA+ LG    QL++    ++  +I Y  + A   ++T +L + +  GI+
Sbjct: 380 EVLTELKPYVVLAEKLGRLAVQLVAGGSGVKNAKITYASARATDDLDTRLLRAMITKGII 439

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + LS
Sbjct: 440 EPISDVYVNLVNADFTAKQRGLRLS 464


>gi|296171277|ref|ZP_06852681.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
 gi|295894245|gb|EFG74002.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium parascrofulaceum
           ATCC BAA-614]
          Length = 528

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/209 (35%), Positives = 109/209 (52%), Gaps = 7/209 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ KE L+KTK GV I+N ARGGLVDE ALAE + SGHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLIGKEALAKTKPGVIIVNAARGGLVDEAALAEAVSSGHVRAAGIDVFAK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V +A+N+   +++
Sbjct: 261 EPCTDSPLFELPQVVVTPHLGASTSEAQDRAGTDVAASVKLALAGEFVPDAVNVGGGVVN 320

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
            E    V P++ L   LG     L       + +   G  A  +  VL  + L G+    
Sbjct: 321 EE----VAPWLDLVRKLGVLAASLSDGPPVSVSVQVRGELAAEDVEVLKLSALRGLFSAV 376

Query: 179 RVGA-NIISAPIIIKENAIILSTIKRDKS 206
             G    ++AP + +E  +     K  +S
Sbjct: 377 VEGPVTFVNAPALAEERGVTAELAKASES 405


>gi|302781158|ref|XP_002972353.1| hypothetical protein SELMODRAFT_413029 [Selaginella moellendorffii]
 gi|300159820|gb|EFJ26439.1| hypothetical protein SELMODRAFT_413029 [Selaginella moellendorffii]
          Length = 627

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 124/213 (58%), Gaps = 6/213 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT+ T+ I N E  +K K GV IIN ARGG++D+ AL + L +G VA+A  DVFE 
Sbjct: 280 LHMPLTDDTRGIFNDETFAKVKKGVRIINVARGGVIDDAALIKALDNGTVAQAALDVFEQ 339

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  N +    NV   P+LGASTVE+QE VA+++A  +   L   + + A+N  ++S 
Sbjct: 340 EPPAKDNKVVQHENVIVTPHLGASTVEAQEGVAVEIAEAVVGALRGELSATAVNAPMVSS 399

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           +    + P+++LA+ LG    QL++    ++++ I Y  + +   ++T +L + ++ G+V
Sbjct: 400 KVLTELAPYVSLAEKLGKLAVQLVAGGGGVKDVTISYTSARSPDDLDTRLLRAMIVKGLV 459

Query: 176 R-VWRVGANIISAPIIIKENAIILSTIKRDKSG 207
             V     N+++A  + K   I +S  +    G
Sbjct: 460 EPVSNAFINLVNADYVAKHRGIRISEERHPAEG 492


>gi|292657076|ref|YP_003536973.1| D-3-phosphoglycerate dehydrogenase [Haloferax volcanii DS2]
 gi|291370333|gb|ADE02560.1| D-3-phosphoglycerate dehydrogenase [Haloferax volcanii DS2]
          Length = 525

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 116/209 (55%), Gaps = 6/209 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ +++ + L    SG  ++NCARGG+VDE ALAE + +G +  A  DVF  
Sbjct: 199 VHTPLTPETEGLISTDELETMGSG-YLVNCARGGVVDEAALAEAVDAGVIDGAAVDVFAD 257

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP +  NPL  + +V   P+LGAST  +QE VA+  A Q+     D  V NALN   +  
Sbjct: 258 EPVSPDNPLLSVDDVVVTPHLGASTSAAQENVAVSTADQIVAAFRDEPVINALNAPSVDE 317

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--V 177
              P ++P++ LA+  G    QL+   + E+++ Y G  A  +  ++ ++ L G+     
Sbjct: 318 SAFPRIQPYIGLAETAGKIAAQLLDGRLNEVEVTYTGDIAAEDIELVTASALKGVFAPLE 377

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
           W+V  N ++AP + +E  I +   K  +S
Sbjct: 378 WQV--NAVNAPQVAEERGIEVVESKSRQS 404


>gi|163845877|ref|YP_001633921.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222523594|ref|YP_002568064.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus sp. Y-400-fl]
 gi|163667166|gb|ABY33532.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus aurantiacus
           J-10-fl]
 gi|222447473|gb|ACM51739.1| D-3-phosphoglycerate dehydrogenase [Chloroflexus sp. Y-400-fl]
          Length = 525

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 111/203 (54%), Gaps = 6/203 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPL   T+N+ +++ + + K G  +IN +RGG+VDE AL E L SGH+  A  DV+  
Sbjct: 199 LHVPLIESTRNLFDQQRIMQMKRGAYLINASRGGIVDEVALVEALNSGHLGGAALDVYNQ 258

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    +PL G P +   P++GAST E+Q     ++A  +   L  G    A+N   ++ 
Sbjct: 259 EPLPADSPLLGHPKIITVPHIGASTTEAQLSAGTEMAEGVVTALNGGTPRYAVNAPFVAP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV-- 177
           E   +++P++ L   LG  + QL+ E ++   +   G  A M+T  +  AVL G++    
Sbjct: 319 EAWNVLQPYLNLGRLLGTLVMQLVQEPVRSYDLELGGELADMDTQPVRLAVLQGLLAASS 378

Query: 178 -WRVGANIISAPIIIKENAIILS 199
             R+    ++APII +E  + ++
Sbjct: 379 SERI--TPVNAPIIARERGVRMT 399


>gi|325958180|ref|YP_004289646.1| D-3-phosphoglycerate dehydrogenase [Methanobacterium sp. AL-21]
 gi|325329612|gb|ADZ08674.1| D-3-phosphoglycerate dehydrogenase [Methanobacterium sp. AL-21]
          Length = 525

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 114/205 (55%), Gaps = 2/205 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT +TK++++K      K    IINCARGG+++E  L E L +  +  AG DV+EV
Sbjct: 200 IHVPLTPETKHLISKPQFEIMKENAIIINCARGGIINEEDLYEALSNNRIRGAGLDVYEV 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L NV   P++ AST E+Q   AI +A+++          N LNM ++  E
Sbjct: 260 EPPENSPLFTLDNVVLTPHIAASTSEAQRDAAIIVANEIKKVFQGRSPKNVLNMPVLDPE 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTM-VLNSAVLAGIVR-VW 178
              +VKP+  L + +G F+ Q    +I+EI + Y G  + +    +L   +L  ++  + 
Sbjct: 320 TFSMVKPYFGLIEKIGKFMIQTAKGNIKEIDVTYCGDLSELRKHDILTRMILQEVLNPIL 379

Query: 179 RVGANIISAPIIIKENAIILSTIKR 203
               N+++A  + ++  II++  KR
Sbjct: 380 TEPVNLVNATSVAEKRGIIVTEGKR 404


>gi|188996207|ref|YP_001930458.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931274|gb|ACD65904.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 529

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 107/199 (53%), Gaps = 4/199 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT +T+N++ K+     K GV  INCARGG+VDE+AL + +Q G +A  G DVF  
Sbjct: 202 LHCPLTEETRNMIGKKEFDLMKKGVYFINCARGGIVDEDALYDAIQEGKIAGLGLDVFSK 261

Query: 61  EPALQ--NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  +    LF  PN+  +P++GA+T ESQ+ VAI++A  +   L    V  A+N     
Sbjct: 262 EPPDERIRRLFEFPNISLSPHIGANTYESQDNVAIKIAQYVIAALKGQFVEVAVNAPFTI 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    +K ++ LA+ LG F+ Q       EI I   GS    +   + +  L G +  +
Sbjct: 322 TEGFENIKAYLELAEKLGSFLTQYAGGHFTEINIEVRGSIK-QHIEPITAFFLKGFLSPI 380

Query: 178 WRVGANIISAPIIIKENAI 196
                NII+AP I KE  +
Sbjct: 381 LDTPVNIINAPFIAKERGV 399


>gi|222824187|ref|YP_002575761.1| D-3-phosphoglycerate dehydrogenase [Campylobacter lari RM2100]
 gi|222539409|gb|ACM64510.1| D-3-phosphoglycerate dehydrogenase [Campylobacter lari RM2100]
          Length = 526

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 110/200 (55%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T ++++ E +SK K GV +INCARGGL +E+AL E L+SG +A  G DVF  
Sbjct: 203 IHTPKTKETTDMISFEEISKMKDGVRLINCARGGLYNEDALCEGLKSGKIAWLGIDVFNK 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +P     NV    +LGA+T+ESQE +AIQ   Q  +        NALN+ I + +
Sbjct: 263 EPATNHPFLEFENVSVTSHLGANTLESQENIAIQACEQALNAARGISYPNALNLPIKTED 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               V P++ L   +G    QL    I+ I++  +G  +  N  +L  A ++ +  +   
Sbjct: 323 LPSFVAPYIELISKMGFLAAQLDKTPIKAIKLESEGQISEYNESLLTFATVSVLRGILGE 382

Query: 181 GANIISAPIIIKENAIILST 200
             N I+A  + K+  + LS+
Sbjct: 383 NINYINAHFVAKDKGVELSS 402


>gi|57234596|ref|YP_181341.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides ethenogenes
           195]
 gi|57225044|gb|AAW40101.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides ethenogenes
           195]
          Length = 526

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 103/193 (53%), Gaps = 6/193 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T +TK ++  + L   K  V +IN +RGG++DE ALA  ++   +  A  DVF  
Sbjct: 199 LHVPMTGQTKGLIGPKELEMMKPTVRLINTSRGGIIDEEALAAAIREKRIGGAAIDVFSK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ LF   N+   P+LGAST E+QE     +  Q+ D         A+N   IS E
Sbjct: 259 EPCTESCLFECDNIIVTPHLGASTAEAQELATSDVVKQVIDVFEGRPARYAVNAPYISAE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV----- 175
             P+V PFM +A  +G  + QL    ++ + I Y G  A  +T  L + VL GI+     
Sbjct: 319 SLPVVGPFMPVARTVGSLVSQLTDGHMKNVTIKYCGELAAYDTTALKALVLGGILEHISE 378

Query: 176 -RVWRVGANIISA 187
            RV  V A+I++A
Sbjct: 379 ERVNVVNADIVAA 391


>gi|302786926|ref|XP_002975234.1| hypothetical protein SELMODRAFT_102593 [Selaginella moellendorffii]
 gi|300157393|gb|EFJ24019.1| hypothetical protein SELMODRAFT_102593 [Selaginella moellendorffii]
          Length = 629

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 121/213 (56%), Gaps = 6/213 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  I N E  +K K GV I+N ARGG++DEN+L   L SG VA+A  DVF  
Sbjct: 286 LHMPLTPATNKIFNDETFAKVKKGVRIVNVARGGVIDENSLVRALNSGIVAQAALDVFTK 345

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  + + L    NV   P+LGAST E+QE VA+++A  +   L   + + A+N  ++  
Sbjct: 346 EPPEKDDKLVQHENVIVTPHLGASTAEAQEGVALEIAEAVVGALQGELAATAVNAPMVPS 405

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++TLA+ LG    QL++    +++I I Y+ + A   ++T +L + ++ G+V
Sbjct: 406 EVLTELAPYITLAERLGKLAVQLVAGGGGVKDITISYNSARAPDDLDTRLLRAMIVKGLV 465

Query: 176 R-VWRVGANIISAPIIIKENAIILSTIKRDKSG 207
             V     N+++A  I K+  + +S  +    G
Sbjct: 466 EPVSDTHINLVNADYIAKQRGLRISEERHPAEG 498


>gi|16330470|ref|NP_441198.1| D-3-phosphoglycerate dehydrogenase [Synechocystis sp. PCC 6803]
 gi|3122863|sp|P73821|SERA_SYNY3 RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|1652961|dbj|BAA17878.1| phosphoglycerate dehydrogenase [Synechocystis sp. PCC 6803]
          Length = 554

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 116/213 (54%), Gaps = 6/213 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T N++N E L+K K    IINC+RGG++DE AL   +++  +  A  DVF  
Sbjct: 227 LHIPKTPETANLINAETLAKMKPTARIINCSRGGIIDEEALVTAIETAQIGGAALDVFAQ 286

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ L    NV   P+LGAST E+Q  VA+ +A Q+ D L+     +A+N+  ++ +
Sbjct: 287 EPLGESRLREFSNVILTPHLGASTEEAQVNVAVDVAEQIRDVLLGLPARSAVNIPGLTPD 346

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTA-VMNTMVLNSAVLAGIV-RVW 178
               ++P++ LA+ LG  +GQL    I  + +   G  A   N+  L  A + G++ +  
Sbjct: 347 VMEKLRPYLKLAETLGTLVGQLAGGRIDRLTVCLQGDLAEYTNSQPLVVAAIKGLLSQAL 406

Query: 179 RVGANIISAPIIIKENAIILSTIK----RDKSG 207
           R   N ++A I  KE  I +   K    RD SG
Sbjct: 407 RERVNYVNAAIEAKERGIRVIETKDASVRDYSG 439


>gi|297832018|ref|XP_002883891.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297329731|gb|EFH60150.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 602

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 118/205 (57%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  +LN E  +K K GV I+N ARGG++DE+AL   L  G VA+A  DVF  
Sbjct: 259 LHMPLTPATSKMLNDETFAKMKKGVRIVNVARGGVIDEDALVRALDGGIVAQAALDVFTK 318

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  + L     V   P+LGAST+E+QE VAI++A  +   L   + S A+N  ++S 
Sbjct: 319 EPPAKDSKLVQHERVTVTPHLGASTMEAQEGVAIEIAEAVVGALNGELASTAVNAPMVSA 378

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +KP++ LA+ LG    QL++    ++ +++ Y  + A   ++T +L + +  GI+
Sbjct: 379 EVLAELKPYVVLAEQLGRLAVQLVAGGSGVKNVKVTYASARATDDLDTRLLRAMITKGII 438

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + +S
Sbjct: 439 EPISDVYVNLVNADYTAKQRGMRIS 463


>gi|240168941|ref|ZP_04747600.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium kansasii ATCC
           12478]
          Length = 528

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 98/176 (55%), Gaps = 6/176 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ +  GHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAIGGGHVRAAGLDVFAS 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF LP V   P+LGASTVE+Q++    +A  +   L    V +A+N+   ++S
Sbjct: 261 EPCTDSPLFDLPQVVVTPHLGASTVEAQDRAGTDVAESVRLALAGEFVPDAVNVGAGVVS 320

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
            E    V P++ L   LG     L   +   + +   G  A     VL  + L G+
Sbjct: 321 EE----VAPWLDLVRKLGVLAAALSDGAPVSLSVQVRGELASEEVEVLRLSALRGL 372


>gi|148240317|ref|YP_001225704.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7803]
 gi|147848856|emb|CAK24407.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7803]
          Length = 528

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 70/177 (39%), Positives = 106/177 (59%), Gaps = 2/177 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N E L   KS   I+NCARGG+VDE ALAE +++G +A AG DV+  
Sbjct: 199 LHIPRTPDTENLVNAELLRSMKSTARIVNCARGGIVDEAALAEAIENGVIAGAGLDVYAS 258

Query: 61  EPALQN-PLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  ++ PL  +   +   P+LGAST E+QE VA  +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLSEDSPLRAVERGLVLTPHLGASTEEAQENVATDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            E    +KP + LA+ LG  + QL    +QE+++   G  A+  +  L  A L G++
Sbjct: 319 AEIMERLKPHLQLAETLGLLVSQLSGGQVQELEVRLQGEFALHPSQPLMVAALKGLL 375


>gi|222640652|gb|EEE68784.1| hypothetical protein OsJ_27507 [Oryza sativa Japonica Group]
          Length = 528

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 119/206 (57%), Gaps = 7/206 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  + N E+ S+ K+GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 183 LHMPLTPATSKVFNDESFSRMKNGVRIINVARGGVIDEDALVRALDSGKVAQAALDVFTE 242

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++    L  NV   P+LGASTVE+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 243 EPPAKDSKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVVGALRGELAATAVNAPMVPA 302

Query: 120 EEAPLVKPFMTLADHLGCFIGQLI---SESIQEIQIIYDGSTAV--MNTMVLNSAVLAGI 174
           E    + P+++LA+ LG    QL+   S  I+ ++++Y  +     ++T +L + V  GI
Sbjct: 303 EVMSELAPYVSLAEKLGKLAVQLVAGESGGIKGVKVVYTTARGPDDLDTRLLRAMVTKGI 362

Query: 175 VR-VWRVGANIISAPIIIKENAIILS 199
           V  V     N+++A    K+  + ++
Sbjct: 363 VEPVSSTFVNLVNADYTAKQRGLRIT 388


>gi|298705972|emb|CBJ29093.1| D-3-phosphoglycerate dehydrogenase [Ectocarpus siliculosus]
          Length = 623

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 116/206 (56%), Gaps = 10/206 (4%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT  T++++N E++++ K GV I+NCARGG+++E+AL + L SG VA A  DV+  
Sbjct: 281 LHTPLTPDTQDLVNDESIAQMKDGVIIVNCARGGIINEDALLKALNSGKVASAALDVYSS 340

Query: 61  EPALQNP--LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  ++   L   P + C P+LGAST E+Q  VA  +A QM D L     +  +N++ ++
Sbjct: 341 EPPPESSRELLQHPRLVCTPHLGASTEEAQVNVARDVAVQMCDTLEGKAYTGVVNVSYMA 400

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQI-IYDGSTAVMNTMVLNSAVLAGIV-- 175
               P ++P+M LA+ +G    Q+ S  + ++ +  Y G  A +        +LA ++  
Sbjct: 401 VANEPAMQPYMILAERIGKMQAQISSSKVVKVGLRTYGGKAANIEANSARQVILATVMKG 460

Query: 176 -----RVWRVGANIISAPIIIKENAI 196
                +  +   ++I++P + KE  I
Sbjct: 461 LLQYTKECKTAPSLINSPFLSKEMGI 486


>gi|293335763|ref|NP_001170081.1| hypothetical protein LOC100383999 [Zea mays]
 gi|224033345|gb|ACN35748.1| unknown [Zea mays]
          Length = 519

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PL   T  I N E+ +K K+GV IIN ARGG++DE+AL   L SG VA+A  DVF V
Sbjct: 174 LHMPLIPTTSKIFNDESFAKMKTGVRIINVARGGVIDEDALVRALDSGKVAQAALDVFTV 233

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++    L  NV   P+LGASTVE+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 234 EPPPKDSKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVVGALRGELAATAVNAPMVPA 293

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P+++LA+ LG    QL++    I+ ++++Y  +     ++T +L + V  G+V
Sbjct: 294 EILSELAPYVSLAEKLGRLAVQLVAGESGIKGVKVVYTTARGPDDLDTRLLRAMVTKGLV 353

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             V     N+++A    K+  + L+
Sbjct: 354 EPVSSTFVNLVNADYTAKQRGLRLT 378


>gi|42408279|dbj|BAD09434.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica
           Group]
 gi|42409460|dbj|BAD09817.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica
           Group]
 gi|215769351|dbj|BAH01580.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 621

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 119/206 (57%), Gaps = 7/206 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  + N E+ S+ K+GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 276 LHMPLTPATSKVFNDESFSRMKNGVRIINVARGGVIDEDALVRALDSGKVAQAALDVFTE 335

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++    L  NV   P+LGASTVE+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 336 EPPAKDSKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVVGALRGELAATAVNAPMVPA 395

Query: 120 EEAPLVKPFMTLADHLGCFIGQLI---SESIQEIQIIYDGSTAV--MNTMVLNSAVLAGI 174
           E    + P+++LA+ LG    QL+   S  I+ ++++Y  +     ++T +L + V  GI
Sbjct: 396 EVMSELAPYVSLAEKLGKLAVQLVAGESGGIKGVKVVYTTARGPDDLDTRLLRAMVTKGI 455

Query: 175 VR-VWRVGANIISAPIIIKENAIILS 199
           V  V     N+++A    K+  + ++
Sbjct: 456 VEPVSSTFVNLVNADYTAKQRGLRIT 481


>gi|255555301|ref|XP_002518687.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223542068|gb|EEF43612.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 596

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 118/203 (58%), Gaps = 8/203 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  ILN EN +K K GV I+N ARGG++DE+AL   + +G VA+A  DVF  
Sbjct: 253 LHMPLTPATSKILNDENFAKMKKGVRIVNVARGGVIDEDALVRAIDAGIVAQAALDVFTE 312

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  + L     V   P+LGASTVE+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 313 EPPAKDSKLVQHEKVTVTPHLGASTVEAQEGVAIEIAEAVVGALKGELAATAVNAPMVPA 372

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV---MNTMVLNSAVLAGI 174
           E    +KPF+ LA+ LG    QL++    ++ +++ Y GST     ++T +L + +  G+
Sbjct: 373 EVLTELKPFVMLAEKLGRLAVQLVAGGSGVKTVKVTY-GSTRAPDDLDTRLLRAMITKGL 431

Query: 175 VR-VWRVGANIISAPIIIKENAI 196
           +  +  V  N+++A    K+  +
Sbjct: 432 IEPISSVFVNLVNADFTAKQRGL 454


>gi|242309368|ref|ZP_04808523.1| d-3-phosphoglycerate dehydrogenase [Helicobacter pullorum MIT
           98-5489]
 gi|239523939|gb|EEQ63805.1| d-3-phosphoglycerate dehydrogenase [Helicobacter pullorum MIT
           98-5489]
          Length = 406

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 115/201 (57%), Gaps = 4/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T NI++KE ++K K GV +INCARGGL +E+AL E LQS  V  AG DVF  
Sbjct: 204 IHTPKNKETINIIDKEQIAKMKEGVVLINCARGGLYNEDALFEALQSKKVRWAGIDVFTK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA+ N L  LPN++  P++GA+T+ESQEK+AI+ A    +        NALN+ I   +
Sbjct: 264 EPAISNKLLDLPNIYVTPHIGANTLESQEKIAIEAAEAALEAARGSSFPNALNLPIKDSD 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               ++ ++ L   +  F  Q+    I+ I++   G  +   +  L++  L GI+    +
Sbjct: 324 LPNFMRAYLELMQKMAFFAIQVNKSEIRSIKLEVQGEISQYLSS-LSTFALVGILNA-TI 381

Query: 181 G--ANIISAPIIIKENAIILS 199
           G   N ++AP + KE  I +S
Sbjct: 382 GDKVNYVNAPYVAKERGIEIS 402


>gi|169630385|ref|YP_001704034.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium abscessus ATCC
           19977]
 gi|169242352|emb|CAM63380.1| D-3-phosphoglycerate dehydrogenase (SerA) [Mycobacterium abscessus]
          Length = 523

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 109/199 (54%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ KE L+KTK GV I+N ARGGL+DE ALA+ ++SGHV  AG DVF  
Sbjct: 196 VHLPKTPETAGLIGKEALAKTKPGVIIVNAARGGLIDEAALADAIRSGHVRGAGLDVFST 255

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+   ++S
Sbjct: 256 EPCTDSPLFELDQVVVTPHLGASTSEAQDRAGTDVAASVQLALAGEFVPDAVNVGGGVVS 315

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RV 177
            E    V P++ +   LG  IG +  +    + +   G  A  +  VL  + L G+   V
Sbjct: 316 EE----VAPWLEVVRKLGVLIGAVSEQLPTSLSVDVRGELASEDVAVLKLSALRGLFSSV 371

Query: 178 WRVGANIISAPIIIKENAI 196
                  ++AP I +E  +
Sbjct: 372 IEDQVTFVNAPSIAEERGV 390


>gi|300858316|ref|YP_003783299.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300685770|gb|ADK28692.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302206033|gb|ADL10375.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis C231]
 gi|302330586|gb|ADL20780.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis 1002]
 gi|308276270|gb|ADO26169.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           pseudotuberculosis I19]
          Length = 531

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 113/207 (54%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T+ + + E L+K+K G  I+N ARGGLV+E ALA+ + SGH+  AGFDVF  
Sbjct: 204 IHLPKTPETQGMFDAELLAKSKPGQIIVNAARGGLVNEQALADAIMSGHIRGAGFDVFAT 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGASTVE+Q++    +A  +   L    V +A+N++     
Sbjct: 264 EPCTDSPLFALPQVVVTPHLGASTVEAQDRAGTDVAESVLKALAGEFVPDAVNVSGGRVG 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V  ++ LA  LG   G+L+ ++   +++   G  +  +   L  + L G+   V  
Sbjct: 324 EE--VSLWLDLARKLGLVAGKLLDKAAVSLEVEARGELSTEDVDALGLSALRGLFSAVIE 381

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
                ++AP I +E  + L      +S
Sbjct: 382 EPVTFVNAPRIAEERGVKLDVTTASES 408


>gi|302785179|ref|XP_002974361.1| hypothetical protein SELMODRAFT_149626 [Selaginella moellendorffii]
 gi|300157959|gb|EFJ24583.1| hypothetical protein SELMODRAFT_149626 [Selaginella moellendorffii]
          Length = 545

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 121/213 (56%), Gaps = 6/213 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  I N E  +K K GV I+N ARGG++DEN+L   L SG VA+A  DVF  
Sbjct: 202 LHMPLTPATNKIFNDETFAKVKKGVRIVNVARGGVIDENSLVRALNSGIVAQAALDVFTK 261

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  + + L    NV   P+LGAST E+QE VA+++A  +   L   + + A+N  ++  
Sbjct: 262 EPPEKDDKLVQHENVIVTPHLGASTAEAQEGVALEIAEAVVGALQGELAATAVNAPMVPS 321

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++TLA+ LG    QL++    +++I I Y+ + A   ++T +L + ++ G+V
Sbjct: 322 EVLTELAPYITLAERLGKLAVQLVAGGGGVKDITISYNSARAPDDLDTRLLRAMIVKGLV 381

Query: 176 R-VWRVGANIISAPIIIKENAIILSTIKRDKSG 207
             V     N+++A  + K+  + +S  +    G
Sbjct: 382 EPVSDTHINLVNADYVAKQRGLRISEERHPAEG 414


>gi|262203115|ref|YP_003274323.1| D-3-phosphoglycerate dehydrogenase [Gordonia bronchialis DSM 43247]
 gi|262086462|gb|ACY22430.1| D-3-phosphoglycerate dehydrogenase [Gordonia bronchialis DSM 43247]
          Length = 531

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 106/197 (53%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L++TK GV I+N ARGGL+DE ALA+ + SG V  AG DV+  
Sbjct: 204 VHLPKTPETLGLIGAEQLARTKKGVVIVNAARGGLIDEQALADAINSGQVRGAGLDVYAT 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V +A+N+   + +
Sbjct: 264 EPCTDSPLFELPQVVVTPHLGASTSEAQDRAGTDVAKSVRLALAGHFVPDAVNITGGAVD 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V P++ +A  LG  +G +  E    + +   G  A  N  VL  + L G+   V  
Sbjct: 324 EE--VAPWLEMARKLGVVVGAISQEPPTSLVVDVRGELASSNVDVLGLSALRGLFSAVLD 381

Query: 180 VGANIISAPIIIKENAI 196
                ++AP +  E  +
Sbjct: 382 DPVTFVNAPAVAAERGV 398


>gi|194704786|gb|ACF86477.1| unknown [Zea mays]
          Length = 624

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PL   T  I N E+ +K K+GV IIN ARGG++DE+AL   L SG VA+A  DVF V
Sbjct: 279 LHMPLIPTTSKIFNDESFAKMKTGVRIINVARGGVIDEDALVRALDSGKVAQAALDVFTV 338

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++    L  NV   P+LGASTVE+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 339 EPPPKDSKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVVGALRGELAATAVNAPMVPA 398

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P+++LA+ LG    QL++    I+ ++++Y  +     ++T +L + V  G+V
Sbjct: 399 EILSELAPYVSLAEKLGRLAVQLVAGESGIKGVKVVYTTARGPDDLDTRLLRAMVTKGLV 458

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             V     N+++A    K+  + L+
Sbjct: 459 EPVSSTFVNLVNADYTAKQRGLRLT 483


>gi|237756137|ref|ZP_04584709.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237691701|gb|EEP60737.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 529

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 106/199 (53%), Gaps = 4/199 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT +T+N++ K+     K GV  INCARGG+VDE+AL + +Q G +A  G DVF  
Sbjct: 202 LHCPLTEETRNMIGKKEFDLMKKGVYFINCARGGIVDEDALYDAIQEGKIAGLGLDVFSK 261

Query: 61  EPALQ--NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP       LF  PN+  +P++GA+T ESQ+ VAI++A  +   L    V  A+N     
Sbjct: 262 EPPDDGIRRLFEFPNISLSPHIGANTYESQDNVAIKIAQYVIAALKGQFVEVAVNAPFTI 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    +K ++ LA+ LG F+ Q       EI I   GS    +   + +  L G +  +
Sbjct: 322 TEGFENIKAYLELAEKLGSFLTQYAGGHFTEINIEVRGSIK-QHIEPITAFFLKGFLSPI 380

Query: 178 WRVGANIISAPIIIKENAI 196
                NII+AP I KE  +
Sbjct: 381 LDTPVNIINAPFIAKERGV 399


>gi|147669219|ref|YP_001214037.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. BAV1]
 gi|146270167|gb|ABQ17159.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. BAV1]
          Length = 526

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 105/197 (53%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T +TK ++  + L   K  V +IN +RGG++DE ALA+ ++   +  A  DVF  
Sbjct: 199 LHVPMTGQTKGLIGPKELEMMKPTVRLINTSRGGIIDEEALAKAVKEKRIGGAAIDVFSK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ LF   N+   P+LGAST E+QE     +  Q+ D         A+N   IS E
Sbjct: 259 EPCTESCLFECDNIIVTPHLGASTAEAQELATSDVVKQVIDVFEGRPARYAVNAPYISAE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
             P+V PFM +A  +G  + QL    ++ + I Y G  A  +T  L + VL GI+  +  
Sbjct: 319 SLPVVGPFMPVARTVGSLVSQLTDGHMKNVTIKYCGELAAYDTTALKALVLGGILEHISE 378

Query: 180 VGANIISAPIIIKENAI 196
              N+++A I+  +  +
Sbjct: 379 ERVNVVNADIVASQRGL 395


>gi|124022234|ref|YP_001016541.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9303]
 gi|123962520|gb|ABM77276.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9303]
          Length = 528

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 107/177 (60%), Gaps = 2/177 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N+E L K KS   ++NCARGG++DE+ALA+ L++G +  A  DV+  
Sbjct: 199 LHLPRTPDTENLVNEELLGKMKSTARLVNCARGGIIDESALADALKAGVIGGAALDVYAQ 258

Query: 61  EP-ALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP A  +PL  +   +   P+LGAST E+QE VA+ +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLATDSPLRSVQERLILTPHLGASTTEAQENVAVDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            E    +KP + LA+ LG  + QL    +QE+++   G  A   +  L  A L G++
Sbjct: 319 AEIMERLKPHLQLAETLGLLVSQLSGGQLQELEVRLQGEFAQHPSQPLVIAALKGVL 375


>gi|73748439|ref|YP_307678.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. CBDB1]
 gi|73660155|emb|CAI82762.1| D-3-phosphoglycerate dehydrogenase [Dehalococcoides sp. CBDB1]
          Length = 526

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 105/197 (53%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T +TK ++  + L   K  V +IN +RGG++DE ALA+ ++   +  A  DVF  
Sbjct: 199 LHVPMTGQTKGLIGPKELEMMKPTVRLINTSRGGIIDEEALAKAVKEKRIGGAAIDVFSK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ LF   N+   P+LGAST E+QE     +  Q+ D         A+N   IS E
Sbjct: 259 EPCTESCLFECDNIIVTPHLGASTAEAQELATSDVVKQVIDVFEGRPARYAVNAPYISAE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
             P+V PFM +A  +G  + QL    ++ + I Y G  A  +T  L + VL GI+  +  
Sbjct: 319 SLPVVGPFMPVARTVGSLVSQLTDGHMKNVTIKYCGELAAYDTTALKALVLGGILEHISE 378

Query: 180 VGANIISAPIIIKENAI 196
              N+++A I+  +  +
Sbjct: 379 ERVNVVNADIVASQRGL 395


>gi|88807419|ref|ZP_01122931.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7805]
 gi|88788633|gb|EAR19788.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 7805]
          Length = 528

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 120/211 (56%), Gaps = 7/211 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N E L   KS   I+NCARGG+VDE ALAE +++G +A AG DV+  
Sbjct: 199 LHIPRTPDTENLVNAELLRSMKSTSRIVNCARGGIVDEAALAEAIENGVIAGAGLDVYAS 258

Query: 61  EP-ALQNPLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP A  +PL  +   +   P+LGAST E+QE VA  +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLAEDSPLRTVERGLVLTPHLGASTEEAQENVATDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
            E    +KP + LA+ LG  + QL    +QE+++   G  A+  +  L  A L G++   
Sbjct: 319 AEIMERLKPHLQLAETLGLLVSQLSGGQVQELEVRLQGEFALHPSQPLVVAALKGLLTSA 378

Query: 179 ---RVGANIISAPIIIKENAIILSTIKRDKS 206
              R+  N ++A +  K   I +  +K D S
Sbjct: 379 LGDRI--NYVNASLEAKGRGIHVLEVKDDAS 407


>gi|125561721|gb|EAZ07169.1| hypothetical protein OsI_29415 [Oryza sativa Indica Group]
          Length = 621

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 119/206 (57%), Gaps = 7/206 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  + N E+ +K K+GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 276 LHMPLTPATSKVFNDESFAKMKNGVRIINVARGGVIDEDALVRALDSGKVAQAALDVFTE 335

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++    L  NV   P+LGASTVE+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 336 EPPAKDSKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVVGALRGELAATAVNAPMVPA 395

Query: 120 EEAPLVKPFMTLADHLGCFIGQLI---SESIQEIQIIYDGSTAV--MNTMVLNSAVLAGI 174
           E    + P+++LA+ LG    QL+   S  I+ ++++Y  +     ++T +L + V  GI
Sbjct: 396 EVMSELAPYVSLAEKLGKLAVQLVAGESGGIKGVKVVYTTARGPDDLDTRLLRAMVTKGI 455

Query: 175 VR-VWRVGANIISAPIIIKENAIILS 199
           V  V     N+++A    K+  + ++
Sbjct: 456 VEPVSSTFVNLVNADYTAKQRGLRIT 481


>gi|17229382|ref|NP_485930.1| D-3-phosphoglycerate dehydrogenase [Nostoc sp. PCC 7120]
 gi|17130980|dbj|BAB73589.1| phosphoglycerate dehydrogenase [Nostoc sp. PCC 7120]
          Length = 526

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 112/198 (56%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T +I+N   L+K K    IINCARGG++DE ALA  ++ G +A A  DVFE 
Sbjct: 199 LHIPKTPETTHIINATTLAKMKPTARIINCARGGIIDEAALAAAIKEGKIAGAALDVFES 258

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++ L  +  ++   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  +  
Sbjct: 259 EPLGESDLRAIGKDIILTPHLGASTTEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGLGP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
           +    +KP+M LA+ LG  +GQL    ++ + +   G  A   +  L  A L G++ +  
Sbjct: 319 DVLEELKPYMQLAETLGKLVGQLAGGRVELLTVRLQGELATNKSQPLVIASLKGLLHQAL 378

Query: 179 RVGANIISAPIIIKENAI 196
           R   N ++A I  KE  I
Sbjct: 379 RERVNYVNANIEAKERGI 396


>gi|158312947|ref|YP_001505455.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EAN1pec]
 gi|158108352|gb|ABW10549.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EAN1pec]
          Length = 529

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 111/200 (55%), Gaps = 8/200 (4%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  + L++ K GV I+N ARGGLVDE ALA+ ++SG V   G DV+  
Sbjct: 199 IHLPKTPETLGLIGADELARVKPGVIIVNAARGGLVDEGALADAVRSGRVGGVGLDVYVK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM---AII 117
           EP   +PLFGL NV   P+LGAST E+Q+K  + +A  +   L    V +A+N+    ++
Sbjct: 259 EPTTSSPLFGLENVVVTPHLGASTQEAQDKAGLAVARSVRLALSGEFVPDAVNVQAGGVV 318

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VR 176
           + +    V+P + LA+ LG     L +     I +   G  A  +  VL  AVL G+ + 
Sbjct: 319 AED----VRPGLPLAEKLGQLFSGLAAGVAAAITVEVRGEIAAHDVSVLQLAVLKGVFID 374

Query: 177 VWRVGANIISAPIIIKENAI 196
           +       ++AP+I KE  +
Sbjct: 375 IVEEQVTYVNAPLIAKERGV 394


>gi|317050557|ref|YP_004111673.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
 gi|316945641|gb|ADU65117.1| D-3-phosphoglycerate dehydrogenase [Desulfurispirillum indicum S5]
          Length = 544

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 115/218 (52%), Gaps = 12/218 (5%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH P T +T  ++ K  L     G  ++N ARGGL++E  L + L+SG +  A  DVF+ 
Sbjct: 206 LHTPRTPETLGMIGKRELELLPDGAIVVNVARGGLINEKDLHDALKSGKLRAAAVDVFDK 265

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N L GL NV   P+LGA+T  SQ  VA+ +A Q+ + L D     A+N+  +  +
Sbjct: 266 EPATDNILLGLDNVIVTPHLGANTDASQINVAVMVAQQVINVLKDRDYEGAVNIPSVLTK 325

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGS-----------TAVMNTMVLNSA 169
            A   + +  LA+ +G  +G +I E+I+E  I+Y GS              +N M  + A
Sbjct: 326 LADDFRVYFELAEKMGKVLGSMIGEAIEECSIVYRGSLFDREFGPRSFDVPLNLMPFSVA 385

Query: 170 VLAGIVR-VWRVGANIISAPIIIKENAIILSTIKRDKS 206
            L GI+    + G + ISAP I++E  + +   K  +S
Sbjct: 386 ALKGILEPKMQEGVSYISAPYIMRERGVAIEEKKISQS 423


>gi|108798878|ref|YP_639075.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. MCS]
 gi|119867993|ref|YP_937945.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. KMS]
 gi|108769297|gb|ABG08019.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. MCS]
 gi|119694082|gb|ABL91155.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. KMS]
          Length = 528

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 103/197 (52%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ +E L+KTK GV I+N ARGGL+DE ALA+ +  GHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLIGREALAKTKKGVIIVNAARGGLIDEQALADAVTGGHVRAAGLDVFAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V +A+N+      
Sbjct: 261 EPCTDSPLFELPQVVVTPHLGASTAEAQDRAGTDVAASVRLALAGEFVPDAVNVGGGVVG 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V P++ L   LG   G L +E    + +   G  A     VL  + L G+   V  
Sbjct: 321 EE--VAPWLDLVRKLGLLAGTLATEPTTTLSVRVCGELAAEEVEVLRLSALRGLFSTVTD 378

Query: 180 VGANIISAPIIIKENAI 196
                ++AP +  E  +
Sbjct: 379 QQVTFVNAPALAAERGV 395


>gi|75909963|ref|YP_324259.1| D-3-phosphoglycerate dehydrogenase [Anabaena variabilis ATCC 29413]
 gi|75703688|gb|ABA23364.1| D-3-phosphoglycerate dehydrogenase [Anabaena variabilis ATCC 29413]
          Length = 526

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 112/198 (56%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T +I+N   L+K K    IINCARGG++DE ALA  ++ G +A A  DVFE 
Sbjct: 199 LHIPKTPETTHIINATTLAKMKPTARIINCARGGIIDEAALAAAVKEGKIAGAALDVFES 258

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++ L  +  ++   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  +  
Sbjct: 259 EPLGESDLRAIGKDIILTPHLGASTTEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGLGP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
           +    +KP+M LA+ LG  +GQL    ++ + +   G  A   +  L  A L G++ +  
Sbjct: 319 DVLEELKPYMQLAETLGKLVGQLAGGRVELLTVRLQGELATNKSQPLVIASLKGLLHQAL 378

Query: 179 RVGANIISAPIIIKENAI 196
           R   N ++A I  KE  I
Sbjct: 379 RERVNYVNANIEAKERGI 396


>gi|189346493|ref|YP_001943022.1| D-3-phosphoglycerate dehydrogenase [Chlorobium limicola DSM 245]
 gi|189340640|gb|ACD90043.1| D-3-phosphoglycerate dehydrogenase [Chlorobium limicola DSM 245]
          Length = 526

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 66/180 (36%), Positives = 101/180 (56%), Gaps = 1/180 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H  L   T+N+++ E  +  K GV I+NCARGG+V+E  LA+ + SG VA A  DVFE 
Sbjct: 199 IHSSLNESTRNLISNETFALMKDGVIIVNCARGGIVNEADLADAIVSGKVAAAALDVFES 258

Query: 61  EPA-LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    NPL  L  V   P++ AST E+Q+KVA+Q+A Q+ D+   G +  A+N + +  
Sbjct: 259 EPVNPDNPLLKLERVIVTPHIAASTNEAQQKVAVQIAEQIVDWKQKGKLEGAVNASAVEL 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
            +AP V  ++ LA+ LG  + Q+       + I   G      + V+ +A L G + V +
Sbjct: 319 AQAPGVSAYLMLAEKLGSTLAQITPLEAHTMTIRTSGEYLQKFSEVIAAAALKGFLDVRQ 378


>gi|226529328|ref|NP_001147079.1| LOC100280688 [Zea mays]
 gi|195607108|gb|ACG25384.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 624

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PL   T  I N E+ +K K+GV IIN ARGG++DE+AL   L SG VA+A  DVF V
Sbjct: 279 LHMPLIPTTSKIFNDESFAKMKNGVRIINVARGGVIDEDALVRALDSGKVAQAALDVFTV 338

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++    L  NV   P+LGASTVE+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 339 EPPPKDSKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVVGALRGELAATAVNAPMVPA 398

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P+++LA+ LG    QL++    I+ ++++Y  +     ++T +L + V  G+V
Sbjct: 399 EILSELAPYVSLAEKLGRLAVQLVAGESGIKGVKVVYTTARGPDDLDTRLLRAMVTKGLV 458

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             V     N+++A    K+  + L+
Sbjct: 459 EPVSSTFVNLVNADYTAKQRGLRLT 483


>gi|119508833|ref|ZP_01627985.1| D-3-phosphoglycerate dehydrogenase [Nodularia spumigena CCY9414]
 gi|119466362|gb|EAW47247.1| D-3-phosphoglycerate dehydrogenase [Nodularia spumigena CCY9414]
          Length = 526

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 110/198 (55%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T +++N   L+K K    IINCARGG++DE ALA  ++ G +  A  DVFE 
Sbjct: 199 LHIPKTPETTHLINATTLAKMKPTARIINCARGGIIDEAALAVAIKEGQIKGAALDVFES 258

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++ L  L   V   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  +  
Sbjct: 259 EPLGESDLRSLGKEVILTPHLGASTTEAQVNVAIDVAEQIRDVLLGLAARSAVNIPGLGP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
           +    +KP+M LA+ LG  +GQL    ++ + +   G  A   +  L  A L G++ +  
Sbjct: 319 DVLEELKPYMQLAETLGNLVGQLAGGRVESLTVRLQGELASNKSQPLVVASLKGLLYQAL 378

Query: 179 RVGANIISAPIIIKENAI 196
           R   N ++A I  KE  I
Sbjct: 379 RERVNYVNATIEAKERGI 396


>gi|270307961|ref|YP_003330019.1| phosphoglycerate dehydrogenase [Dehalococcoides sp. VS]
 gi|270153853|gb|ACZ61691.1| phosphoglycerate dehydrogenase [Dehalococcoides sp. VS]
          Length = 526

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 104/197 (52%), Gaps = 1/197 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP+T +TK ++  + L   K  V +IN +RGG++DE ALA  ++   +  A  DVF  
Sbjct: 199 LHVPMTGQTKGLIGPKELEMMKPTVRLINTSRGGIIDEEALATAIKEKRIGGAAIDVFSK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ LF   N+   P+LGAST E+QE     +  Q+ D         A+N   IS E
Sbjct: 259 EPCTESCLFECDNIIVTPHLGASTAEAQELATSDVVKQVIDVFEGRPARYAVNAPYISAE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
             P+V PFM +A  +G  + QL    ++ + I Y G  A  +T  L + VL GI+  +  
Sbjct: 319 SLPVVGPFMPVARTVGSLVSQLTDGHMKNVTIKYCGELAAYDTTALKALVLGGILEHISE 378

Query: 180 VGANIISAPIIIKENAI 196
              N+++A I+  +  +
Sbjct: 379 ERVNVVNADIVASQRGL 395


>gi|18394525|ref|NP_564034.1| PGDH (3-PHOSPHOGLYCERATE DEHYDROGENASE); phosphoglycerate
           dehydrogenase [Arabidopsis thaliana]
 gi|3122858|sp|O04130|SERA_ARATH RecName: Full=D-3-phosphoglycerate dehydrogenase, chloroplastic;
           Short=3-PGDH; Flags: Precursor
 gi|9802747|gb|AAF99816.1|AC034257_8 D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|2189964|dbj|BAA20405.1| Phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|2804258|dbj|BAA24440.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana]
 gi|15215740|gb|AAK91415.1| At1g17740/F11A6_16 [Arabidopsis thaliana]
 gi|20466083|gb|AAM19963.1| At1g17740/F11A6_16 [Arabidopsis thaliana]
 gi|21554130|gb|AAM63210.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
 gi|332191509|gb|AEE29630.1| D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 624

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVF-E 59
           LH+PLT  TK + N E  SK K GV +IN ARGG++DE+AL   L +G VA+A  DVF E
Sbjct: 281 LHMPLTPATKKVFNDETFSKMKKGVRLINVARGGVIDEDALVRALDAGIVAQAALDVFCE 340

Query: 60  VEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
             P+  + L    NV   P+LGAST E+QE VAI++A  ++  L   + + A+N  +++ 
Sbjct: 341 EPPSKDSRLIQHENVTVTPHLGASTKEAQEGVAIEIAEAVAGALKGELSATAVNAPMVAP 400

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL S  + +Q I+++Y  +     ++T +L + +  GI+
Sbjct: 401 EVLSELTPYIVLAEKLGRLAVQLASGGKGVQSIRVVYRSARDRDDLDTRLLRAMITKGII 460

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +     N+++A  I K+  + +S
Sbjct: 461 EPISDSYVNLVNADFIAKQKGLRIS 485


>gi|326505978|dbj|BAJ91228.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326514850|dbj|BAJ99786.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 617

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 121/208 (58%), Gaps = 6/208 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  +LN E  +K K GV IIN ARGG++DE+AL   L +G VA+A  DVF  
Sbjct: 274 LHMPLTPSTNKMLNDEAFAKMKKGVRIINVARGGVIDEDALVRALDAGIVAQAALDVFTK 333

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  + L    NV   P+LGASTVE+QE VAI++A  ++  L   + ++A+N  ++  
Sbjct: 334 EPPAADSKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVTGALKGELAASAVNAPMVPA 393

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL++    I+ +++ Y  + A   ++T +L + +  G++
Sbjct: 394 EVLSELAPYVVLAEKLGRLAVQLVAGGGGIKSVKVTYASARAPDDLDTRLLRAMITKGVI 453

Query: 176 R-VWRVGANIISAPIIIKENAIILSTIK 202
             +  V  N+++A    K+  I +S  K
Sbjct: 454 EPISDVFVNLVNADFTAKQRGIRVSEEK 481


>gi|126434478|ref|YP_001070169.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. JLS]
 gi|126234278|gb|ABN97678.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium sp. JLS]
          Length = 528

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 103/197 (52%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ +E L+KTK GV I+N ARGGL+DE ALA+ +  GHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLIGREALAKTKKGVIIVNAARGGLIDEQALADAVTGGHVRAAGLDVFAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V +A+N+      
Sbjct: 261 EPCTDSPLFELPQVVVTPHLGASTAEAQDRAGTDVAASVRLALAGEFVPDAVNVGGGVVG 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V P++ L   LG   G L +E    + +   G  A     VL  + L G+   V  
Sbjct: 321 EE--VAPWLDLVRKLGLLAGTLATEPTTTLSVRVCGELAAEEVEVLRLSALRGLFSTVTD 378

Query: 180 VGANIISAPIIIKENAI 196
                ++AP +  E  +
Sbjct: 379 QQVTFVNAPALAAERGV 395


>gi|300709559|ref|YP_003735373.1| D-3-phosphoglycerate dehydrogenase [Halalkalicoccus jeotgali B3]
 gi|299123242|gb|ADJ13581.1| D-3-phosphoglycerate dehydrogenase [Halalkalicoccus jeotgali B3]
          Length = 537

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/203 (33%), Positives = 112/203 (55%), Gaps = 2/203 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+++++ + L     G  +INCARGG+VDE ALAE +++G +  A  DVF  
Sbjct: 200 VHTPLTPETEDLISHDELELLGEG-YLINCARGGVVDEAALAEAVETGPLKGAALDVFAE 258

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP + +NPL  + +V   P+LGAST  +QE VA   A Q+     D  V NALN   I  
Sbjct: 259 EPISPENPLLDVEDVIVTPHLGASTEAAQENVATSTAEQVLAAFNDEPVLNALNAPSIDK 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
              P V+P++ LA+  G    QL+ + ++ + I Y G  A     ++ ++ L G+     
Sbjct: 319 SAFPRVRPYIELAETAGRIAAQLLDKRVESVDIRYAGEIAEEEVDLVTASALKGVFSPLE 378

Query: 180 VGANIISAPIIIKENAIILSTIK 202
              N ++AP + ++  + ++  K
Sbjct: 379 WQVNAVNAPQVAEDRGVDVTETK 401


>gi|332191510|gb|AEE29631.1| D-3-phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 651

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVF-E 59
           LH+PLT  TK + N E  SK K GV +IN ARGG++DE+AL   L +G VA+A  DVF E
Sbjct: 308 LHMPLTPATKKVFNDETFSKMKKGVRLINVARGGVIDEDALVRALDAGIVAQAALDVFCE 367

Query: 60  VEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
             P+  + L    NV   P+LGAST E+QE VAI++A  ++  L   + + A+N  +++ 
Sbjct: 368 EPPSKDSRLIQHENVTVTPHLGASTKEAQEGVAIEIAEAVAGALKGELSATAVNAPMVAP 427

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL S  + +Q I+++Y  +     ++T +L + +  GI+
Sbjct: 428 EVLSELTPYIVLAEKLGRLAVQLASGGKGVQSIRVVYRSARDRDDLDTRLLRAMITKGII 487

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +     N+++A  I K+  + +S
Sbjct: 488 EPISDSYVNLVNADFIAKQKGLRIS 512


>gi|300933674|ref|ZP_07148930.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium resistens DSM
           45100]
          Length = 530

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 109/207 (52%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + N E L K K G  IIN ARGGLVDE ALA+ ++SGH+  AGFDV++ 
Sbjct: 204 IHLPKTKETAGMFNAELLGKAKKGQIIINAARGGLVDEQALADAIKSGHIRGAGFDVYDS 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L  V   P+LGASTVE+Q++    +A  +   L    V +A+N++     
Sbjct: 264 EPCTDSPLFELDEVVVTPHLGASTVEAQDRAGTDVAASVLRALAGDFVPDAVNVSGGKVS 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW-R 179
           E   V  ++ LA +LG   G+L+  +   + +   G  +      L  A + G+   +  
Sbjct: 324 EE--VALWLNLATNLGRVAGELLGAAPTAVNVTAKGELSTEKVDALGLAAMRGVFTGFID 381

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
                ++ P I +E  + L     D+S
Sbjct: 382 EQVTFVNTPTIAEERGVQLEVGSHDES 408


>gi|303311837|ref|XP_003065930.1| D-3-phosphoglycerate dehydrogenase, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240105592|gb|EER23785.1| D-3-phosphoglycerate dehydrogenase, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320039874|gb|EFW21808.1| D-3-phosphoglycerate dehydrogenase [Coccidioides posadasii str.
           Silveira]
          Length = 589

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 121/219 (55%), Gaps = 13/219 (5%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   L+K K G  I+N ARGG +DE AL + L+SGH+A AG DVF  
Sbjct: 209 IHTPLIASTKGMISTAELAKMKPGARILNVARGGTIDEIALLDALESGHIAGAGIDVFTS 268

Query: 61  EP----ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP    +  + L   PNV   P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 269 EPPKPGSSASRLIAHPNVVATPHLGASTVEAQENVSIDVCEQVLQILGGALPRSAVNAPL 328

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESI------QEIQIIYDGSTA-VMNTMVLNSA 169
           I  EE   ++PF+ L + +G    Q  S S           +IY+G  A + NT  L +A
Sbjct: 329 ILPEEYKKLQPFVRLVEKMGSLYTQHYSSSTSFDANRSTFDLIYEGDIAGINNTKPLFAA 388

Query: 170 VLAGIV-RVWRVGANIISAPIIIKENAIILSTIK-RDKS 206
            + G++  +     +I++A ++ +E  I+++  + RD S
Sbjct: 389 FIKGLMATISSTNVSIVNAELVARERGIVVNEQRSRDPS 427


>gi|312621616|ref|YP_004023229.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312202083|gb|ADQ45410.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 531

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 115/215 (53%), Gaps = 8/215 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N+++++   K K GV I+NCARGG+++EN L   ++ G VA A  DV E 
Sbjct: 199 IHTPKTKETYNLISEKEFKKMKKGVRIVNCARGGVINENDLYNAIKEGIVAAAALDVLEK 258

Query: 61  EPALQ-------NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP  +       NPL  L NV   P+LGAST E+Q  VA+ +A +++  L  G+  NA+N
Sbjct: 259 EPNFELEKQEYHNPLLELDNVVITPHLGASTQEAQVNVAVSVAREVAAVLKGGIAKNAVN 318

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +     E+     P++ LA+ +G    Q       +I+I+Y G      T  L  A+L G
Sbjct: 319 LPAFEKEKLEETMPYLELAEAMGKIFIQAERAFANKIEIVYSGQIDEKATTWLTRALLKG 378

Query: 174 IVRVW-RVGANIISAPIIIKENAIILSTIKRDKSG 207
            +    +   N +++ ++ KE  I +   K +++G
Sbjct: 379 YLEFSVQDTVNYVNSQLLAKEQGIEVIESKTEEAG 413


>gi|326924873|ref|XP_003208648.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Meleagris
           gallopavo]
          Length = 490

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 107/204 (52%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    +K + GV ++NCARGG+VDE AL   L+SG    A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDSTFAKCRRGVQVVNCARGGIVDEGALLRALRSGQCGGAALDVFTQ 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L   PNV C P+LGAST E+Q +   ++A Q+ D      +   +N   +S  
Sbjct: 265 EPPKDRDLVDHPNVICCPHLGASTREAQSRCGKEIAMQIVDMATGKGLVGVVNGQALSKA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            AP  KP++TLA  LG  +  L  ++   +Q+   G+     +  L  AV++G++   + 
Sbjct: 325 FAPQTKPWITLARALGTVLHGLAKQATGNVQVCTLGAPLKDASSYLAPAVVSGMLAGGKK 384

Query: 181 GANIISAPIIIKENAIILSTIKRD 204
            A +++A ++ +E  + ++    D
Sbjct: 385 EATLVNAMLLAQEAGLKVTASHGD 408


>gi|326501108|dbj|BAJ98785.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326504920|dbj|BAK06751.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 616

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 117/202 (57%), Gaps = 6/202 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  +   E+  K K+GV IIN ARGG++DE+AL   L SG VA+A  DVF V
Sbjct: 272 LHMPLTPATSKVFKDESFGKMKTGVRIINVARGGVIDEDALVRALDSGKVAQAALDVFTV 331

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++    L  NV   P+LGASTVE+QE VAI++A  ++  L   + + A+N  ++  
Sbjct: 332 EPPPKDSKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVAGALRGELAATAVNAPMVPA 391

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P+++LA+ LG    QL++    I+ ++++Y  +     ++T ++ + V  GIV
Sbjct: 392 EVLSELAPYVSLAEKLGRLAVQLVAGESGIKGVKVVYTSARDPDDLDTRLVRAMVTKGIV 451

Query: 176 R-VWRVGANIISAPIIIKENAI 196
             V     N+++A    K+  +
Sbjct: 452 EPVSSTFVNLVNADYTAKQRGL 473


>gi|60594357|pdb|1YGY|A Chain A, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase
           From Mycobacterium Tuberculosis
 gi|60594358|pdb|1YGY|B Chain B, Crystal Structure Of D-3-Phosphoglycerate Dehydrogenase
           From Mycobacterium Tuberculosis
 gi|313507314|pdb|3DC2|A Chain A, Crystal Structure Of Serine Bound D-3-Phosphoglycerate
           Dehydrogenase From Mycobacterium Tuberculosis
 gi|313507315|pdb|3DC2|B Chain B, Crystal Structure Of Serine Bound D-3-Phosphoglycerate
           Dehydrogenase From Mycobacterium Tuberculosis
          Length = 529

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 108/209 (51%), Gaps = 7/209 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ +  GHV  AG DVF  
Sbjct: 202 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFAT 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+   +++
Sbjct: 262 EPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGVVN 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    V P++ L   LG   G L  E    + +   G  A     VL  + L G+   V
Sbjct: 322 EE----VAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEEVEVLRLSALRGLFSAV 377

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
                  ++AP +  E  +     K  +S
Sbjct: 378 IEDAVTFVNAPALAAERGVTAEICKASES 406


>gi|308375950|ref|ZP_07445640.2| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu007]
 gi|308344687|gb|EFP33538.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu007]
          Length = 526

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 108/209 (51%), Gaps = 7/209 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ +  GHV  AG DVF  
Sbjct: 199 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFAT 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+   +++
Sbjct: 259 EPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGVVN 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    V P++ L   LG   G L  E    + +   G  A     VL  + L G+   V
Sbjct: 319 EE----VAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEEVEVLRLSALRGLFSAV 374

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
                  ++AP +  E  +     K  +S
Sbjct: 375 IEDAVTFVNAPALAAERGVTAEICKASES 403


>gi|225849892|ref|YP_002730126.1| D-3-phosphoglycerate dehydrogenase [Persephonella marina EX-H1]
 gi|225646129|gb|ACO04315.1| phosphoglycerate dehydrogenase [Persephonella marina EX-H1]
          Length = 529

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 110/199 (55%), Gaps = 4/199 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT +T+ ++ ++     K GV  INCARGG+VDE+A+ + ++ G  A  G DV+  
Sbjct: 202 LHCPLTEETRGMIGRKEFEMMKDGVYFINCARGGIVDEDAMYDFMKKGKFAGIGLDVYGK 261

Query: 61  EPALQ--NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP       +F  PN+  +P++GA+T ESQ+KVAI++A Q+   L    V  A+N     
Sbjct: 262 EPPDDRIRRIFEFPNISLSPHIGANTYESQDKVAIKIAKQVIAALKGQFVEAAVNAPFTV 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    +K ++ LA+ LG F+ Q    + +E+ +   GS A  +   + + VL G +  +
Sbjct: 322 TEGFENIKAYLLLAERLGSFLTQYAGGNFRELHVEVRGSIA-EHVKPIVAYVLKGFLSPI 380

Query: 178 WRVGANIISAPIIIKENAI 196
                NII+AP + KE  I
Sbjct: 381 LDRPVNIINAPFLAKERGI 399


>gi|15842552|ref|NP_337589.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           CDC1551]
 gi|31794172|ref|NP_856665.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium bovis AF2122/97]
 gi|57117042|ref|YP_177916.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           H37Rv]
 gi|121638877|ref|YP_979101.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|148662846|ref|YP_001284369.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           H37Ra]
 gi|148824186|ref|YP_001288940.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis F11]
 gi|167967839|ref|ZP_02550116.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis H37Ra]
 gi|215404980|ref|ZP_03417161.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           02_1987]
 gi|215428447|ref|ZP_03426366.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T92]
 gi|215431947|ref|ZP_03429866.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           EAS054]
 gi|224991369|ref|YP_002646058.1| putative D-3-phosphoglycerate dehydrogenase [Mycobacterium bovis
           BCG str. Tokyo 172]
 gi|253797911|ref|YP_003030912.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 1435]
 gi|254233079|ref|ZP_04926406.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis C]
 gi|254552073|ref|ZP_05142520.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260188020|ref|ZP_05765494.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           CPHL_A]
 gi|260202137|ref|ZP_05769628.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T46]
 gi|260206320|ref|ZP_05773811.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis K85]
 gi|289444561|ref|ZP_06434305.1| phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T46]
 gi|289448668|ref|ZP_06438412.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis CPHL_A]
 gi|289553214|ref|ZP_06442424.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 605]
 gi|289575703|ref|ZP_06455930.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis K85]
 gi|289746800|ref|ZP_06506178.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis 02_1987]
 gi|289751673|ref|ZP_06511051.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T92]
 gi|289755114|ref|ZP_06514492.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis EAS054]
 gi|294993916|ref|ZP_06799607.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis 210]
 gi|297635621|ref|ZP_06953401.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis KZN
           4207]
 gi|297732619|ref|ZP_06961737.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis KZN
           R506]
 gi|306777289|ref|ZP_07415626.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu001]
 gi|306781200|ref|ZP_07419537.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu002]
 gi|306785839|ref|ZP_07424161.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu003]
 gi|306789879|ref|ZP_07428201.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu004]
 gi|306794690|ref|ZP_07432992.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu005]
 gi|306798933|ref|ZP_07437235.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu006]
 gi|306804778|ref|ZP_07441446.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu008]
 gi|306969070|ref|ZP_07481731.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu009]
 gi|306973407|ref|ZP_07486068.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu010]
 gi|307081115|ref|ZP_07490285.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu011]
 gi|307085720|ref|ZP_07494833.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu012]
 gi|313659951|ref|ZP_07816831.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis KZN
           V2475]
 gi|61242571|sp|P0A544|SERA_MYCTU RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|61242577|sp|P0A545|SERA_MYCBO RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|13882863|gb|AAK47403.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           CDC1551]
 gi|31619767|emb|CAD96707.1| PROBABLE D-3-PHOSPHOGLYCERATE DEHYDROGENASE SERA1 (PGDH)
           [Mycobacterium bovis AF2122/97]
 gi|41352771|emb|CAE55535.1| PROBABLE D-3-PHOSPHOGLYCERATE DEHYDROGENASE SERA1 (PGDH)
           [Mycobacterium tuberculosis H37Rv]
 gi|121494525|emb|CAL73006.1| Probable D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           bovis BCG str. Pasteur 1173P2]
 gi|124602138|gb|EAY61148.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis C]
 gi|148506998|gb|ABQ74807.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           H37Ra]
 gi|148722713|gb|ABR07338.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis F11]
 gi|224774484|dbj|BAH27290.1| putative D-3-phosphoglycerate dehydrogenase [Mycobacterium bovis
           BCG str. Tokyo 172]
 gi|253319414|gb|ACT24017.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 1435]
 gi|289417480|gb|EFD14720.1| phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T46]
 gi|289421626|gb|EFD18827.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis CPHL_A]
 gi|289437846|gb|EFD20339.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 605]
 gi|289540134|gb|EFD44712.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis K85]
 gi|289687328|gb|EFD54816.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis 02_1987]
 gi|289692260|gb|EFD59689.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T92]
 gi|289695701|gb|EFD63130.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis EAS054]
 gi|308214339|gb|EFO73738.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu001]
 gi|308325983|gb|EFP14834.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu002]
 gi|308329514|gb|EFP18365.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu003]
 gi|308333653|gb|EFP22504.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu004]
 gi|308337010|gb|EFP25861.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu005]
 gi|308340824|gb|EFP29675.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu006]
 gi|308348637|gb|EFP37488.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu008]
 gi|308353362|gb|EFP42213.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu009]
 gi|308357207|gb|EFP46058.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu010]
 gi|308361161|gb|EFP50012.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu011]
 gi|308364754|gb|EFP53605.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis SUMu012]
 gi|323718375|gb|EGB27549.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis CDC1551A]
 gi|326904610|gb|EGE51543.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis W-148]
 gi|328457686|gb|AEB03109.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis KZN 4207]
          Length = 528

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 108/209 (51%), Gaps = 7/209 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ +  GHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+   +++
Sbjct: 261 EPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGVVN 320

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    V P++ L   LG   G L  E    + +   G  A     VL  + L G+   V
Sbjct: 321 EE----VAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEEVEVLRLSALRGLFSAV 376

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
                  ++AP +  E  +     K  +S
Sbjct: 377 IEDAVTFVNAPALAAERGVTAEICKASES 405


>gi|194368789|pdb|3DDN|A Chain A, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound
           D- 3-Phosphoglycerate Dehydrogenase In Mycobacterium
           Tuberculosis
 gi|194368790|pdb|3DDN|B Chain B, Crystal Structure Of Hydroxypyruvic Acid Phosphate Bound
           D- 3-Phosphoglycerate Dehydrogenase In Mycobacterium
           Tuberculosis
          Length = 528

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 108/209 (51%), Gaps = 7/209 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ +  GHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+   +++
Sbjct: 261 EPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGVVN 320

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    V P++ L   LG   G L  E    + +   G  A     VL  + L G+   V
Sbjct: 321 EE----VAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEEVEVLRLSALRGLFSAV 376

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
                  ++AP +  E  +     K  +S
Sbjct: 377 IEDAVTFVNAPALAAERGVTAEICKASES 405


>gi|219559028|ref|ZP_03538104.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis T17]
 gi|289571195|ref|ZP_06451422.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T17]
 gi|289544949|gb|EFD48597.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis T17]
          Length = 528

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 108/209 (51%), Gaps = 7/209 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ +  GHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+   +++
Sbjct: 261 EPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGVVN 320

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    V P++ L   LG   G L  E    + +   G  A     VL  + L G+   V
Sbjct: 321 EE----VAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEEVEVLRLSALRGLFSAV 376

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
                  ++AP +  E  +     K  +S
Sbjct: 377 IEDAVTFVNAPALAAERGVTAEICKASES 405


>gi|38233698|ref|NP_939465.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium diphtheriae
           NCTC 13129]
 gi|38199959|emb|CAE49627.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium diphtheriae]
          Length = 531

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 111/207 (53%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + N E L+K+K G  IIN ARGGLVDE ALA+ + +G +  AGFDVF  
Sbjct: 204 IHLPKTAETAGMFNAELLAKSKQGQIIINAARGGLVDEQALADAIDAGRIRGAGFDVFAT 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF  P V   P+LGASTVE+Q++    +A  +   L    V +A+N++     
Sbjct: 264 EPCTDSPLFNRPEVVVTPHLGASTVEAQDRAGTDVAASVLKALAGEFVPDAVNVSGGRVG 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW-R 179
           E   V  ++ LA  LG   G+L+ ++   +++   G  +  N  VL  + L G+   +  
Sbjct: 324 EE--VALWLDLARKLGVVAGKLLDKAPVAVEVEARGELSTENIDVLGLSALRGVFSSFIE 381

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
                ++AP I +E  + L      +S
Sbjct: 382 EPVTFVNAPRIAEERGVKLDVTTASES 408


>gi|50751002|ref|XP_422226.1| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 525

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 106/204 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    +K + GV ++NCARGG+VDE AL   L+SG    A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDSTFAKCRRGVQVVNCARGGIVDEGALLRALRSGQCGGAALDVFTQ 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L   PNV C P+LGAST E+Q +   ++A Q+ D      +   +N   +S  
Sbjct: 265 EPPKDRDLVDHPNVICCPHLGASTREAQSRCGKEIAMQIVDMATGKGLVGVVNGQALSKA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            AP  KP++ LA  LG  +  L  ++   +Q+   G+     +  L  AV++G++   + 
Sbjct: 325 FAPQTKPWIALAKALGTVLHGLAKQATGNVQVCTLGAPLKDASSYLAPAVVSGMLARGKK 384

Query: 181 GANIISAPIIIKENAIILSTIKRD 204
            A +++A ++ +E  + ++    D
Sbjct: 385 EATLVNAMLLAQEAGLKVTATHGD 408


>gi|327321766|gb|AEA48241.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium glutamicum]
          Length = 530

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/200 (34%), Positives = 110/200 (55%), Gaps = 3/200 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + + + L+K+K G  IIN ARGGLVDE ALA+ ++SGH+  AGFDV+  
Sbjct: 204 IHLPKTKETAGMFDAQLLAKSKKGQIIINAARGGLVDEQALADAIESGHIRGAGFDVYST 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V++A+N++     
Sbjct: 264 EPCTDSPLFKLPQVVVTPHLGASTEEAQDRAGTDVADSVLKALAGEFVADAVNVSGGRVG 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V  +M LA  LG   G+L+  +   I++   G  +      L  + + G+   +  
Sbjct: 324 EE--VAVWMDLARKLGLLAGKLVDAAPVSIEVEARGELSSEQVDALGLSAVRGLFSGIIE 381

Query: 180 VGANIISAPIIIKENAIILS 199
                ++AP I +E  + +S
Sbjct: 382 ESVTFVNAPRIAEERGLDIS 401


>gi|19552504|ref|NP_600506.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium glutamicum ATCC
           13032]
 gi|62390170|ref|YP_225572.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium glutamicum ATCC
           13032]
 gi|145295425|ref|YP_001138246.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium glutamicum R]
 gi|21324052|dbj|BAB98677.1| Phosphoglycerate dehydrogenase and related dehydrogenases or
           D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glutamicum ATCC 13032]
 gi|41325506|emb|CAF19986.1| Phosphoglycerate Dehydrogenase [Corynebacterium glutamicum ATCC
           13032]
 gi|140845345|dbj|BAF54344.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 530

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/200 (34%), Positives = 110/200 (55%), Gaps = 3/200 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + + + L+K+K G  IIN ARGGLVDE ALA+ ++SGH+  AGFDV+  
Sbjct: 204 IHLPKTKETAGMFDAQLLAKSKKGQIIINAARGGLVDEQALADAIESGHIRGAGFDVYST 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V++A+N++     
Sbjct: 264 EPCTDSPLFKLPQVVVTPHLGASTEEAQDRAGTDVADSVLKALAGEFVADAVNVSGGRVG 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V  +M LA  LG   G+L+  +   I++   G  +      L  + + G+   +  
Sbjct: 324 EE--VAVWMDLARKLGLLAGKLVDAAPVSIEVEARGELSSEQVDALGLSAVRGLFSGIIE 381

Query: 180 VGANIISAPIIIKENAIILS 199
                ++AP I +E  + +S
Sbjct: 382 ESVTFVNAPRIAEERGLDIS 401


>gi|255568067|ref|XP_002525010.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223535718|gb|EEF37382.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 633

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 116/202 (57%), Gaps = 6/202 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T+NI N +  SK K+GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 290 LHMPLTPATQNIFNDDTFSKMKNGVRIINVARGGVIDEDALVRALDSGKVAQAALDVFSE 349

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L    NV   P+LGAST E+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 350 EPPSRDGKLVQHKNVTATPHLGASTKEAQEGVAIEIAEAVIGALEGELSATAVNAPMVPA 409

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL++    I+ ++++Y  +     ++T +L + +  GI+
Sbjct: 410 EVLSELAPYVILAEKLGRLAVQLVAGGSGIKSVKVLYKSARDPDDLDTRLLRAMITKGII 469

Query: 176 RVWRVG-ANIISAPIIIKENAI 196
                   N+++A  I KE  +
Sbjct: 470 EPISTSIINLVNADFIAKEKGL 491


>gi|41409131|ref|NP_961967.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41397951|gb|AAS05581.1| SerA [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 528

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 108/204 (52%), Gaps = 17/204 (8%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++K+ L+KTK GV I+N ARGGLVDE ALA+ ++SGHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLIDKDALAKTKPGVIIVNAARGGLVDEAALADAVRSGHVRAAGLDVFSK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V +A+N+A  +  
Sbjct: 261 EPCTDSPLFELPQVVVTPHLGASTTEAQDRAGTDVAASVKLALAGEFVPDAVNVAGGTVN 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLN--------SAVLA 172
           E   V P++ L   LG     L       + +   G  A  +  VL         SAV+ 
Sbjct: 321 EE--VAPWLDLVRKLGLLAATLSDGPPVSLSVQVRGELASEDVEVLKLSALRVLFSAVVE 378

Query: 173 GIVRVWRVGANIISAPIIIKENAI 196
           G V         ++AP + +E  +
Sbjct: 379 GPV-------TFVNAPALAEERGV 395


>gi|308081353|ref|NP_001183055.1| hypothetical protein LOC100501398 [Zea mays]
 gi|238009062|gb|ACR35566.1| unknown [Zea mays]
          Length = 598

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  +LN E  +K K GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 255 LHMPLTPATNKMLNDEAFAKMKYGVRIINVARGGVIDEDALVRALDSGIVAQAALDVFTK 314

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  N L    NV   P+LGASTVE+QE VAI++A  +   L   + ++A+N  ++  
Sbjct: 315 EPPAPDNKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVIGALKGELAASAVNAPMVPA 374

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + PF+ LA+ LG    QL++    I+ +++ Y  + A   ++T +L + +  G++
Sbjct: 375 EVLSELAPFVVLAEKLGHLAVQLVAGGGGIKSVKVTYASARAPDDLDTRLLRAMITKGLI 434

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + ++
Sbjct: 435 EPISSVFVNLVNADFTAKQRGVRIT 459


>gi|242074584|ref|XP_002447228.1| hypothetical protein SORBIDRAFT_06g030920 [Sorghum bicolor]
 gi|241938411|gb|EES11556.1| hypothetical protein SORBIDRAFT_06g030920 [Sorghum bicolor]
          Length = 620

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 118/205 (57%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  +LN E  +K K GV IIN ARGG++DE AL   L SG VA+A  DVF  
Sbjct: 277 LHMPLTPATNKMLNDEAFAKMKKGVRIINVARGGVIDEEALVRALDSGIVAQAALDVFTK 336

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  N L    NV   P+LGASTVE+QE VAI++A  +   L   + ++A+N  ++  
Sbjct: 337 EPPAPDNKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVIGALKGELAASAVNAPMVPA 396

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + PF+ LA+ LG    QL++    I+ +++ Y  + A   ++T +L + +  G++
Sbjct: 397 EVLSELAPFVVLAEKLGRLAVQLVAGGGGIKSVKVTYASARAPDDLDTRLLRAMITKGLI 456

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + ++
Sbjct: 457 EPISSVFVNLVNADFTAKQRGVRIT 481


>gi|21536501|gb|AAM60833.1| Phosphoglycerate dehydrogenase-like protein [Arabidopsis thaliana]
          Length = 603

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 117/205 (57%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  ILN E  +  K GV I+N ARGG++DE+AL   L +G VA+A  DVF  
Sbjct: 260 LHMPLTPTTSKILNDETFANMKKGVRIVNVARGGVIDEDALVRALDAGIVAQAALDVFTK 319

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  + L     V   P+LGAST+E+QE VAI++A  +   L   + + A+N  ++S 
Sbjct: 320 EPPAKDSKLVQHERVTVTPHLGASTMEAQEGVAIKIAEAVVGALNGELAATAVNAPMVSA 379

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +KP++ LA+ LG    QL++    ++  +I Y  + A   ++T +L + +  GI+
Sbjct: 380 EVLTELKPYVVLAEKLGRLAVQLVAGGSGVKNAKITYASARATDDLDTRLLRAMITKGII 439

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + LS
Sbjct: 440 EPISDVYVNLVNADFTAKQRGLRLS 464


>gi|218754755|ref|ZP_03533551.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis GM
           1503]
 gi|289763176|ref|ZP_06522554.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis GM 1503]
 gi|289710682|gb|EFD74698.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis GM 1503]
          Length = 438

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 108/209 (51%), Gaps = 7/209 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ +  GHV  AG DVF  
Sbjct: 111 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFAT 170

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+   +++
Sbjct: 171 EPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGVVN 230

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    V P++ L   LG   G L  E    + +   G  A     VL  + L G+   V
Sbjct: 231 EE----VAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEEVEVLRLSALRGLFSAV 286

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
                  ++AP +  E  +     K  +S
Sbjct: 287 IEDAVTFVNAPALAAERGVTAEICKASES 315


>gi|332178487|gb|AEE14176.1| D-3-phosphoglycerate dehydrogenase [Thermodesulfobium narugense DSM
           14796]
          Length = 528

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 104/174 (59%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVP T +T ++++KE ++  K G  IIN ARGG+VDE A+A+ L+SGH+A A  DVFE 
Sbjct: 201 IHVPKTKETYHLVSKERINLMKKGSYIINAARGGVVDEVAVADALKSGHLAGAASDVFET 260

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP +  NP   + N    P++GA+T E+Q  V + +  Q+  +    +   A+N+     
Sbjct: 261 EPISADNPYISIKNTVLTPHIGAATKEAQVNVILDVVDQIIAFFDGRIPHGAVNLPAFRG 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
               L+ P++ LA+ LG FI  L+SE + +I+I+Y G  A  N   ++ +VL G
Sbjct: 321 VSDDLL-PWIDLAERLGKFIKDLVSERVNKIEIVYYGDIAKKNVNSVSISVLKG 373


>gi|224034059|gb|ACN36105.1| unknown [Zea mays]
          Length = 612

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  +LN E  +K K GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 269 LHMPLTPATNKMLNDEAFAKMKYGVRIINVARGGVIDEDALVRALDSGIVAQAALDVFTK 328

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  N L    NV   P+LGASTVE+QE VAI++A  +   L   + ++A+N  ++  
Sbjct: 329 EPPAPDNKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVIGALKGELAASAVNAPMVPA 388

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + PF+ LA+ LG    QL++    I+ +++ Y  + A   ++T +L + +  G++
Sbjct: 389 EVLSELAPFVVLAEKLGHLAVQLVAGGGGIKSVKVTYASARAPDDLDTRLLRAMITKGLI 448

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + ++
Sbjct: 449 EPISSVFVNLVNADFTAKQRGVRIT 473


>gi|117927917|ref|YP_872468.1| D-3-phosphoglycerate dehydrogenase [Acidothermus cellulolyticus
           11B]
 gi|117648380|gb|ABK52482.1| D-3-phosphoglycerate dehydrogenase [Acidothermus cellulolyticus
           11B]
          Length = 530

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 110/210 (52%), Gaps = 9/210 (4%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  IL +  L+  K GV IIN ARGGLVDE+ALA  L+ G V   G DVF  
Sbjct: 201 VHLPKTPETVGILGERELAMVKPGVIIINAARGGLVDEDALAIALKEGRVGGVGLDVFAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF  PNV   P+LGAST E+QEK    +A  +   L    V +A+N+     +
Sbjct: 261 EPTTASPLFEFPNVVVTPHLGASTHEAQEKAGTAVAKSVRLALKGEFVPDAVNV-----Q 315

Query: 121 EAPL---VKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VR 176
             P+   V+P + LA+ LG     L       I++   G  A  +  VL  AVL G+ + 
Sbjct: 316 GGPIAEDVRPGLPLAEKLGRVFTALAGGLASRIEVEVRGEIAQYDVKVLQLAVLKGVFMD 375

Query: 177 VWRVGANIISAPIIIKENAIILSTIKRDKS 206
           +       ++AP+  ++  +  + +  D+S
Sbjct: 376 IVEKTVTYVNAPLFAQDRGVEATLVTEDES 405


>gi|298526466|ref|ZP_07013875.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           94_M4241A]
 gi|298496260|gb|EFI31554.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium tuberculosis
           94_M4241A]
          Length = 424

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 108/209 (51%), Gaps = 7/209 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ +  GHV  AG DVF  
Sbjct: 97  VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFAT 156

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+   +++
Sbjct: 157 EPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGVVN 216

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    V P++ L   LG   G L  E    + +   G  A     VL  + L G+   V
Sbjct: 217 EE----VAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEEVEVLRLSALRGLFSAV 272

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
                  ++AP +  E  +     K  +S
Sbjct: 273 IEDAVTFVNAPALAAERGVTAEICKASES 301


>gi|289550521|ref|YP_003471425.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus lugdunensis
           HKU09-01]
 gi|289180053|gb|ADC87298.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus lugdunensis
           HKU09-01]
          Length = 539

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 117/209 (55%), Gaps = 2/209 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KTK ++ K+  +K KS + +IN ARGG++DE AL E +    +A+A  DVFE 
Sbjct: 202 VHTPLTEKTKGMIGKDFFNKAKSTLQVINVARGGIIDEAALFEAIDKKQIAKAAIDVFEE 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL    ++   P+LGAST+E+Q KVAI ++ ++ DY   G++ +A+N   + F 
Sbjct: 262 EPPTNSPLISHDDIIVTPHLGASTIEAQTKVAISVSEELVDYFEQGLIKHAINAPTLDFS 321

Query: 121 E-APLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNT-MVLNSAVLAGIVRVW 178
             +   + F+ +++       QL   + ++I+I   G     +  ++L S++   +   +
Sbjct: 322 NISNTAREFIKVSEIAAELAVQLFDHAPEDIKITVSGEIVEPHADLILRSSITQLLKPHF 381

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKSG 207
              AN+I+A +++KE  I      R  +G
Sbjct: 382 GHRANLINALVLLKEQEINYQVETRTSAG 410


>gi|300087849|ref|YP_003758371.1| D-3-phosphoglycerate dehydrogenase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527582|gb|ADJ26050.1| D-3-phosphoglycerate dehydrogenase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 526

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 107/203 (52%), Gaps = 1/203 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT +T+N++  + L+  K    IIN ARGGL+DE AL   + +  +A A  DVF  
Sbjct: 201 LHVPLTAQTRNMIGAKQLAMMKPTTRIINAARGGLIDEEALVAAINNNRLAGAAIDVFVK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++ LF +P +   P+LGAST E+Q+     +  Q+ D         A+N   I  E
Sbjct: 261 EPCTESILFDVPRIIVTPHLGASTAEAQDMATADVVDQVIDVFAGRPARYAVNAPYIPAE 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
             P++ P++ +A  LG  + Q+     + + I Y G  +   T  L + +L GI+ +V  
Sbjct: 321 SLPVISPYVKVAKMLGRLLQQMSEGQFKSLNIKYSGEISGYETRALKATILGGILEQVSE 380

Query: 180 VGANIISAPIIIKENAIILSTIK 202
              N+++A I+  +  I +S  K
Sbjct: 381 ERVNVVNADIVASKRGICVSEQK 403


>gi|33863698|ref|NP_895258.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9313]
 gi|33635281|emb|CAE21606.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9313]
          Length = 532

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 105/177 (59%), Gaps = 2/177 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N E L K KS   ++NCARGG++DE+ALA+ L +G +  A  DV+  
Sbjct: 203 LHLPRTPDTENLVNAELLGKMKSTARLVNCARGGIIDESALADALTAGVIGGAALDVYAQ 262

Query: 61  EP-ALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP A  +PL  +   +   P+LGAST E+QE VA+ +A Q+ D L+     +A+N+  +S
Sbjct: 263 EPLATDSPLRSVQERLILTPHLGASTTEAQENVAVDVAEQIRDVLLGLPARSAVNIPGLS 322

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            E    +KP + LA+ LG  + QL    +QE+++   G  A   +  L  A L G++
Sbjct: 323 AEIMERLKPHLQLAETLGLLVSQLSGGQLQELEVRLQGEFAQHPSQPLVIAALKGVL 379


>gi|70726201|ref|YP_253115.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus haemolyticus
           JCSC1435]
 gi|68446925|dbj|BAE04509.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus haemolyticus
           JCSC1435]
          Length = 532

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 121/206 (58%), Gaps = 4/206 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KT+ I+N +  SK K  + IIN ARGG+++E+ L   L +  +A A  DVFE 
Sbjct: 202 VHTPLTPKTRGIVNADFFSKAKPTLQIINVARGGIINEDDLLNALNNNQIARAALDVFEH 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL     +   P+LGAST+E+QEKVA+ ++ ++ D L +G V++A+N   ISF 
Sbjct: 262 EPPTDSPLIEHDKIIVTPHLGASTIEAQEKVAVSVSEEIIDILENGNVTHAVNAPKISFN 321

Query: 121 E-APLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           +   + + ++ + +  G    QLI  + +EI++ ++G  A   T ++  +++  I++   
Sbjct: 322 DIDEITQQWIEIGELSGELAIQLIEGAPREIKVTFNGDVAKQETDLITRSIVKQILQ-QD 380

Query: 180 VG--ANIISAPIIIKENAIILSTIKR 203
           +G   NII+A  ++ E  +  +  KR
Sbjct: 381 LGDRVNIINAFALLNEQGVTRNVEKR 406


>gi|310778370|ref|YP_003966703.1| D-3-phosphoglycerate dehydrogenase [Ilyobacter polytropus DSM 2926]
 gi|309747693|gb|ADO82355.1| D-3-phosphoglycerate dehydrogenase [Ilyobacter polytropus DSM 2926]
          Length = 530

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 118/196 (60%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T ++++ + + K K  V ++N ARG +V+E+AL + L+ G +  AG DV  V
Sbjct: 202 IHTPRTEETIDMISFDEIDKMKDNVILVNVARGKIVNEDALYQGLKGGKIRGAGIDVHAV 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PL+   N    P++GA+T E+QE V I +A Q+S+ L   +V  A+N+ ++  E
Sbjct: 262 EPRYESPLYEFDNFIPTPHIGANTSEAQENVGIAIAQQVSNGLNGEIVETAVNLPVMERE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               VKP++ L ++LG    QL +ES++ ++I Y G  + ++T + + A   G+++ +  
Sbjct: 322 GLKDVKPYIELMENLGKIYYQLYTESVKFVEINYWGDVSNLDTQMADLAFTKGLLQPILG 381

Query: 180 VGANIISAPIIIKENA 195
              N ++A  I+ ENA
Sbjct: 382 NSVNYVNAK-IMAENA 396


>gi|15827900|ref|NP_302163.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium leprae TN]
 gi|221230377|ref|YP_002503793.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium leprae Br4923]
 gi|3122862|sp|O33116|SERA_MYCLE RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|2414551|emb|CAB16440.1| phosphoglycerate dehydrogenase [Mycobacterium leprae]
 gi|13093453|emb|CAC30645.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium leprae]
 gi|219933484|emb|CAR71787.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium leprae Br4923]
          Length = 528

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 108/199 (54%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ ++SGHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEVALADAVRSGHVRAAGLDVFAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+   +++
Sbjct: 261 EPCTDSPLFELSQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVDGGVVN 320

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    V P++ L   LG  +  L  E    + +   G  A  +  +L  + L G+   V
Sbjct: 321 EE----VAPWLDLVCKLGVLVAALSDELPASLSVHVRGELASEDVEILRLSALRGLFSTV 376

Query: 178 WRVGANIISAPIIIKENAI 196
                  ++AP +  E  +
Sbjct: 377 IEDAVTFVNAPALAAERGV 395


>gi|254365629|ref|ZP_04981674.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis str. Haarlem]
 gi|134151142|gb|EBA43187.1| D-3-phosphoglycerate dehydrogenase serA1 [Mycobacterium
           tuberculosis str. Haarlem]
          Length = 528

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 107/209 (51%), Gaps = 7/209 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ +  GHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+   +++
Sbjct: 261 EPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGVVN 320

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    V P++ L   LG   G L  E    + +   G  A     VL  + L G+   V
Sbjct: 321 EE----VAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEEVEVLRLSALRGLFSAV 376

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
                  ++AP    E  +     K  +S
Sbjct: 377 IEDAVTFVNAPAFAAERGVTAEICKASES 405


>gi|313125075|ref|YP_004035339.1| d-3-phosphoglycerate dehydrogenase [Halogeometricum borinquense DSM
           11551]
 gi|312291440|gb|ADQ65900.1| D-3-phosphoglycerate dehydrogenase [Halogeometricum borinquense DSM
           11551]
          Length = 534

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 114/205 (55%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+++++ E L     G  ++NCARGG+VDE+ALA  ++ G +  A  DVF  
Sbjct: 203 VHTPLTPETEDLISTEELELMGGG-YLVNCARGGVVDEDALAAAVEDGTLDGAAIDVFAD 261

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP +  NPL  + +V   P+LGAST  +QE VA  +A Q+        V NALN   +  
Sbjct: 262 EPVSPDNPLLDVDDVVVTPHLGASTEAAQENVATSIADQIDAAFNGEPVMNALNAPSVDK 321

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--V 177
              P ++P++ LA+  G    QL+   I  +++ Y+G  A  +  ++ ++ L G+     
Sbjct: 322 SAFPRIRPYIDLAETAGKVAAQLLDGRISNVEVSYEGDIAEEDIELVTASALKGVFEPLE 381

Query: 178 WRVGANIISAPIIIKENAIILSTIK 202
           W+V  N ++AP I +E  I ++  K
Sbjct: 382 WQV--NAVNAPRIAEERGIEVTESK 404


>gi|225849496|ref|YP_002729661.1| D-3-phosphoglycerate dehydrogenase [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643873|gb|ACN98923.1| phosphoglycerate dehydrogenase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 529

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 104/198 (52%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT +T+N++ K+     K GV  INCARGG+VDE+AL E ++ G +A  G DVF  
Sbjct: 202 LHCPLTEETRNMIGKKEFDLMKKGVYFINCARGGIVDEDALYEAVKEGKIAGLGLDVFSK 261

Query: 61  EPALQ--NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP       LF  PN+  +P++GA+T ESQ+ VAI++A  +   L    V  A+N     
Sbjct: 262 EPPDDRIRRLFEFPNISLSPHIGANTYESQDNVAIKIAQYVIAALKGQFVEVAVNAPFTI 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
            E    +K ++ LA+ LG F+ Q       EI I   G+       ++   +   +  V 
Sbjct: 322 TEGFENIKAYLELAEKLGSFLTQYAGGHFTEINIEVRGTIRDHIEPIVAFFLKGYLSPVL 381

Query: 179 RVGANIISAPIIIKENAI 196
               NII+AP I KE  I
Sbjct: 382 DTPVNIINAPFIAKERGI 399


>gi|86821596|gb|AAI05480.1| Phosphoglycerate dehydrogenase [Bos taurus]
 gi|296489452|gb|DAA31565.1| D-3-phosphoglycerate dehydrogenase [Bos taurus]
          Length = 533

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GVC++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDSTFAQCKKGVCVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVNHENVISCPHLGASTKEAQSRCGEEIALQFVDMVKGKALAGVVNAQALASI 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
             P  KP+++LA  LG  +          IQ++  GS+   +   L  AV+ G+++    
Sbjct: 325 FCPHTKPWVSLAKALGALMQAWAGSPKGAIQVVTQGSSLKNSGSCLAPAVIIGLLKDASQ 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QSNVNLVNAMLLVKEAGLDVTT 406


>gi|196001599|ref|XP_002110667.1| hypothetical protein TRIADDRAFT_37449 [Trichoplax adhaerens]
 gi|190586618|gb|EDV26671.1| hypothetical protein TRIADDRAFT_37449 [Trichoplax adhaerens]
          Length = 520

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 107/199 (53%), Gaps = 3/199 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+ +L  E  +K K GV +INCARGG++DE AL   LQSG  A A  DVFE 
Sbjct: 203 VHTPLIPQTRGLLGDETFAKCKKGVRVINCARGGIIDEAALLRALQSGQCAGAALDVFEQ 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L   PNV    +LGASTVE+Q +VA+++A Q  D+     +  A+N   +   
Sbjct: 263 EPPQNTELVQHPNVIPVCHLGASTVEAQSRVAVEIAEQFVDFNEGKSLFGAINANAMVKA 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLIS-ESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
            +P  K  + L + LG  +  L   E+ +E+ I+  G         L +A+L+G++    
Sbjct: 323 LSPSAKSLVKLGERLGRLVEVLYGLEACKELSIVAQGPDYSEAPSFLPAAILSGVLARDA 382

Query: 180 VGA--NIISAPIIIKENAI 196
            G   N+++AP   K+  I
Sbjct: 383 SGVTLNLVNAPDFAKKKGI 401


>gi|317508269|ref|ZP_07965949.1| phosphoglycerate dehydrogenase [Segniliparus rugosus ATCC BAA-974]
 gi|316253444|gb|EFV12834.1| phosphoglycerate dehydrogenase [Segniliparus rugosus ATCC BAA-974]
          Length = 523

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 98/175 (56%), Gaps = 2/175 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++   L KTK GV I+N ARGGL+DE ALAE + SGHV  AG DVF  
Sbjct: 196 MHLPKTPETAGLIDAAALRKTKPGVIIVNAARGGLIDEQALAEAVSSGHVRAAGLDVFVQ 255

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PLFGL  V   P+LGASTVE+Q++    +A  +   L    V  A+N++     
Sbjct: 256 EPPGESPLFGLEQVVLTPHLGASTVEAQDRAGTDVAKSVKLALAGEFVPEAVNVSAGPVG 315

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
           E  L  P++ L   LG  +  L  ++   +++   G  A  +  VL  + L G +
Sbjct: 316 EEVL--PWLDLTRKLGVLLSALTEQAAVTLEVKVYGELAAESVGVLGLSTLRGFL 368


>gi|223043512|ref|ZP_03613557.1| phosphoglycerate dehydrogenase [Staphylococcus capitis SK14]
 gi|222443000|gb|EEE49100.1| phosphoglycerate dehydrogenase [Staphylococcus capitis SK14]
          Length = 531

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/210 (34%), Positives = 119/210 (56%), Gaps = 8/210 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KT+ I+ +   +K K  + IIN ARGG++DE AL   L +  +  A  DVFE 
Sbjct: 202 VHTPLTPKTRGIVGESFFNKAKPNLQIINVARGGIIDEEALIHALDNNLIDRAAIDVFEH 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EP   +PL     +   P+LGASTVE+QEKVA+ ++ ++ D L +G V +A+N   M + 
Sbjct: 262 EPPTDSPLISHDKIIVTPHLGASTVEAQEKVAVSVSEEIIDILTNGTVEHAVNAPKMDLS 321

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + +E   VK F+ L   +G F  QL+  +  EI+I + G  A  +T ++   ++  I++ 
Sbjct: 322 NVDET--VKSFVDLGTTIGEFAIQLLEGAPSEIKITFAGDLATNDTSLITRTIVTNILK- 378

Query: 178 WRVG--ANIISAPIIIKENAIILSTIKRDK 205
             +G   NII+A  ++ +  +  +  K+ K
Sbjct: 379 EDLGEEVNIINALALLNQQGVTYNIEKQKK 408


>gi|78042498|ref|NP_001030189.1| D-3-phosphoglycerate dehydrogenase [Bos taurus]
 gi|71153759|sp|Q5EAD2|SERA_BOVIN RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|59857639|gb|AAX08654.1| phosphoglycerate dehydrogenase [Bos taurus]
          Length = 533

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GVC++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDSTFAQCKKGVCVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVNHENVISCPHLGASTKEAQSRCGEEIALQFVDMVKGKALAGVVNAQALASI 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
             P  KP+++LA  LG  +          IQ++  GS+   +   L  AV+ G+++    
Sbjct: 325 FCPHTKPWVSLAKALGALMQAWAGSPKGAIQVVTQGSSLKNSGSCLAPAVIIGLLKDASQ 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QSNVNLVNAMLLVKEAGLDVTT 406


>gi|327288752|ref|XP_003229089.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Anolis
           carolinensis]
          Length = 531

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 104/206 (50%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    +K + GV +INCARGG+VDE AL   LQSG    A  DVF  
Sbjct: 210 VHTPLLPSTTGLLNDSTFAKCRPGVQVINCARGGIVDEGALLRALQSGQCGGAALDVFTE 269

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L   PNV   P+LGA+T E+Q +   ++A Q  D      +   +N   ++  
Sbjct: 270 EPPKDKDLVNHPNVISCPHLGANTREAQSRCGKEIAMQFVDLAQGKALVGTVNGQALTSA 329

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            AP  KP++ LA  LG  +  L  +    +Q++  G      +  L  AV AG+++    
Sbjct: 330 YAPQTKPWIALARALGTLLRALTHQVNGNVQVVTHGPALQKASSYLTPAVAAGLLKGTAQ 389

Query: 181 GANIISAPIIIKENAIILSTIKRDKS 206
             N+++  ++ +E  + ++T   +K+
Sbjct: 390 DVNLVNGLLLAQEAGLKITTTHNEKA 415


>gi|157165087|ref|YP_001466441.1| D-3-phosphoglycerate dehydrogenase [Campylobacter concisus 13826]
 gi|112801635|gb|EAT98979.1| phosphoglycerate dehydrogenase [Campylobacter concisus 13826]
          Length = 525

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 105/200 (52%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T +++  + ++K K GV +INCARGGL +E AL E L+SG +A AG DVF  
Sbjct: 202 IHTPKTKETTDMIGAKEIAKMKDGVRLINCARGGLYNEEALYEGLKSGKIAFAGIDVFTK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL  L NV   P+LGA+T+ESQ  +A++   Q           NALN+ I + +
Sbjct: 262 EPATSHPLLDLNNVSVTPHLGANTLESQRNIAVEAVEQAILAARGISYPNALNLPIKTED 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V+P++ L   +     Q+   +I+ I+I   G        +L  A++  +      
Sbjct: 322 LPPFVEPYIDLTSKMAFLAAQINKSAIKAIRIETHGQIGEYANSMLTFAIVGALKESLGD 381

Query: 181 GANIISAPIIIKENAIILST 200
             N ++A  +  E  I   T
Sbjct: 382 AINYVNAKFLCDEKGITTET 401


>gi|242374013|ref|ZP_04819587.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W1]
 gi|242348264|gb|EES39866.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W1]
          Length = 531

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/210 (33%), Positives = 120/210 (57%), Gaps = 8/210 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KT+ I+ +    K K  + IIN ARGG++DE+AL   L +G +  A  DVFE 
Sbjct: 202 VHTPLTPKTRGIIGEAFFKKAKPNLQIINVARGGIIDEDALVNALNNGLIDRAAIDVFEH 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EP   +PL     +   P+LGASTVE+QEKVA+ ++ ++ D L  G V +A+N   M + 
Sbjct: 262 EPPTDSPLIEHDKIIVTPHLGASTVEAQEKVAVSVSKEIVDILTKGTVEHAVNAPKMDLS 321

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
             +EA  ++ ++ L+  +G F  QL+  +  EI+I Y G     +T ++   +++ +++ 
Sbjct: 322 HVDEA--IQSYVDLSTTIGEFGIQLLEGAPSEIKITYAGDLTTSDTSLITRTIVSSVLK- 378

Query: 178 WRVG--ANIISAPIIIKENAIILSTIKRDK 205
             +G   NII+A  ++ +  +  +  K+ K
Sbjct: 379 EDLGDQVNIINALALLNQQGVTYNIEKQKK 408


>gi|226498082|ref|NP_001147127.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
 gi|195607486|gb|ACG25573.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 612

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  +LN E  +K K GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 269 LHMPLTPATNKMLNDEAFAKMKYGVRIINVARGGVIDEDALVRALDSGIVAQAALDVFTK 328

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  N L    NV   P+LGASTVE+QE VAI++A  +   L   + ++A+N  ++  
Sbjct: 329 EPPAPDNKLVLHVNVTVTPHLGASTVEAQEGVAIEIAEAVIGALKGELAASAVNAPMVPA 388

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + PF+ LA+ LG    QL++    I+ +++ Y  + A   ++T +L + +  G++
Sbjct: 389 EVLSELAPFVVLAEKLGHLAVQLVAGGGGIKSVKVTYASARAPDDLDTRLLRAMITKGLI 448

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + ++
Sbjct: 449 EPISSVFVNLVNADFTAKQRGVRIT 473


>gi|254819120|ref|ZP_05224121.1| D-3-phosphoglycerate dehydrogenase [Mycobacterium intracellulare
           ATCC 13950]
          Length = 528

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 107/199 (53%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ K+ L+KTK GV I+N ARGGLVDE ALA+ ++SGHV  AG DVF  
Sbjct: 201 VHLPKTPETAGLIGKDALAKTKPGVVIVNAARGGLVDEAALADAVRSGHVRAAGLDVFSK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V +A+N+   +++
Sbjct: 261 EPCTDSPLFELPQVVVTPHLGASTEEAQDRAGTDVAASVKLALAGEFVPDAVNVGGGVVN 320

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
            E    V P++ L   LG     L       + +   G  A  +  VL  + L G+    
Sbjct: 321 EE----VAPWLDLVRKLGVLAATLSDGPPVSLSVQVRGELASEDVEVLKLSALRGLFSAV 376

Query: 179 RVGA-NIISAPIIIKENAI 196
             G    ++AP + +E  I
Sbjct: 377 VEGPVTFVNAPALAEERGI 395


>gi|315586946|gb|ADU41327.1| possible phosphoglycerate dehydrogenase [Helicobacter pylori 35A]
          Length = 524

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGTKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLKGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++  A++  +  V   
Sbjct: 322 TS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFALVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|311740551|ref|ZP_07714378.1| phosphoglycerate dehydrogenase [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311304071|gb|EFQ80147.1| phosphoglycerate dehydrogenase [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 528

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 103/174 (59%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T++T  + ++E L+K K G  +IN ARGGLVDE ALAE ++SGH   AGFDV+  
Sbjct: 201 IHLPKTSETAGMFDRELLAKAKQGQILINAARGGLVDEAALAESIESGHHRGAGFDVYAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V  +P+LGASTVE+Q++    +A  +   L    V +A+N++     
Sbjct: 261 EPCTDSPLFKLPQVTVSPHLGASTVEAQDRAGTDVAESVLKALEGEFVPDAVNVSGGPVR 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V  ++ LA  LG   G+L+ ++   +++   G  +  +  VL  + + G+
Sbjct: 321 EE--VAGWLDLARKLGLTAGRLLGQAPVAVEVEACGELSTEDVEVLGLSAVRGL 372


>gi|296090450|emb|CBI40269.3| unnamed protein product [Vitis vinifera]
          Length = 432

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 118/205 (57%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  +LN E  +K K GV IIN ARGG++DE AL   L +G VA+A  DVF  
Sbjct: 89  LHMPLTPATSKMLNDETFAKMKKGVRIINVARGGVIDEEALVRALDAGIVAQAALDVFTE 148

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++    L  NV   P+LGAST+E+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 149 EPPPKDSKLILHENVTVTPHLGASTMEAQEGVAIEIAEAVVGALKGELAATAVNAPMVPA 208

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +KPF+ LA+ LG    QL+S    ++ +++ Y  + A   ++T +L + +  G++
Sbjct: 209 EVLSELKPFVELAEKLGRLAVQLVSGGSGVKSVKVTYASARAPDDLDTRLLRAMITKGLI 268

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + ++
Sbjct: 269 EPISSVFVNLVNADFSAKQRGLRIT 293


>gi|195953161|ref|YP_002121451.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobaculum sp. Y04AAS1]
 gi|195932773|gb|ACG57473.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobaculum sp. Y04AAS1]
          Length = 527

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 120/210 (57%), Gaps = 5/210 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++TK ++NKE ++K K G  +INCARGG++ E  L E L+SG +  AG DVF  
Sbjct: 199 VHTPLTHETKGMINKERIAKMKDGAIVINCARGGIIVEWDLIEALKSGKLYGAGIDVFSK 258

Query: 61  EP---ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP    L +      NV  + ++GA+T ESQE V I +A Q++  L    V   +N    
Sbjct: 259 EPPPKELVDAFRECKNVSLSAHIGANTYESQENVGIIIAQQVTKALKGQPVDYVVNAPFP 318

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR- 176
                 L+KP + LA+++G  + QL ++ I++I+I   G  A  N+  + +AVL G+++ 
Sbjct: 319 DISVITLIKPHLDLAENMGSLVAQLSTDGIKKIKIEVIGDLA-QNSKPVVAAVLKGVLKS 377

Query: 177 VWRVGANIISAPIIIKENAIILSTIKRDKS 206
           +     NII+A  + K+  I +  I  ++S
Sbjct: 378 ITDYPVNIINATYLAKDYGIEVEEIANEES 407


>gi|225458719|ref|XP_002283022.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 605

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 116/205 (56%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  ILN E+ S+ K GV I+N ARGG++DE AL   L SG VA+A  DVF  
Sbjct: 262 LHMPLTPATSKILNDESFSRMKKGVRIVNVARGGVIDEEALIRALDSGIVAQAALDVFTE 321

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L    NV   P+LGAST E+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 322 EPPPKDSKLVQHENVTVTPHLGASTTEAQEGVAIEIAEAVVGALKGELAATAVNAPMVPA 381

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + PF+ LA+ LG    QL++    ++ +++ Y  S     ++T +L + V  G++
Sbjct: 382 EVLSALAPFVVLAEKLGRLAVQLVAGGSGVRSVKVTYASSRGPDDLDTRLLRAMVTKGLI 441

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + ++
Sbjct: 442 EPISSVFVNLVNADFTAKQRGLRIT 466


>gi|217034326|ref|ZP_03439742.1| hypothetical protein HP9810_491g19 [Helicobacter pylori 98-10]
 gi|216943211|gb|EEC22678.1| hypothetical protein HP9810_491g19 [Helicobacter pylori 98-10]
          Length = 524

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++  A++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFALVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|308063839|gb|ADO05726.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Sat464]
          Length = 524

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++  A++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFALVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|208434953|ref|YP_002266619.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori G27]
 gi|208432882|gb|ACI27753.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori G27]
          Length = 524

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +  VK ++ LA  LG F  Q+     Q+I++   G        ++   ++  +  V   
Sbjct: 322 AS--VKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFTLVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|225022672|ref|ZP_03711864.1| hypothetical protein CORMATOL_02717 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224944580|gb|EEG25789.1| hypothetical protein CORMATOL_02717 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 558

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 103/174 (59%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + + E L+K K G  IIN ARGGLV+E ALA+ ++SGH+  AGFDVF  
Sbjct: 232 IHLPKTPETAGMFDAELLAKAKKGQIIINAARGGLVNEQALADAIRSGHIRGAGFDVFTT 291

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGAST E+Q++    +A  +   L    V++A+N++     
Sbjct: 292 EPCTDSPLFDLPEVVVTPHLGASTAEAQDRAGTDVAASVLKALAGEFVADAVNVSGGQVS 351

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V  ++ LA  LG  +G++++++   +++   G  +  +  VL  + + G+
Sbjct: 352 EE--VALWLELARKLGLVVGRMLAKAPVRLEVEARGELSTEDVNVLGLSAVRGL 403


>gi|297380233|gb|ADI35120.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori v225d]
          Length = 524

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++  A++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFALVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|288819163|ref|YP_003433511.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
 gi|288788563|dbj|BAI70310.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
 gi|308752746|gb|ADO46229.1| D-3-phosphoglycerate dehydrogenase [Hydrogenobacter thermophilus
           TK-6]
          Length = 530

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 109/200 (54%), Gaps = 5/200 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++T+N++ +      K G  +INCARGG+V+E  L   L+SG ++  G DVF  
Sbjct: 202 IHAPLTHETRNMITRREFEIMKDGAVLINCARGGIVNEEDLLWALESGKLSGVGLDVFSK 261

Query: 61  EP---ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP        L   PNV  +P++GA+T ESQE VA+ +A Q+   L    V   +N    
Sbjct: 262 EPPSMEFIEKLKRFPNVSLSPHIGANTYESQENVAVIVAQQVIKALRGQTVEYVVNAPFP 321

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR- 176
                 L+KP + LA+ +G F+ Q   E I+E+ I   G  A  +   ++SAVL GI+R 
Sbjct: 322 DISVLTLIKPHLDLAEKMGRFLVQWAEEGIREVHIEVRGDIA-EHFHPISSAVLMGILRQ 380

Query: 177 VWRVGANIISAPIIIKENAI 196
           V     NII+A  + ++  I
Sbjct: 381 VVDFPINIINASYVARDRGI 400


>gi|254779611|ref|YP_003057717.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori B38]
 gi|254001523|emb|CAX29541.1| D-3-phosphoglycerate dehydrogenase (PGDH) [Helicobacter pylori B38]
          Length = 524

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +  VK ++ LA  LG F  Q+     Q+I++   G        ++   ++  +  V   
Sbjct: 322 AS--VKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFTLVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|188527838|ref|YP_001910525.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Shi470]
 gi|188144078|gb|ACD48495.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Shi470]
          Length = 524

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++  A++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFALVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|325003700|ref|ZP_08124812.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia sp. P1]
          Length = 536

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 101/176 (57%), Gaps = 5/176 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ K+ L+ TK GV I+N ARGGL+DE+ALAE ++SGHV  AG DV+  
Sbjct: 207 VHLPKTPETLGLIGKDQLAITKPGVLIVNAARGGLIDEDALAEAVRSGHVGGAGVDVYVT 266

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF- 119
           EP   +PLF L NV   P+LGAST E+Q++    +A  +   L    V +A+N+ +    
Sbjct: 267 EPTTASPLFELENVVVTPHLGASTAEAQDRAGTDVARSVQLALAGEFVPDAVNVQVHGAV 326

Query: 120 -EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
            EE   V+P++ L   LG  +  +   +   + +   G  A  +  VL+ A L G+
Sbjct: 327 GEE---VRPWLPLVQKLGTTLHAVAGRTPSSVTVDIAGELAGEDVSVLSLAALRGV 379


>gi|308062332|gb|ADO04220.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori Cuz20]
          Length = 524

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++  A++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFALVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|317177807|dbj|BAJ55596.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F16]
          Length = 524

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGTKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++  A++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFALVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|308184795|ref|YP_003928928.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori SJM180]
 gi|308060715|gb|ADO02611.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori SJM180]
          Length = 524

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +  VK ++ LA  LG F  Q+     Q+I++   G        ++   ++  +  V   
Sbjct: 322 AS--VKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFTLVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|302142267|emb|CBI19470.3| unnamed protein product [Vitis vinifera]
          Length = 532

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 116/205 (56%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  ILN E+ S+ K GV I+N ARGG++DE AL   L SG VA+A  DVF  
Sbjct: 204 LHMPLTPATSKILNDESFSRMKKGVRIVNVARGGVIDEEALIRALDSGIVAQAALDVFTE 263

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L    NV   P+LGAST E+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 264 EPPPKDSKLVQHENVTVTPHLGASTTEAQEGVAIEIAEAVVGALKGELAATAVNAPMVPA 323

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + PF+ LA+ LG    QL++    ++ +++ Y  S     ++T +L + V  G++
Sbjct: 324 EVLSALAPFVVLAEKLGRLAVQLVAGGSGVRSVKVTYASSRGPDDLDTRLLRAMVTKGLI 383

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + ++
Sbjct: 384 EPISSVFVNLVNADFTAKQRGLRIT 408


>gi|84489937|ref|YP_448169.1| D-3-phosphoglycerate dehydrogenase [Methanosphaera stadtmanae DSM
           3091]
 gi|84373256|gb|ABC57526.1| SerA [Methanosphaera stadtmanae DSM 3091]
          Length = 524

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 114/208 (54%), Gaps = 1/208 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT +TK +++K  L+K K    ++NCARGG+++E  L E+L+     +AG DV+E 
Sbjct: 199 IHVPLTPETKGLISKPELTKMKDHAILLNCARGGIINEADLYEVLKERPELKAGLDVYEN 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL  L NV   P++ AST E+Q   AI +A ++ + +   + +N LNM ++  E
Sbjct: 259 EPLENSPLVTLDNVVLTPHIAASTKEAQRDAAIIVAKEVKEVINGNIPNNVLNMPVVDNE 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               +KP+  L + LG  + Q  + +I E+ I+Y G  +      L   +L   +  +  
Sbjct: 319 TFQTLKPYFQLTEKLGQILVQTTTSNISELNIVYSGEISGKAKEPLTRELLKEFLNPILT 378

Query: 180 VGANIISAPIIIKENAIILSTIKRDKSG 207
              N ++A  + KE  I ++  + + SG
Sbjct: 379 EPVNSVNAKAVAKERGIKITEGETEDSG 406


>gi|317182310|dbj|BAJ60094.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F57]
          Length = 524

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++  A++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFALVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|225428898|ref|XP_002285358.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 595

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 118/205 (57%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  +LN E  +K K GV IIN ARGG++DE AL   L +G VA+A  DVF  
Sbjct: 252 LHMPLTPATSKMLNDETFAKMKKGVRIINVARGGVIDEEALVRALDAGIVAQAALDVFTE 311

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++    L  NV   P+LGAST+E+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 312 EPPPKDSKLILHENVTVTPHLGASTMEAQEGVAIEIAEAVVGALKGELAATAVNAPMVPA 371

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +KPF+ LA+ LG    QL+S    ++ +++ Y  + A   ++T +L + +  G++
Sbjct: 372 EVLSELKPFVELAEKLGRLAVQLVSGGSGVKSVKVTYASARAPDDLDTRLLRAMITKGLI 431

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + ++
Sbjct: 432 EPISSVFVNLVNADFSAKQRGLRIT 456


>gi|312126868|ref|YP_003991742.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311776887|gb|ADQ06373.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 531

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 70/215 (32%), Positives = 115/215 (53%), Gaps = 8/215 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N+++++   K K GV I+NCARGG+++EN L   ++ G VA A  DV E 
Sbjct: 199 IHTPKTKETYNLISEKEFKKMKKGVRIVNCARGGVINENDLYNAIKEGIVAAAALDVLEK 258

Query: 61  EPALQ-------NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP  +       NPL  L NV   P+LGAST E+Q  VA+ +A +++  L  G+  NA+N
Sbjct: 259 EPNFELEKQDFYNPLLELDNVVITPHLGASTQEAQVNVAVSVAKEVAAVLKGGIAKNAVN 318

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +     E+   + P++ LA+ +G    Q       +I+I+Y G         L  A+L G
Sbjct: 319 LPAFEKEKLEEIMPYLELAEAMGKIFIQAERAFANKIEIVYGGQIDEKAITWLTRALLKG 378

Query: 174 IVRVW-RVGANIISAPIIIKENAIILSTIKRDKSG 207
            +    +   N +++ ++ KE  I +   K +++G
Sbjct: 379 YLEFSVQDTVNYVNSQLLAKEQGIEVVESKTEEAG 413


>gi|261838390|gb|ACX98156.1| 3-phosphoglycerate dehydrogenase [Helicobacter pylori 51]
          Length = 524

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++  A++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELNLCGEINQFKDALVAFALVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|297559156|ref|YP_003678130.1| D-3-phosphoglycerate dehydrogenase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296843604|gb|ADH65624.1| D-3-phosphoglycerate dehydrogenase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 529

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 104/205 (50%), Gaps = 3/205 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P    T  ++  E LSK K  V +IN ARGG++DE+AL   L+ G VA AG DVF  
Sbjct: 201 IHLPKNKDTLGLIGDEALSKVKPTVRVINAARGGILDEDALYRALKDGRVAGAGIDVFAK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF   NV  AP+LGAST E+QEK   Q+A  +   L    V +A+N+      
Sbjct: 261 EPCTDSPLFEFENVVVAPHLGASTAEAQEKAGTQVARSVKLALSGEFVPDAVNVQGTGVA 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVWR 179
           E   VKP + L + LG     L       I +   G  A  +  VL  A L G+   V  
Sbjct: 321 ED--VKPGLPLTEKLGRVFTSLAGTIASRIDVEVRGEIASHDVKVLELAALKGVFADVVE 378

Query: 180 VGANIISAPIIIKENAIILSTIKRD 204
                ++AP++ KE  + ++ +  D
Sbjct: 379 DTVTFVNAPLLAKERGVEVNLVTSD 403


>gi|307111670|gb|EFN59904.1| hypothetical protein CHLNCDRAFT_56437 [Chlorella variabilis]
          Length = 609

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 119/206 (57%), Gaps = 5/206 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT  TK + N E  +K K G  I+N ARGG++D++AL   L +G VA A  DVF  
Sbjct: 267 LHTPLTPNTKGMFNDELFAKMKKGARIVNVARGGVIDDDALKRALDAGIVAGAALDVFST 326

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  + NPL   P V C P+LGAST E+QE+VA ++A  +   L   +  + +N  +++ 
Sbjct: 327 EPPPEDNPLVSHPAVICTPHLGASTKEAQEEVAYEIAEAVISALNGELTPSCVNAPMVAP 386

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISES-IQEIQIIYDGSTA-VMNTMVLNSAVLAGIV-R 176
           E    ++PF+ LAD LG    QL+ +S   ++ I Y       ++T +L + V+ G++ +
Sbjct: 387 EVLKELQPFVALADGLGRAAVQLVQDSGFADVFITYHSPRGDDLDTRLLRAMVVKGMLEQ 446

Query: 177 VWRVGANIISAPIIIKENAI-ILSTI 201
           +     N+++A ++ K+  + I+ T+
Sbjct: 447 ITTSQVNLVNADLLAKKRGLRIVETV 472


>gi|317178639|dbj|BAJ56427.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F30]
          Length = 524

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 112/197 (56%), Gaps = 4/197 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
            +   K ++ LA  LG F  Q+     Q+I++   G        ++ + VL G+++ V  
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALV-AFVLVGVLKPVVG 378

Query: 180 VGANIISAPIIIKENAI 196
              N I+AP + KE  I
Sbjct: 379 DKINYINAPFVAKERGI 395


>gi|260577503|ref|ZP_05845445.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium jeikeium ATCC
           43734]
 gi|258604372|gb|EEW17607.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium jeikeium ATCC
           43734]
          Length = 529

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 113/207 (54%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + + + L+K+K G  IIN ARGGLVDE ALAE ++SGH+  AGFDV+  
Sbjct: 203 IHLPKTKETAGMFDADLLAKSKKGQIIINAARGGLVDETALAEAIKSGHIRGAGFDVYAS 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L  V   P+LGASTVE+Q++    +A  +   L    V +A+N++     
Sbjct: 263 EPCTDSPLFELEEVVVTPHLGASTVEAQDRAGTDVAASVLKALSGDFVPDAVNVSGGKVS 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V  ++ LA +LG    +L++ +   + +   G  +  +   L  A L G+   V  
Sbjct: 323 EE--VALWLNLATNLGRVASELLNSAPNTVTVTARGELSTESVDALGLAGLRGVFSGVID 380

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
                ++AP I +E  + L    +D+S
Sbjct: 381 EQVTFVNAPQIAEERGVELDVQTQDES 407


>gi|317009666|gb|ADU80246.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori India7]
          Length = 524

 Score =  118 bits (296), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 110/196 (56%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGVKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +  VK ++ LA  LG F  Q+     Q+I++   G        ++   ++  +  V   
Sbjct: 322 AS--VKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFTLVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE +I
Sbjct: 380 KINYINAPFVAKERSI 395


>gi|284052483|ref|ZP_06382693.1| D-3-phosphoglycerate dehydrogenase [Arthrospira platensis str.
           Paraca]
 gi|291569633|dbj|BAI91905.1| D-3-phosphoglycerate dehydrogenase [Arthrospira platensis NIES-39]
          Length = 527

 Score =  118 bits (295), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 114/199 (57%), Gaps = 3/199 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T +++N E L++ K    IINCARGG+VDE ALAE L+S  +A A  DV+E 
Sbjct: 199 LHMPKTEETYHLINAEALAQMKPTARIINCARGGIVDEVALAEALKSDQIAGAAVDVYEN 258

Query: 61  EPALQN-PLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  +N PL  L   V   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  + 
Sbjct: 259 EPLEENSPLRELGQKVILTPHLGASTEEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGLY 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RV 177
            +    +KP++ LA+ LG  + QL+   +  + I   G  A  ++  +  A L G++ + 
Sbjct: 319 PDALEQLKPYLQLAETLGNLVSQLVGGRVDFLDIRLQGDLANRDSKPVVVAALKGLLSQA 378

Query: 178 WRVGANIISAPIIIKENAI 196
            R   N ++A I  KE  I
Sbjct: 379 LRERVNYVNATIEAKERGI 397


>gi|297830606|ref|XP_002883185.1| hypothetical protein ARALYDRAFT_479462 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297329025|gb|EFH59444.1| hypothetical protein ARALYDRAFT_479462 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 585

 Score =  118 bits (295), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  ++N    S  K GV I+N ARGG++DE AL   L SG VA+A  DVF V
Sbjct: 242 LHLPLTAATSKMMNDVTFSMMKKGVRIVNVARGGVIDEEALLRALDSGIVAQAALDVFTV 301

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP ++ N L    +V   P+LGAST+E+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 302 EPPVKDNKLVLHESVTATPHLGASTMEAQEGVAIEVAEAVIGALRGELAATAVNAPMVPL 361

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +KP++ LA+ LG    QL++    +  +++ Y  S A   ++T +L + V+ G++
Sbjct: 362 EVLRELKPYVVLAEKLGRLAVQLVTGGSGVNAVKVTYASSRAPDDLDTRLLRAMVIKGLI 421

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N++++  I K+  + +S
Sbjct: 422 EPISSVFINLVNSDYIAKQRGVKIS 446


>gi|317180143|dbj|BAJ57929.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori F32]
          Length = 524

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGVKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++  A++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFALVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|308183160|ref|YP_003927287.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori PeCan4]
 gi|308065345|gb|ADO07237.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori PeCan4]
          Length = 524

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 109/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++  A++  +  +   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFALVGVLKPIVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|331695673|ref|YP_004331912.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia dioxanivorans
           CB1190]
 gi|326950362|gb|AEA24059.1| D-3-phosphoglycerate dehydrogenase [Pseudonocardia dioxanivorans
           CB1190]
          Length = 533

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 98/176 (55%), Gaps = 5/176 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ K+ L+ TK GV I+N ARGGLVDE ALAE ++SGHV  AG DV+  
Sbjct: 205 IHLPKTPETLGLIGKDQLAITKKGVIIVNAARGGLVDEAALAEAVRSGHVGGAGIDVYVT 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF- 119
           EP   +PLF L NV   P+LGAST E+Q++    +A  +   L    V +A+N+ I    
Sbjct: 265 EPTTSSPLFELENVVVTPHLGASTDEAQDRAGTDVARSVQLALAGEFVPDAVNVQIDGAV 324

Query: 120 -EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
            EE   V+P++ L   +G  +  L       I +   G  +  +  VL  A L G+
Sbjct: 325 GEE---VRPYLPLVQKMGTVLHALAGRVPSSITVDVAGELSSEDVSVLPLAALRGV 377


>gi|312194898|ref|YP_004014959.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EuI1c]
 gi|311226234|gb|ADP79089.1| D-3-phosphoglycerate dehydrogenase [Frankia sp. EuI1c]
          Length = 527

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 115/210 (54%), Gaps = 11/210 (5%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  + L+KTK GV I+N ARGGLV E ALA+ ++SGHV  AG DVF  
Sbjct: 199 IHLPKTKETLGLIGADELAKTKPGVIIVNAARGGLVVEEALADAIRSGHVGGAGVDVFVK 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM---AII 117
           EP   +PLFGL NV   P+LGAST E+QEK  + +A  +   L    V +A+N+    ++
Sbjct: 259 EPTTSSPLFGLENVVVTPHLGASTNEAQEKAGLAVARSVRLALQGEFVPDAVNVQAGGVV 318

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR- 176
           + +    V+P + LA+ LG     +     + + +   G     +  VL  A L G+   
Sbjct: 319 AED----VRPGLPLAEKLGQVFTGIAGGLPENLTVEIRGEITEFDVSVLQLAALKGVFHD 374

Query: 177 VWRVGANIISAPIIIKEN--AIILSTIKRD 204
           V       ++AP++ KE    ++L T  RD
Sbjct: 375 VVEEQVTYVNAPLLAKERHVEVVLET-HRD 403


>gi|227501755|ref|ZP_03931804.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium accolens ATCC
           49725]
 gi|227077780|gb|EEI15743.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium accolens ATCC
           49725]
          Length = 528

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 102/174 (58%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + N E L+K K G  +IN ARGGLVDE ALA+ + SGH   AGFDV+  
Sbjct: 201 IHLPKTPETAGMFNAELLAKAKEGQILINAARGGLVDEQALADSITSGHHRGAGFDVYST 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V  +P+LGASTVE+Q++    +A  +   L    V +A+N++  +  
Sbjct: 261 EPCTDSPLFKLPQVTVSPHLGASTVEAQDRAGTDVAASVLKALAGEFVPDAVNVSGGTVG 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V  ++ LA  LG   G+L+ ++   ++I   G  +  +  VL  +V+ G+
Sbjct: 321 EE--VAGWLDLARKLGLTAGRLLDQAPVAVEIEACGELSTEDVDVLGLSVVRGL 372


>gi|222629679|gb|EEE61811.1| hypothetical protein OsJ_16432 [Oryza sativa Japonica Group]
          Length = 544

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  +LN E  +K K GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 201 LHMPLTPATNKMLNDETFAKMKKGVRIINVARGGVIDEDALVRALDSGIVAQAALDVFTK 260

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  + L    NV   P+LGASTVE+QE VAI++A  +   L   + ++A+N  ++  
Sbjct: 261 EPPAPDSKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVIGALKGELAASAVNAPMVPA 320

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL++    I+ +++ Y  + A   ++T +L + +  G++
Sbjct: 321 EVLSELAPYVVLAEKLGRLAVQLVAGGGGIKSVKVTYASARAPDDLDTRLLRAMITKGLI 380

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + ++
Sbjct: 381 EPISSVFVNLVNADFTAKQRGVRIT 405


>gi|119193730|ref|XP_001247470.1| hypothetical protein CIMG_01241 [Coccidioides immitis RS]
          Length = 585

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 76/219 (34%), Positives = 120/219 (54%), Gaps = 13/219 (5%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   L+  K G  I+N ARGG +DE AL + L+SGH+A AG DVF  
Sbjct: 209 IHTPLIASTKGMISTAELANMKPGARILNVARGGTIDEIALLDALESGHIAGAGIDVFTS 268

Query: 61  EP----ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP    +  + L   PNV   P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 269 EPPKPGSSASRLIAHPNVVATPHLGASTVEAQENVSIDVCEQVLQILGGALPRSAVNAPL 328

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESI------QEIQIIYDGSTA-VMNTMVLNSA 169
           I  EE   ++PF+ L + +G    Q  S S           +IY+G  A + NT  L +A
Sbjct: 329 ILPEEYKKLQPFVRLVEKMGSLYTQHYSSSTSFDANRSTFDLIYEGDIAGINNTKPLFAA 388

Query: 170 VLAGIV-RVWRVGANIISAPIIIKENAIILSTIK-RDKS 206
            + G++  +     +I++A ++ +E  I+++  + RD S
Sbjct: 389 FIKGLMATISSTNVSIVNAELVARERGIVVNEQRSRDPS 427


>gi|90399366|emb|CAH68268.1| H0212B02.14 [Oryza sativa Indica Group]
 gi|116311962|emb|CAJ86321.1| OSIGBa0113E10.4 [Oryza sativa Indica Group]
          Length = 613

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  +LN E  +K K GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 270 LHMPLTPATNKMLNDETFAKMKKGVRIINVARGGVIDEDALVRALDSGIVAQAALDVFTK 329

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  + L    NV   P+LGASTVE+QE VAI++A  +   L   + ++A+N  ++  
Sbjct: 330 EPPAPDSKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVIGALKGELAASAVNAPMVPA 389

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL++    I+ +++ Y  + A   ++T +L + +  G++
Sbjct: 390 EVLSELAPYVVLAEKLGRLAVQLVAGGGGIKSVKVTYASARAPDDLDTRLLRAMITKGLI 449

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + ++
Sbjct: 450 EPISSVFVNLVNADFTAKQRGVRIT 474


>gi|257386858|ref|YP_003176631.1| D-3-phosphoglycerate dehydrogenase [Halomicrobium mukohataei DSM
           12286]
 gi|257169165|gb|ACV46924.1| D-3-phosphoglycerate dehydrogenase [Halomicrobium mukohataei DSM
           12286]
          Length = 529

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 113/207 (54%), Gaps = 2/207 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+N++ +E L++ + G  ++NCARGG++DE ALAE ++ G +  A  DVF  
Sbjct: 200 IHTPLTPETENMIGEEELAQLEDG-YVVNCARGGIIDELALAEAVEDGILKGAAVDVFAE 258

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP   + PL  + ++   P+LGAST  +QE VA   A Q+     D  V NALN   I  
Sbjct: 259 EPLPDDSPLLDVEDIIVTPHLGASTEAAQENVATSTADQIVAAFNDEPVINALNAPSIDE 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
              P ++P++ LAD  G    QL    +  +++ Y G  A  +  ++ ++ L G+     
Sbjct: 319 SIFPQIRPYIELADTAGKIAVQLFDGQMGSVEVTYAGDIADQDVELVTASALKGVFAPSE 378

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
           +  N ++AP I +   I ++  K  +S
Sbjct: 379 LQVNAVNAPQIAENRGIDVTESKTRQS 405


>gi|146296326|ref|YP_001180097.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145409902|gb|ABP66906.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 531

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 114/215 (53%), Gaps = 8/215 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N+++++   K K GV I+NCARGG+++E  L   ++ G VA A  DV E 
Sbjct: 199 IHTPKTPETYNLISEKEFKKMKKGVRIVNCARGGVINEKDLYNAIKEGIVAAAALDVLEK 258

Query: 61  EPALQ-------NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP  +       NPL  L NV   P+LGAST E+Q  VA+ +A +++  L  G+  NA+N
Sbjct: 259 EPNFEVEKQDYYNPLLELDNVVITPHLGASTQEAQVNVAVSVAREVAAVLKGGIAKNAVN 318

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +     E+   + P++ LA+ +G    Q       +I+IIY G      T  L  A+L G
Sbjct: 319 LPAFEKEKLDEIMPYLELAEAMGKIFIQAERAFANKIEIIYSGQIDPKMTTWLTRALLKG 378

Query: 174 IVRVW-RVGANIISAPIIIKENAIILSTIKRDKSG 207
            +    +   N +++ ++  E  I +   K+ +SG
Sbjct: 379 YLEFSVQDTVNYVNSQVLATEQGIEVIESKKQESG 413


>gi|147823108|emb|CAN68604.1| hypothetical protein VITISV_036580 [Vitis vinifera]
          Length = 610

 Score =  117 bits (294), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 116/205 (56%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  TK I N E  +K K GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 267 LHMPLTPTTKKIFNDETFAKVKKGVRIINVARGGVIDEDALVRALDSGAVAQAALDVFTE 326

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L    NV   P+LGAST E+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 327 EPPPKDSKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAVVGALRGELSATAVNAPMVPP 386

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGST--AVMNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL++    I+ ++++Y  +     ++T +L + V  GI+
Sbjct: 387 EVISELSPYVVLAEKLGRLAVQLVAGGSGIKSVKVVYKTARDPXDLDTRLLRAMVTKGII 446

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +     N+++A    K+  + +S
Sbjct: 447 EPISSSFINLVNADFTAKQKGLRIS 471


>gi|115460988|ref|NP_001054094.1| Os04g0650800 [Oryza sativa Japonica Group]
 gi|32488924|emb|CAE04505.1| OSJNBb0059K02.15 [Oryza sativa Japonica Group]
 gi|113565665|dbj|BAF16008.1| Os04g0650800 [Oryza sativa Japonica Group]
 gi|125550010|gb|EAY95832.1| hypothetical protein OsI_17701 [Oryza sativa Indica Group]
 gi|215768007|dbj|BAH00236.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 613

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  +LN E  +K K GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 270 LHMPLTPATNKMLNDETFAKMKKGVRIINVARGGVIDEDALVRALDSGIVAQAALDVFTK 329

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  + L    NV   P+LGASTVE+QE VAI++A  +   L   + ++A+N  ++  
Sbjct: 330 EPPAPDSKLVLHENVTVTPHLGASTVEAQEGVAIEIAEAVIGALKGELAASAVNAPMVPA 389

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL++    I+ +++ Y  + A   ++T +L + +  G++
Sbjct: 390 EVLSELAPYVVLAEKLGRLAVQLVAGGGGIKSVKVTYASARAPDDLDTRLLRAMITKGLI 449

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + ++
Sbjct: 450 EPISSVFVNLVNADFTAKQRGVRIT 474


>gi|315658015|ref|ZP_07910888.1| phosphoglycerate dehydrogenase [Staphylococcus lugdunensis M23590]
 gi|315496905|gb|EFU85227.1| phosphoglycerate dehydrogenase [Staphylococcus lugdunensis M23590]
          Length = 539

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 66/209 (31%), Positives = 115/209 (55%), Gaps = 2/209 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KTK ++ K+  +K KS + +IN ARGG++DE AL E +    +A+A  DVFE 
Sbjct: 202 VHTPLTEKTKGMIGKDFFNKAKSTLQVINVARGGIIDEAALFEAIDKKQIAKAAIDVFEE 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL    ++   P+LGAST+E+Q KVAI ++ ++ DY   G++ +A+N   + F 
Sbjct: 262 EPPTNSPLINHDDIIVTPHLGASTIEAQTKVAISVSEELVDYFEQGLIKHAINAPTLDFS 321

Query: 121 E-APLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNT-MVLNSAVLAGIVRVW 178
             +   + F+ +++       QL   + ++I+I   G     +  ++L S++   +   +
Sbjct: 322 NISDTAREFIKVSEIAAELAVQLFDHAPEDIKITVSGEIVEPHADLILRSSITQLLKPHF 381

Query: 179 RVGANIISAPIIIKENAIILSTIKRDKSG 207
              AN+I+   ++KE  I      R  +G
Sbjct: 382 GYRANLINGLALLKEQEINYQVETRTSAG 410


>gi|298204781|emb|CBI25279.3| unnamed protein product [Vitis vinifera]
          Length = 432

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 116/205 (56%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  TK I N E  +K K GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 89  LHMPLTPTTKKIFNDETFAKVKKGVRIINVARGGVIDEDALVRALDSGAVAQAALDVFTE 148

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L    NV   P+LGAST E+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 149 EPPPKDSKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAVVGALRGELSATAVNAPMVPP 208

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL++    I+ ++++Y  +     ++T +L + V  GI+
Sbjct: 209 EVISELSPYVVLAEKLGRLAVQLVAGGSGIKSVKVVYKTARDPDDLDTRLLRAMVTKGII 268

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +     N+++A    K+  + +S
Sbjct: 269 EPISSSFINLVNADFTAKQKGLRIS 293


>gi|28210417|ref|NP_781361.1| D-3-phosphoglycerate dehydrogenase [Clostridium tetani E88]
 gi|28202854|gb|AAO35298.1| D-3-phosphoglycerate dehydrogenase [Clostridium tetani E88]
          Length = 533

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 69/203 (33%), Positives = 114/203 (56%), Gaps = 1/203 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T NI++++ L   K GV I+N ARG L+ E AL + L+ G +A  G DV E 
Sbjct: 204 IHTPRTEETINIISEKELELMKDGVRIVNAARGKLISEKALCKGLKKGKIASVGIDVHEH 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L+   NV   P++GA+T+E+Q+ V + +A Q+ + +   +V NA+N+  I  +
Sbjct: 264 EPRYSADLYEYENVVVTPHIGATTIEAQQNVGVTIAKQVINGIKGDIVPNAVNLPTIHRD 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   +KP++ LA+ LG    QL   +I+ + I Y G     +T ++  A + G++  V  
Sbjct: 324 ELKEIKPYIDLAEKLGKIYYQLNKGAIKLVDITYWGDIGCQDTEMVTIAFIKGLLEPVMA 383

Query: 180 VGANIISAPIIIKENAIILSTIK 202
              N I+A I  +E  I +++ K
Sbjct: 384 DKINYINAMIKAEEGGIGVNSKK 406


>gi|13928850|ref|NP_113808.1| D-3-phosphoglycerate dehydrogenase [Rattus norvegicus]
 gi|3122856|sp|O08651|SERA_RAT RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|1944614|emb|CAA66374.1| D-3-phosphoglycerate dehydrogenase [Rattus norvegicus]
 gi|7688285|emb|CAB89828.1| 3-phosphoglycerate dehydrogenase [Rattus norvegicus]
 gi|55562727|gb|AAH86327.1| Phgdh protein [Rattus norvegicus]
 gi|149030526|gb|EDL85563.1| 3-phosphoglycerate dehydrogenase, isoform CRA_a [Rattus norvegicus]
 gi|149030528|gb|EDL85565.1| 3-phosphoglycerate dehydrogenase, isoform CRA_a [Rattus norvegicus]
          Length = 533

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ++  G++       L+ AV+ G++R    
Sbjct: 325 FSPHTKPWIGLAEALGTLMHAWAGSPKGTIQVVTQGTSLKNAGTCLSPAVIVGLLREASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLNVTT 406


>gi|116073644|ref|ZP_01470906.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9916]
 gi|116068949|gb|EAU74701.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. RS9916]
          Length = 528

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 105/177 (59%), Gaps = 2/177 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N E L   KS   ++NCARGG++DE ALAE +++G +A AG DVF  
Sbjct: 199 LHIPRTPDTENLVNAELLRSMKSTARLVNCARGGIIDEAALAEAIENGVIAGAGVDVFAS 258

Query: 61  EP-ALQNPLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP A  +PL  +   +   P+LGAST E+QE VA  +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLAEDSPLRKVQRGLVLTPHLGASTEEAQENVATDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            E    +KP + LA+ LG  I QL    ++E+++   G  +   +  L  A L G++
Sbjct: 319 AEIMERLKPHLQLAETLGLLISQLAGGQVEELEVRLQGEFSEHPSQPLVIAALKGLL 375


>gi|57242228|ref|ZP_00370167.1| D-3-phosphoglycerate dehydrogenase [Campylobacter upsaliensis
           RM3195]
 gi|57016908|gb|EAL53690.1| D-3-phosphoglycerate dehydrogenase [Campylobacter upsaliensis
           RM3195]
          Length = 527

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 67/199 (33%), Positives = 107/199 (53%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++  + ++K K  V +INCARGGL  E+AL E L+SG +A  G DVF+ 
Sbjct: 204 IHTPKTKETNGMIGSKEIAKMKDKVRLINCARGGLYTEDALCEGLKSGKIAWLGIDVFDK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    NV    +LGA+T+ESQE +AI+   Q  +        NALN+ I + +
Sbjct: 264 EPATNHPLLDFENVSVTSHLGANTLESQENIAIEACEQALNAARGVAYPNALNLPIKTED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V+P++ L   +     Q+    ++ I+I  +G+ +     +L  A +  +  +   
Sbjct: 324 LPPFVEPYIELISKMAFLAVQIDKSPVKSIKIEAEGNISDYANSMLTFATVGALSGILGE 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  I LS
Sbjct: 384 NINYVNAEFVAKEKGIELS 402


>gi|225443272|ref|XP_002273552.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 624

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 116/205 (56%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  TK I N E  +K K GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 281 LHMPLTPTTKKIFNDETFAKVKKGVRIINVARGGVIDEDALVRALDSGAVAQAALDVFTE 340

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L    NV   P+LGAST E+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 341 EPPPKDSKLVQHENVTVTPHLGASTKEAQEGVAIEIAEAVVGALRGELSATAVNAPMVPP 400

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL++    I+ ++++Y  +     ++T +L + V  GI+
Sbjct: 401 EVISELSPYVVLAEKLGRLAVQLVAGGSGIKSVKVVYKTARDPDDLDTRLLRAMVTKGII 460

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +     N+++A    K+  + +S
Sbjct: 461 EPISSSFINLVNADFTAKQKGLRIS 485


>gi|315638687|ref|ZP_07893861.1| phosphoglycerate dehydrogenase [Campylobacter upsaliensis JV21]
 gi|315481311|gb|EFU71941.1| phosphoglycerate dehydrogenase [Campylobacter upsaliensis JV21]
          Length = 527

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 67/199 (33%), Positives = 107/199 (53%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++  + ++K K  V +INCARGGL  E+AL E L+SG +A  G DVF+ 
Sbjct: 204 IHTPKTKETNGMIGSKEIAKMKDKVRLINCARGGLYTEDALCEGLKSGKIAWLGIDVFDK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    NV    +LGA+T+ESQE +AI+   Q  +        NALN+ I + +
Sbjct: 264 EPATNHPLLDFENVSVTSHLGANTLESQENIAIEACEQALNAARGVAYPNALNLPIKTED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V+P++ L   +     Q+    ++ I+I  +G+ +     +L  A +  +  +   
Sbjct: 324 LPPFVEPYIELISKMAFLAVQIDKSPVKSIKIEAEGNISDYANSMLTFATVGALSGILGE 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  I LS
Sbjct: 384 NINYVNAEFVAKEKGIELS 402


>gi|78213665|ref|YP_382444.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9605]
 gi|78198124|gb|ABB35889.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9605]
          Length = 528

 Score =  117 bits (293), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 104/177 (58%), Gaps = 2/177 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N E L   K    I+NCARGG+VDE A+AE + +G +A AG DV+  
Sbjct: 199 LHIPRTKDTENLVNAELLRTMKPTARIVNCARGGVVDEAAIAEAINNGVIAGAGLDVYAS 258

Query: 61  EP-ALQNPLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP A  +PL  +   +   P+LGAST E+QE VAI +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLAEDSPLRAVERGLVLTPHLGASTEEAQENVAIDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            E    +KP + LA+ +G  + QL    +QE+++   G  A   +  L  A L G++
Sbjct: 319 AEIMERLKPHLQLAETVGLLVSQLAGGHVQEMELRLQGEFASHPSQPLVIAALKGLL 375


>gi|211906486|gb|ACJ11736.1| phosphoglycerate dehydrogenase [Gossypium hirsutum]
          Length = 602

 Score =  117 bits (293), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 117/205 (57%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  +LN E  +K K GV I+N ARGG++DE AL   L +G VA+A  DVF  
Sbjct: 259 LHMPLTPATNKMLNDETFAKMKKGVRIVNVARGGVIDEEALVRALDAGTVAQAALDVFSE 318

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  Q+  L     V   P+LGAST+E+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 319 EPPKQDSKLVQHERVTVTPHLGASTMEAQEGVAIEIAEAVVGALKGELAATAVNAPMVPA 378

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +KP++ LA+ LG    QL++    ++ +++ Y  S A   ++T +L + +  GI+
Sbjct: 379 EVLTELKPYVELAEKLGRLGVQLVAGGSGVKTVKVSYASSRAPDDLDTRLLRAMITKGII 438

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + ++
Sbjct: 439 EPISSVFVNLVNADYTAKQRGLRIT 463


>gi|33865069|ref|NP_896628.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. WH 8102]
 gi|33638753|emb|CAE07048.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 8102]
          Length = 528

 Score =  117 bits (293), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 118/214 (55%), Gaps = 7/214 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N E L   K    I+NCARGG+VDE A+AE +  G +A AG DV+  
Sbjct: 199 LHIPRTKDTENLVNAELLRTMKPTARIVNCARGGVVDEAAIAEAINGGVIAGAGLDVYAS 258

Query: 61  EP-ALQNPLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP A  +PL  +   +   P+LGAST E+QE VAI +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLAEDSPLRAVERGLVLTPHLGASTEEAQENVAIDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RV 177
            E    +KP + LA+ +G  + QL    +QE+++   G  A   +  L  A L G++  V
Sbjct: 319 AEIMERLKPHLQLAETVGGLVSQLSGGQVQELELRLQGDFASHPSQPLVIASLKGLLGAV 378

Query: 178 WRVGANIISAPIIIKENAIILSTIK----RDKSG 207
                N ++A +  K   I +  +K    RD +G
Sbjct: 379 LGDSINFVNASLEAKARGIRVLEVKDEASRDYAG 412


>gi|68536373|ref|YP_251078.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium jeikeium K411]
 gi|68263972|emb|CAI37460.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium jeikeium K411]
          Length = 529

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 112/207 (54%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + + + L+K K G  IIN ARGGLVDE ALAE ++SGH+  AGFDV+  
Sbjct: 203 IHLPKTKETAGMFDADLLAKAKKGQIIINAARGGLVDEAALAEAIKSGHIRGAGFDVYAS 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L  V   P+LGASTVE+Q++    +A  +   L    V +A+N++     
Sbjct: 263 EPCTDSPLFELDEVVVTPHLGASTVEAQDRAGTDVAASVLKALAGDFVPDAVNVSGGKVS 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V  ++ LA +LG    +L++ +   + +   G  +  +   L  A L G+   V  
Sbjct: 323 EE--VALWLNLATNLGRVASELLNSAPNTVTVTARGELSTESVDALGLAGLRGVFSGVID 380

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
                ++AP I +E  + L    +D+S
Sbjct: 381 EQVTFVNAPQIAEERGVELDVQTQDES 407


>gi|210135216|ref|YP_002301655.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori P12]
 gi|210133184|gb|ACJ08175.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori P12]
          Length = 524

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 112/197 (56%), Gaps = 4/197 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
            +   K ++ LA  LG F  Q+     Q+I++   G        ++ + +L G+++ V  
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALV-AFMLVGVLKPVVG 378

Query: 180 VGANIISAPIIIKENAI 196
              N I+AP + KE  I
Sbjct: 379 DKINYINAPFVAKERGI 395


>gi|314933875|ref|ZP_07841240.1| phosphoglycerate dehydrogenase [Staphylococcus caprae C87]
 gi|313654025|gb|EFS17782.1| phosphoglycerate dehydrogenase [Staphylococcus caprae C87]
          Length = 531

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 118/210 (56%), Gaps = 8/210 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KT+ I+ +   +  K  + IIN ARGG++DE AL   L +  +  A  DVFE 
Sbjct: 202 VHTPLTPKTRGIVGESFFNNAKPNLQIINVARGGIIDEEALIHALDNNLIDHAAIDVFEH 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN---MAII 117
           EP   +PL     +   P+LGASTVE+QEKVA+ ++ ++ D L +G V +A+N   M + 
Sbjct: 262 EPPTDSPLISHDKIIVTPHLGASTVEAQEKVAVSVSEEIIDILTNGTVEHAVNAPKMDLS 321

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           + +E   VK F+ L   +G F  QL+  +  EI+I + G  A  +T ++   ++  I++ 
Sbjct: 322 NVDET--VKSFVDLGTTIGEFAIQLLEGAPSEIKITFAGDLATNDTSLITRTIVTNILK- 378

Query: 178 WRVG--ANIISAPIIIKENAIILSTIKRDK 205
             +G   NII+A  ++ +  +  +  K+ K
Sbjct: 379 EDLGEEVNIINALALLNQQGVTYNIEKQKK 408


>gi|134102592|ref|YP_001108253.1| D-3-phosphoglycerate dehydrogenase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|291004723|ref|ZP_06562696.1| D-3-phosphoglycerate dehydrogenase [Saccharopolyspora erythraea
           NRRL 2338]
 gi|133915215|emb|CAM05328.1| D-3-phosphoglycerate dehydrogenase (PgdH) [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 531

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 97/174 (55%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L + K G  I+N ARGGL+DE ALA+ ++SGH+  AG DV++ 
Sbjct: 204 IHLPKTAETLGLIGAEELKRAKKGQLIVNAARGGLIDEEALADAIRSGHIGGAGIDVYKT 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L NV   P+LGAST E+Q++    +A  +   L    V +A+N+   +  
Sbjct: 264 EPTTSSPLFELTNVVATPHLGASTAEAQDRAGTDVARSVLLALRGDFVPDAVNVQGGAVG 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V+P++ L   LG  +  ++  +   + +   G  A  +  VL  A L G+
Sbjct: 324 EE--VRPYLPLTQKLGQVLAAVLGSTPSSVTVEARGELADEDVSVLQLAALRGV 375


>gi|224063477|ref|XP_002301163.1| predicted protein [Populus trichocarpa]
 gi|222842889|gb|EEE80436.1| predicted protein [Populus trichocarpa]
          Length = 598

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/202 (34%), Positives = 114/202 (56%), Gaps = 6/202 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  I N +  S+ K GV I+N ARGG++DE AL   L SG VA+A  DVF  
Sbjct: 255 LHMPLTPATSKIFNDQAFSRMKKGVRIVNVARGGVIDEEALVRALDSGIVAQAALDVFTE 314

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++    L  NV   P+LGAST E+QE VAI++A  +   L   + + A+N  +++ 
Sbjct: 315 EPPPKDSRLVLHENVTVTPHLGASTTEAQEGVAIEVAEAVIGALKGELAATAVNAPMVTA 374

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + PF+TL++ LG    QL++    +Q +++ Y  +     ++T +L + +  G++
Sbjct: 375 EVLTELAPFVTLSEKLGRLAAQLVAGGSGVQSVKVTYASARGPDDLDTRLLRAMITKGLI 434

Query: 176 R-VWRVGANIISAPIIIKENAI 196
             +  V  N+++A    K+  +
Sbjct: 435 EPIASVYINLVNADFTAKQRGL 456


>gi|207092309|ref|ZP_03240096.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 524

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 108/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++   ++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFTLVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|15612049|ref|NP_223701.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori J99]
 gi|4155559|gb|AAD06553.1| D-3-PHOSPHOGLYCERATE DEHYDROGENASE [Helicobacter pylori J99]
          Length = 524

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 108/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++   ++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFTLVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|307637719|gb|ADN80169.1| D-3-phospho glycerate dehydrogenase [Helicobacter pylori 908]
 gi|325996322|gb|ADZ51727.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 2018]
          Length = 524

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 108/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++   ++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFTLVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|300783616|ref|YP_003763907.1| D-3-phosphoglycerate dehydrogenase [Amycolatopsis mediterranei U32]
 gi|299793130|gb|ADJ43505.1| D-3-phosphoglycerate dehydrogenase [Amycolatopsis mediterranei U32]
          Length = 532

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 98/174 (56%), Gaps = 1/174 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +TK +++ E L KTK GV I+N ARGGL+ E  LA+ L+SGHV  AG DVF  
Sbjct: 204 IHLPKTPETKGLIDAEALKKTKPGVIIVNAARGGLIVEQDLADALRSGHVGGAGVDVFVT 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L NV   P+LGAST E+Q++    +A  +   L    V +A+N++     
Sbjct: 264 EPTTSSPLFELENVVVTPHLGASTAEAQDRAGTDVAKSVLLALRGDFVPDAVNVS-GGGA 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
               V+P+++L   LG  +  L   S   + +   G  +  +T VL  A L G+
Sbjct: 323 VGEHVRPYLSLVQKLGQLLTALNPTSPTSVTVQVKGEISNEDTGVLQLAALRGV 376


>gi|317014441|gb|ADU81877.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           Gambia94/24]
          Length = 524

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 108/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++   ++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFTLVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|22297868|ref|NP_681115.1| D-3-phosphoglycerate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
 gi|22294046|dbj|BAC07877.1| D-3-phosphoglycerate dehydrogenase [Thermosynechococcus elongatus
           BP-1]
          Length = 527

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 119/210 (56%), Gaps = 6/210 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T++++N + ++K K    IINCARGG++DE AL E L+SG +A A  DVFE 
Sbjct: 199 LHLPKTPETQHLINAKTIAKMKPTARIINCARGGIIDEVALVEALKSGRLAGAALDVFEN 258

Query: 61  EP-ALQNPLFGLP-NVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP    +PL  L       P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  + 
Sbjct: 259 EPLEADSPLRSLGMEAILTPHLGASTEEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGLR 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    + P+M LA+ LG  +GQL    ++ +++   G  A   +  +  A L G++   
Sbjct: 319 PDVLEKLAPYMQLAETLGNLVGQLAGGRVESLEVRLQGELATNESQPIVIAALKGLLSPA 378

Query: 178 WRVGANIISAPIIIKENAI-ILSTIKRDKS 206
            R   N ++A +  KE  I ++ T  RD+S
Sbjct: 379 LRERVNYVNAGLEAKERGIRVVET--RDES 406


>gi|52353955|ref|NP_058662.2| D-3-phosphoglycerate dehydrogenase [Mus musculus]
 gi|55584180|sp|Q61753|SERA_MOUSE RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH;
           AltName: Full=A10
 gi|41529270|dbj|BAD08449.1| 3-phosphoglycerate dehyrogenase [Mus musculus]
 gi|56104627|gb|AAH86668.1| 3-phosphoglycerate dehydrogenase [Mus musculus]
 gi|74146580|dbj|BAE41303.1| unnamed protein product [Mus musculus]
 gi|83404941|gb|AAI10674.1| 3-phosphoglycerate dehydrogenase [Mus musculus]
 gi|148707012|gb|EDL38959.1| mCG11110 [Mus musculus]
          Length = 533

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ +G  +          IQ++  G++       L+ AV+ G++R    
Sbjct: 325 FSPHTKPWIGLAEAMGTLMHAWAGSPKGTIQVVTQGTSLKNAGTCLSPAVIVGLLREASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLNVTT 406


>gi|26345686|dbj|BAC36494.1| unnamed protein product [Mus musculus]
          Length = 533

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ +G  +          IQ++  G++       L+ AV+ G++R    
Sbjct: 325 FSPHTKPWIGLAEAMGTLMHAWAGSPKGTIQVVTQGTSLKNAGTCLSPAVIVGLLREASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLNVTT 406


>gi|163839793|ref|YP_001624198.1| D-3-phosphoglycerate dehydrogenase [Renibacterium salmoninarum ATCC
           33209]
 gi|162953269|gb|ABY22784.1| D-3-phosphoglycerate dehydrogenase [Renibacterium salmoninarum ATCC
           33209]
          Length = 530

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 111/208 (53%), Gaps = 7/208 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E   K K    +IN ARGGL+DE+AL + LQ+G +A AG DVF  
Sbjct: 202 IHMPKTPETVGMIGPEAFKKMKKSAYVINVARGGLIDESALYDALQAGEIAGAGIDVFVK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMA--IIS 118
           EP+   P FGL NV   P+LGAST E+QEK  I +A  +   L   +  +A+N+A  +I 
Sbjct: 262 EPSTDLPFFGLDNVVVTPHLGASTDEAQEKAGISVAKSVRLALAGELAPDAVNVAGGVID 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRV 177
            E    V+P + L + LG     L   S+ +I +   G  A  +   L  A L GI   V
Sbjct: 322 SE----VRPGIPLIEKLGRVFTALTHASVTQIDVEVAGEIASKDVKALELAALKGIFTDV 377

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDK 205
                + ++AP++ ++  I +  I  D+
Sbjct: 378 VSEQVSYVNAPVLAEQRGINVRLITTDE 405


>gi|118474999|ref|YP_892404.1| D-3-phosphoglycerate dehydrogenase [Campylobacter fetus subsp.
           fetus 82-40]
 gi|118414225|gb|ABK82645.1| D-3-phosphoglycerate dehydrogenase [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 525

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 114/207 (55%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T +++  E +SK K+GV +INCARGGL +E++L + LQSG ++ AG DVF  
Sbjct: 202 IHTPKNKETVDMIGDEEISKMKNGVRLINCARGGLYNEDSLLKGLQSGKISYAGIDVFVK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA+ +PL  L NV   P+LGA+T ESQ+ +AI  A Q           NALN+ I + +
Sbjct: 262 EPAINHPLLDLENVSATPHLGANTYESQKNIAIAAAEQAISAAKGICYPNALNLPIKTED 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +  F  QL  + I+ I+I  +GS A     +L  A++  +      
Sbjct: 322 LPPFVAPYVELISKMSYFGAQLNKKPIKAIRIEAEGSIAEYANSMLTFAIVGCLKETLGD 381

Query: 181 GANIISAPIIIKENAIILSTIKRDKSG 207
             N ++A    +E  + +S     +SG
Sbjct: 382 TINYVNAKFKAEEKGVEVSATTLPESG 408


>gi|261839790|gb|ACX99555.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 52]
          Length = 524

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 107/196 (54%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I+    G        ++   ++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIEFSLCGEINQFKDALVAFTLVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|217032273|ref|ZP_03437770.1| hypothetical protein HPB128_142g21 [Helicobacter pylori B128]
 gi|298735944|ref|YP_003728469.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori B8]
 gi|216946039|gb|EEC24652.1| hypothetical protein HPB128_142g21 [Helicobacter pylori B128]
 gi|298355133|emb|CBI66005.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori B8]
          Length = 524

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 112/197 (56%), Gaps = 4/197 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
            +   K ++ LA  LG F  Q+     Q+I++   G        ++ + +L G+++ V  
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALV-AFMLVGVLKPVVG 378

Query: 180 VGANIISAPIIIKENAI 196
              N I+AP + KE  I
Sbjct: 379 DKINYINAPFVAKERDI 395


>gi|42565022|ref|NP_566637.2| D-3-phosphoglycerate dehydrogenase, putative / 3-PGDH, putative
           [Arabidopsis thaliana]
 gi|11994471|dbj|BAB02473.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 588

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  ++N    +  K GV I+N ARGG++DE AL   L SG VA+A  DVF V
Sbjct: 245 LHLPLTAATSKMMNDVTFAMMKKGVRIVNVARGGVIDEEALLRALDSGIVAQAALDVFTV 304

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP ++ N L    +V   P+LGAST+E+QE V+I++A  +   L   + + A+N  ++  
Sbjct: 305 EPPVKDNKLVLHESVTATPHLGASTMEAQEGVSIEVAEAVIGALRGELAATAVNAPMVPL 364

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +KP++ LA+ LG    QL++    +  +++ Y  S A   ++T +L + V+ GI+
Sbjct: 365 EVLRELKPYVVLAEKLGRLAVQLVTGGSGVNAVKVTYASSRAPDDLDTRLLRAMVIKGII 424

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N++++  I K+  + +S
Sbjct: 425 EPISSVFINLVNSDYIAKQRGVKIS 449


>gi|300866531|ref|ZP_07111221.1| D-3-phosphoglycerate dehydrogenase [Oscillatoria sp. PCC 6506]
 gi|300335488|emb|CBN56381.1| D-3-phosphoglycerate dehydrogenase [Oscillatoria sp. PCC 6506]
          Length = 527

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 110/199 (55%), Gaps = 3/199 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T +++N E L K K    IINCARGG++DE ALA+ L+ G +A A  DV+E 
Sbjct: 199 LHIPKTPETYHLINAEVLEKMKPTARIINCARGGIIDETALAKALEEGQIAGAALDVYEN 258

Query: 61  EP-ALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP    +PL  L       P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  I 
Sbjct: 259 EPLQADSPLRSLGQKAILTPHLGASTAEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGIY 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RV 177
            +    ++P++ LA+ LG  + QL    +  + ++  G  A   +  +  A L G++ + 
Sbjct: 319 PDAIEKLRPYLQLAETLGNLVSQLAGGRVDYLNVLLQGELANNQSQPVVVAALKGLLSQA 378

Query: 178 WRVGANIISAPIIIKENAI 196
            R   N ++A I  KE  I
Sbjct: 379 LRERVNYVNASIEAKERGI 397


>gi|306835934|ref|ZP_07468927.1| phosphoglycerate dehydrogenase [Corynebacterium accolens ATCC
           49726]
 gi|304568208|gb|EFM43780.1| phosphoglycerate dehydrogenase [Corynebacterium accolens ATCC
           49726]
          Length = 528

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 101/174 (58%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + N E L+K K G  +IN ARGGLVDE ALA+ + SGH   AGFDV+  
Sbjct: 201 IHLPKTPETAGMFNAELLAKAKEGQILINAARGGLVDEQALADSITSGHHRGAGFDVYST 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V  +P+LGASTVE+Q++    +A  +   L    V +A+N++  +  
Sbjct: 261 EPCTDSPLFKLPQVTVSPHLGASTVEAQDRAGTDVAASVLKALAGEFVPDAVNVSGGTVG 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V  ++ LA  LG   G+L+ ++   ++I   G  +  +  VL  + + G+
Sbjct: 321 EE--VAGWLDLARKLGLTAGRLLDQAPVAVEIEACGELSTEDVDVLGLSAVRGL 372


>gi|256396892|ref|YP_003118456.1| D-3-phosphoglycerate dehydrogenase [Catenulispora acidiphila DSM
           44928]
 gi|256363118|gb|ACU76615.1| D-3-phosphoglycerate dehydrogenase [Catenulispora acidiphila DSM
           44928]
          Length = 535

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/197 (36%), Positives = 108/197 (54%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ +E L+K K GV IIN ARGG+VDE ALA  ++ G V  AG DVF  
Sbjct: 207 VHLPKTPETLGLIGEEALTKVKPGVRIINAARGGIVDEAALAIAIKEGRVGGAGVDVFLT 266

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PLF L  V   P+LGAST E+QEK  I +A  +   L   +V +A+N+   +  
Sbjct: 267 EPCTESPLFDLDQVVVTPHLGASTDEAQEKAGIAVAKSVRLALAGELVPDAVNVQGGTIA 326

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVWR 179
           E   V+P + LA+ LG     L   +  ++ +I  G     +  VL  A L G+   V  
Sbjct: 327 ED--VRPGLPLAERLGRVFTALAGAAPTQLDVIVRGEITQHDVKVLELAALKGVFADVVE 384

Query: 180 VGANIISAPIIIKENAI 196
              + ++AP++  E  +
Sbjct: 385 HSVSYVNAPLLATERGM 401


>gi|220928617|ref|YP_002505526.1| D-3-phosphoglycerate dehydrogenase [Clostridium cellulolyticum H10]
 gi|219998945|gb|ACL75546.1| D-3-phosphoglycerate dehydrogenase [Clostridium cellulolyticum H10]
          Length = 535

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 110/202 (54%), Gaps = 11/202 (5%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH P T++T  ++ +E L   K  V I+N ARGGLV+E AL   ++ GHVA A  DV + 
Sbjct: 201 LHTPKTSETYGMIGEEQLKLCKKDVRIVNAARGGLVNEEALYNAIKEGHVAAAALDVLDP 260

Query: 61  EP---------ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNA 111
           EP           QN LF L NV   P+LGAST E+   V   ++  +SD L  G +  A
Sbjct: 261 EPNYDKKPEDQDYQNKLFELDNVIITPHLGASTAEANYNVGTAVSKLVSDAL-KGEMVAA 319

Query: 112 LNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVL 171
           +NM  +  ++   +KP++ LA+ LG    Q   E++ +I+I+Y G  A   T +L+ +VL
Sbjct: 320 VNMPPMKNKDLNEMKPYLDLAEILGKIYYQAEKETVNKIEIVYSGELAEQETKILSLSVL 379

Query: 172 AGIVR-VWRVGANIISAPIIIK 192
            G +  V +   N ++A  I K
Sbjct: 380 KGFLDIVIKEKVNYVNAEFIAK 401


>gi|14596141|gb|AAK68798.1| phosphoglycerate dehydrogenase [Arabidopsis thaliana]
          Length = 516

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 119/205 (58%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  ++N    +  K GV I+N ARGG++DE AL   L SG VA+A  DVF V
Sbjct: 173 LHLPLTAATSKMMNDVTFAMMKKGVRIVNVARGGVIDEEALLRALDSGIVAQAALDVFTV 232

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP ++ N L    +V   P+LGAST+E+QE V+I++A  +   L   + + A+N  ++  
Sbjct: 233 EPPVKDNKLVLHESVTATPHLGASTMEAQEGVSIEVAEAVIGALRGELAATAVNAPMVPL 292

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +KP++ LA+ LG    QL++    +  +++ Y  S A   ++T +L + V+ GI+
Sbjct: 293 EVLRELKPYVVLAEKLGRLAVQLVTGGSGVNAVKVTYASSRAPDDLDTRLLRAMVIKGII 352

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N++++  I K+  + +S
Sbjct: 353 EPISSVFINLVNSDYIAKQRGVKIS 377


>gi|260434318|ref|ZP_05788288.1| phosphoglycerate dehydrogenase [Synechococcus sp. WH 8109]
 gi|260412192|gb|EEX05488.1| phosphoglycerate dehydrogenase [Synechococcus sp. WH 8109]
          Length = 528

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 104/177 (58%), Gaps = 2/177 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N E L   K    I+NCARGG+VDE A+AE + +G +A AG DV+  
Sbjct: 199 LHIPRTKDTENLVNAELLRTMKPTARIVNCARGGVVDEEAIAEAINNGVIAGAGLDVYAS 258

Query: 61  EP-ALQNPLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP A  +PL  +   +   P+LGAST E+QE VAI +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLAEDSPLRAVERGLVLTPHLGASTEEAQENVAIDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            E    +KP + LA+ +G  + QL    ++E+++   G  A   +  L  A L G++
Sbjct: 319 AEIMERLKPHLQLAETVGLLVSQLAGGHVKEMELRLQGEFASHPSQPLVIAALKGLL 375


>gi|290967984|ref|ZP_06559533.1| phosphoglycerate dehydrogenase [Megasphaera genomosp. type_1 str.
           28L]
 gi|290781890|gb|EFD94469.1| phosphoglycerate dehydrogenase [Megasphaera genomosp. type_1 str.
           28L]
          Length = 530

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 111/209 (53%), Gaps = 3/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT +T+ ++    ++K K GV +IN +RG ++D  ALA  LQSG VA A  DVF  
Sbjct: 199 LHTPLTKETRGMIGAAEIAKMKRGVRVINVSRGAVLDIQALAAALQSGQVAGAAIDVFPE 258

Query: 61  EPALQ--NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  Q  NP   +  V   P+LGASTVE+Q  V++ +A  +   L    V  A+NMA + 
Sbjct: 259 EPLTQDINPFLHMDQVVLTPHLGASTVEAQIGVSVDVAKGVMAALQGEPVPTAVNMAPVP 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
                +++P+  L + +G     L    ++EIQ+ Y G+ A   T +L +A L G +  +
Sbjct: 319 PNVYNVIRPYFDLLERMGIMGVYLADGPMREIQVEYTGALADTETRLLTTAALKGALNPI 378

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
            +   N ++A  + K   + +  IK   S
Sbjct: 379 LQDAVNFVNAADVAKTRQVTVKEIKSQAS 407


>gi|15645025|ref|NP_207195.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 26695]
 gi|2313497|gb|AAD07461.1| phosphoglycerate dehydrogenase (serA) [Helicobacter pylori 26695]
          Length = 524

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 111/197 (56%), Gaps = 4/197 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV ++NCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILLNCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
            +   K ++ LA  LG F  Q+     Q+I++   G         L + +L G+++ V  
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKD-ALVAFMLVGVLKPVVG 378

Query: 180 VGANIISAPIIIKENAI 196
              N I+AP + KE  I
Sbjct: 379 DKINYINAPFVAKERGI 395


>gi|220913021|ref|YP_002488330.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter chlorophenolicus
           A6]
 gi|219859899|gb|ACL40241.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter chlorophenolicus
           A6]
          Length = 529

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 108/199 (54%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +L  +   K K+   +IN ARGGLVDE AL   LQ G +A AG DVF  
Sbjct: 201 IHMPKTPETVGMLGADAFKKMKNTAYVINVARGGLVDEEALFTALQDGDIAGAGVDVFSK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMA--IIS 118
           EP+   P F L NV   P+LGAST E+QEK  + +A  +   L   +V +A+N+A  +I 
Sbjct: 261 EPSTDLPFFKLDNVVVTPHLGASTDEAQEKAGVSVAKSVRLALAGELVPDAVNVAGGVI- 319

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRV 177
              AP V+P + L + LG     L  +S+ +  I   G  + ++  VL  A L GI   V
Sbjct: 320 ---APDVRPGIPLIEKLGRIFTALTHDSLTQFDIEVAGEISSLDVKVLELAALKGIFADV 376

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+I ++  I
Sbjct: 377 VTEQVSYVNAPVIAEQRGI 395


>gi|90076160|dbj|BAE87760.1| unnamed protein product [Macaca fascicularis]
          Length = 533

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLAGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLDVTT 406


>gi|109014689|ref|XP_001114128.1| PREDICTED: d-3-phosphoglycerate dehydrogenase isoform 3 [Macaca
           mulatta]
          Length = 533

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLAGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLDVTT 406


>gi|90079521|dbj|BAE89440.1| unnamed protein product [Macaca fascicularis]
          Length = 533

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHAPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLAGVVNAQALTSS 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLDVTT 406


>gi|67971102|dbj|BAE01893.1| unnamed protein product [Macaca fascicularis]
          Length = 533

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLAGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLDVTT 406


>gi|152992147|ref|YP_001357868.1| D-3-phosphoglycerate dehydrogenase [Sulfurovum sp. NBC37-1]
 gi|151424008|dbj|BAF71511.1| D-3-phosphoglycerate dehydrogenase [Sulfurovum sp. NBC37-1]
          Length = 529

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 105/199 (52%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++NK+ ++K K GV +INCARGGL +E AL E L+SG +A AG DVF  
Sbjct: 205 IHTPKTEETIGMINKDEIAKMKDGVILINCARGGLYNEEALLEGLKSGKIAMAGIDVFNK 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL  L NV   P+LGA+T ESQ  +AIQ A             NALN+ I   E
Sbjct: 265 EPATDHPLLDLDNVTVTPHLGANTKESQRNIAIQAAENAIAAAKGIAYPNALNLPIKENE 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               V+P++ L   +G    Q+   +++ I++   G  +     +   A +  +      
Sbjct: 325 LPDFVRPYLELIQKMGHLSSQVTKSAVKSIKVTAKGPVSDYLASMQTFATVGVLTESLAD 384

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  I L+
Sbjct: 385 QVNYVNAEFVAKERGIELA 403


>gi|314936177|ref|ZP_07843524.1| phosphoglycerate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
 gi|313654796|gb|EFS18541.1| phosphoglycerate dehydrogenase [Staphylococcus hominis subsp.
           hominis C80]
          Length = 531

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 118/211 (55%), Gaps = 4/211 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KTK I++    ++ K  + IIN ARGG+++EN L   L    +A A  DVFE 
Sbjct: 202 VHTPLTPKTKGIIDAHFFNQAKPTLQIINVARGGIINENDLLNALNHHQIARAALDVFEN 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP L +PL    N+   P+LGAST+E+QEKVA+ +A ++ D L +G V+NA+N   ++  
Sbjct: 262 EPPLDSPLLDHKNIIVTPHLGASTIEAQEKVAVSVAEEIIDILENGNVTNAVNAPKLNLN 321

Query: 121 E-APLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
                 + ++ ++   G    QL+ ++ +EI++ ++G  A   + ++  +++  I++   
Sbjct: 322 HIDEKTQQWLRISQLSGELAIQLLDDAPREIKVTFNGENAKKESDLITRSIVTSILK-QN 380

Query: 180 VG--ANIISAPIIIKENAIILSTIKRDKSGV 208
           +G   N+I+A  ++ E  I      R   G 
Sbjct: 381 LGERVNLINAIALLNEQGITHHIENRASQGT 411


>gi|56752495|ref|YP_173196.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           6301]
 gi|81300310|ref|YP_400518.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           7942]
 gi|56687454|dbj|BAD80676.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           6301]
 gi|81169191|gb|ABB57531.1| D-3-phosphoglycerate dehydrogenase [Synechococcus elongatus PCC
           7942]
          Length = 546

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 120/210 (57%), Gaps = 6/210 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T N++N E L+K K    IINCARGG+++E ALA+ + +G +  A  DV++ 
Sbjct: 216 LHIPKTPETANLINAETLAKMKPTTRIINCARGGVINEQALADAIAAGKIGGAALDVYDQ 275

Query: 61  EP-ALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP    +PL  L  N+   P+LGAST E+Q  VA+ +A Q+ D L+     +A+N+  + 
Sbjct: 276 EPLQADSPLRALGKNLILTPHLGASTTEAQVNVAVDVAEQIRDVLLGLPARSAVNIPGLY 335

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RV 177
            +    ++P++ LA+ LG  + Q+    ++++ +   G  A   +  +  A L G++ + 
Sbjct: 336 PDILEKLRPYLQLAETLGNLLSQVAGGRLEQLTVRLQGELAAQQSQPIVVAALKGLLTQA 395

Query: 178 WRVGANIISAPIIIKENAI-ILSTIKRDKS 206
            R   N ++A I  KE  I I+ T  RD+S
Sbjct: 396 LRERVNYVNAMIEAKERGIRIIET--RDES 423


>gi|52782263|dbj|BAD51978.1| 3-phosphoglycerate dehydrogenase [Macaca fascicularis]
          Length = 533

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLAGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLDVTT 406


>gi|297844730|ref|XP_002890246.1| 3-phosphoglycerate dehydrogenase [Arabidopsis lyrata subsp. lyrata]
 gi|297336088|gb|EFH66505.1| 3-phosphoglycerate dehydrogenase [Arabidopsis lyrata subsp. lyrata]
          Length = 613

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 114/203 (56%), Gaps = 13/203 (6%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVF-E 59
           LH+PLT  TK + N E  SK K GV +IN ARGG++DE+AL   L +G VA+A  DVF E
Sbjct: 281 LHMPLTPATKKVFNDETFSKMKKGVRLINVARGGVIDEDALVRALDAGIVAQAALDVFCE 340

Query: 60  VEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
             P+  + L    NV   P+LGAST E+QE VAI++A  ++  L   + + A+N      
Sbjct: 341 EPPSKDSKLIQHENVTVTPHLGASTKEAQEGVAIEIAEAVAGALRGELSATAVN------ 394

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIVR- 176
             AP+V P   L   + C I  + S+ +Q I+++Y  +     ++T +L + +  GI+  
Sbjct: 395 --APMVDPEFYLTREVSCPI-SIWSKGVQSIRVVYRSARNRDDLDTRLLRAMITKGIIEP 451

Query: 177 VWRVGANIISAPIIIKENAIILS 199
           +     N+++A  I K+  + +S
Sbjct: 452 ISDSYVNLVNADFIAKQKGLRIS 474


>gi|217074366|gb|ACJ85543.1| unknown [Medicago truncatula]
          Length = 473

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 106/180 (58%), Gaps = 5/180 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  + N    +K K+GV IIN ARGG++DE+AL + L SG VA+A  DVF  
Sbjct: 287 LHMPLTPTTNKVFNDNTFAKMKNGVRIINVARGGVIDEDALVKALDSGIVAQAALDVFTE 346

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  + L    NV   P+LGAST E+QE VAI++A  +   L   + + A+N  +++ 
Sbjct: 347 EPPAKDSKLVQHENVIATPHLGASTKEAQEGVAIEIAEAVVGALNGELSATAVNAPMVAP 406

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL+S    IQ ++++Y  +     ++T +L + +  GI+
Sbjct: 407 EVLSELAPYVVLAEKLGRLAVQLVSGGSGIQSVKVVYRSARGPDDLDTRLLRAMITKGII 466


>gi|313673092|ref|YP_004051203.1| d-3-phosphoglycerate dehydrogenase [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939848|gb|ADR19040.1| D-3-phosphoglycerate dehydrogenase [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 540

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 90/152 (59%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
            H PLT +T N++ KE++ K K GV IINCARGG+V+EN L E ++SG V  AG DVFE 
Sbjct: 204 FHTPLTKETHNMIRKEHIDKMKDGVIIINCARGGIVNENDLYEAVKSGKVFAAGVDVFEE 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  L N+F  P++GA+T E Q+ VA+ +A  + + L      NA+N+  +  +
Sbjct: 264 EPPVNNKLLTLDNIFVTPHIGANTHEGQKGVAVIIAENVLNALYGKSYINAVNIPFMKSQ 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQI 152
            +  ++ +  L + +     Q+I   ++   +
Sbjct: 324 LSEELQRYFELTEQMAKLAAQIIKGRVETFNV 355


>gi|166900094|sp|Q60HD7|SERA_MACFA RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|90075028|dbj|BAE87194.1| unnamed protein product [Macaca fascicularis]
          Length = 533

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLAGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLDVTT 406


>gi|87301209|ref|ZP_01084050.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 5701]
 gi|87284177|gb|EAQ76130.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Synechococcus
           sp. WH 5701]
          Length = 528

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 120/211 (56%), Gaps = 7/211 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N E L+  K    ++NCARGG+VDE ALAE + SG +A A  DV+  
Sbjct: 199 LHLPRTPDTENLVNAELLATMKPTARLVNCARGGIVDEKALAEAVSSGTIAGAALDVYGN 258

Query: 61  EP-ALQNPLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  + +PL  + + +   P+LGAST E+QE V++ +A Q+ D L+     +A+N+  ++
Sbjct: 259 EPLEVDSPLRKVGDRLILTPHLGASTEEAQENVSVDVAEQIRDVLLGLPARSAVNIPGLT 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
            E    +KP + LA+ LG  + QL   SIQ++++   G  A   +  L  A L G++   
Sbjct: 319 PEVMERLKPHLQLAETLGLLLSQLAGGSIQDLEVRLQGEFAHHPSQPLVVAALKGLLSSA 378

Query: 179 ---RVGANIISAPIIIKENAIILSTIKRDKS 206
              R+  N ++A I  +   I +  +K D S
Sbjct: 379 LGDRI--NYVNAGIEARSRGIHVLEVKDDAS 407


>gi|109947057|ref|YP_664285.1| D-3-phosphoglycerate dehydrogenase [Helicobacter acinonychis str.
           Sheeba]
 gi|109714278|emb|CAJ99286.1| D-3-phosphoglycerate dehydrogenase [Helicobacter acinonychis str.
           Sheeba]
          Length = 524

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 109/197 (55%), Gaps = 4/197 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL  E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGTKEIERMKKGVILINCARGGLYSEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
            +   K ++ LA  LG F  Q+     Q+I     G        ++ + +L G+++ +  
Sbjct: 322 AS--TKAYLNLAQKLGYFSSQIHKSVCQKIDFSLCGEINQFKDALV-AFMLVGVLKPIVG 378

Query: 180 VGANIISAPIIIKENAI 196
              N I+AP + KE  I
Sbjct: 379 DKINYINAPFVAKERGI 395


>gi|5771523|gb|AAD51415.1|AF171237_1 3-phosphoglycerate dehydrogenase [Homo sapiens]
 gi|2674062|gb|AAB88664.1| 3-phosphoglycerate dehydrogenase [Homo sapiens]
          Length = 533

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLNVTT 406


>gi|148727271|ref|NP_001092041.1| D-3-phosphoglycerate dehydrogenase [Pan troglodytes]
 gi|156633629|sp|A5A6P1|SERA_PANTR RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|146741516|dbj|BAF62414.1| phosphoglycerate dehydrogenase [Pan troglodytes verus]
          Length = 533

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLNVTT 406


>gi|23308577|ref|NP_006614.2| D-3-phosphoglycerate dehydrogenase [Homo sapiens]
 gi|21264510|sp|O43175|SERA_HUMAN RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|12653075|gb|AAH00303.1| Phosphoglycerate dehydrogenase [Homo sapiens]
 gi|12655003|gb|AAH01349.1| Phosphoglycerate dehydrogenase [Homo sapiens]
 gi|15030035|gb|AAH11262.1| Phosphoglycerate dehydrogenase [Homo sapiens]
 gi|48145707|emb|CAG33076.1| PHGDH [Homo sapiens]
 gi|56204622|emb|CAI22212.1| phosphoglycerate dehydrogenase [Homo sapiens]
 gi|56205096|emb|CAI22407.1| phosphoglycerate dehydrogenase [Homo sapiens]
 gi|119577112|gb|EAW56708.1| phosphoglycerate dehydrogenase, isoform CRA_b [Homo sapiens]
 gi|123982516|gb|ABM82999.1| phosphoglycerate dehydrogenase [synthetic construct]
 gi|157928102|gb|ABW03347.1| phosphoglycerate dehydrogenase [synthetic construct]
 gi|189067496|dbj|BAG37755.1| unnamed protein product [Homo sapiens]
 gi|261860040|dbj|BAI46542.1| phosphoglycerate dehydrogenase [synthetic construct]
          Length = 533

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLNVTT 406


>gi|154248802|ref|YP_001409627.1| phosphoglycerate dehydrogenase [Fervidobacterium nodosum Rt17-B1]
 gi|154152738|gb|ABS59970.1| Phosphoglycerate dehydrogenase [Fervidobacterium nodosum Rt17-B1]
          Length = 303

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/102 (54%), Positives = 73/102 (71%), Gaps = 3/102 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT +TKN++NK+ +SK K GV IIN ARGG+VDE+AL E L SG +  AG DVFEV
Sbjct: 196 IHVPLTPETKNLINKDTISKMKDGVIIINAARGGIVDESALYEALLSGKIYAAGLDVFEV 255

Query: 61  EP---ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQM 99
           EP    L+  L  LPNV   P++GAST E+QE+V + L  ++
Sbjct: 256 EPPTDELRQKLLSLPNVVATPHVGASTFEAQERVGMLLVERL 297


>gi|325997911|gb|ADZ50119.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori 2017]
          Length = 524

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 108/196 (55%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ + A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKKAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I++   G        ++   ++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIELSLCGEINQFKDALVAFTLVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|317011252|gb|ADU84999.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           SouthAfrica7]
          Length = 524

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 111/197 (56%), Gaps = 4/197 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL + L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIERMKKGVILINCARGGLYNEDALYDALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
            +   K ++ LA  LG F  Q+     Q+I+    G        ++ + +L G+++ V  
Sbjct: 322 AS--TKAYLNLAQKLGYFSSQIHKGVCQKIEFSLCGEINQFKDALV-AFMLVGVLKPVVG 378

Query: 180 VGANIISAPIIIKENAI 196
              N I+AP + KE  I
Sbjct: 379 DKINYINAPFVAKERGI 395


>gi|217070862|gb|ACJ83791.1| unknown [Medicago truncatula]
          Length = 249

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 105/180 (58%), Gaps = 5/180 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  + N    +K K+GV IIN ARGG++DE+AL + L SG VA+A  DVF  
Sbjct: 63  LHMPLTPTTNKVFNDNTFAKMKNGVRIINVARGGVIDEDALVKALDSGIVAQAALDVFTE 122

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  + L    NV   P+LGAST E+QE VAI++A  +   L   + + A+N  +++ 
Sbjct: 123 EPPAKDSKLVQHENVIATPHLGASTKEAQEGVAIEIAEAVVGALNGELSATAVNAPMVAP 182

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL+S    IQ ++++Y  +     ++T +  + +  GI+
Sbjct: 183 EVLSELAPYVVLAEKLGRLAVQLVSGGSGIQSVKVVYRSARGPDDLDTRLFRAMITKGII 242


>gi|11498419|ref|NP_069647.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus fulgidus DSM
           4304]
 gi|3122861|sp|O29445|SERA_ARCFU RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=PGDH
 gi|2649798|gb|AAB90429.1| phosphoglycerate dehydrogenase (serA) [Archaeoglobus fulgidus DSM
           4304]
          Length = 527

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 110/204 (53%), Gaps = 2/204 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVP T +T  ++ K    K K GV ++N ARGG+VDE AL E +++G VA A  DV+E 
Sbjct: 199 VHVPRTKETIGLIGKGQFEKMKDGVIVVNAARGGIVDEAALYEAIKAGKVAAAALDVYEK 258

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E P+  NPL  L NV   P++ AST E+Q  V + +A  + +      V NA+N+  I  
Sbjct: 259 EPPSPDNPLLKLDNVVTTPHIAASTREAQLNVGMIIAEDIVNMAKGLPVRNAVNLPSIEP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VW 178
            +   + PF+TLA+ +G      +  +I+++++   G  A  NT  +  A+L G+   + 
Sbjct: 319 SDFEFMMPFLTLAEKMGKIASVRLGGAIRKVKVTCSGKLATKNTEFVTRALLKGLFEPIL 378

Query: 179 RVGANIISAPIIIKENAIILSTIK 202
               N++SA  +  E  I +   K
Sbjct: 379 SNEINLVSAKPVAVERGITIEESK 402


>gi|307720842|ref|YP_003891982.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas autotrophica DSM
           16294]
 gi|306978935|gb|ADN08970.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas autotrophica DSM
           16294]
          Length = 528

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 109/209 (52%), Gaps = 3/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T NI++KE ++K K GV ++NCARGGL +E+AL + L+SG +  AG DVF  
Sbjct: 205 IHTPKNQETINIIDKEEVAKMKDGVVLVNCARGGLYNEDALYDGLKSGKIRFAGIDVFVK 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA+ N L  L N+  +P+LGA+T ESQ  +  Q A             NA+N+ I   +
Sbjct: 265 EPAINNKLLDLDNIVVSPHLGANTYESQYNIGTQAAGNAIAAAKGIAYPNAMNLPIDESK 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTM-VLNSAVLAGIVRVWR 179
             P VKPF+ +   +G    Q+    I  I++   G   + N +  L + V  G +    
Sbjct: 325 IPPFVKPFLEMGQKIGFLESQINKSKIVSIKV--KGQGDIANYIDSLATFVTVGALSHST 382

Query: 180 VGANIISAPIIIKENAIILSTIKRDKSGV 208
              N ++A  + KE  I + ++    S V
Sbjct: 383 ESINYVNADFVAKEKGIEVESVNLGDSEV 411


>gi|323359647|ref|YP_004226043.1| phosphoglycerate dehydrogenase [Microbacterium testaceum StLB037]
 gi|323276018|dbj|BAJ76163.1| phosphoglycerate dehydrogenase [Microbacterium testaceum StLB037]
          Length = 534

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 105/201 (52%), Gaps = 7/201 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L + K    +IN ARGGL+DE AL E L +G +A AG DVF  
Sbjct: 201 IHMPKTPETTGMIGAEQLRRMKKTAYVINVARGGLIDEEALFEALTTGEIAGAGLDVFST 260

Query: 61  EPALQ----NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP  +      L  LPNV   P+LGAST E+QEK  + +A  +   L   +V +A+N+A 
Sbjct: 261 EPPAEGGPARKLLDLPNVVVTPHLGASTEEAQEKAGVSVARSVKLALEGDLVPDAVNVAG 320

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV- 175
            + +  P V+P + L + LG F   L   ++  + I   G  A  +  V   A L G   
Sbjct: 321 GAID--PFVRPGIALVEMLGQFFSGLADSALTSLDIEVRGELAAYDVSVYRLAALKGYFS 378

Query: 176 RVWRVGANIISAPIIIKENAI 196
           R+     + ++AP+  ++  +
Sbjct: 379 RIVSESVSYVNAPLFAEQRGV 399


>gi|209523822|ref|ZP_03272375.1| D-3-phosphoglycerate dehydrogenase [Arthrospira maxima CS-328]
 gi|209495854|gb|EDZ96156.1| D-3-phosphoglycerate dehydrogenase [Arthrospira maxima CS-328]
          Length = 527

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 114/199 (57%), Gaps = 3/199 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T +++N + L++ K    IINCARGG+VDE ALAE L++  +A A  DV+E 
Sbjct: 199 LHMPKTEETYHLINAQALAQMKPTARIINCARGGIVDEVALAEALKNDQIAGAAVDVYEN 258

Query: 61  EPALQN-PLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  +N PL  L   V   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  + 
Sbjct: 259 EPLEENSPLRELGQKVILTPHLGASTEEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGLY 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RV 177
            +    +KP++ LA+ LG  + QL+   +  + I   G  A  ++  +  A L G++ + 
Sbjct: 319 PDALEQLKPYLQLAETLGNLVSQLVGGRVDFLDIRLQGDLANRDSKPVVVAALKGLLSQA 378

Query: 178 WRVGANIISAPIIIKENAI 196
            R   N ++A I  KE  I
Sbjct: 379 LRERVNYVNATIEAKERGI 397


>gi|193787479|dbj|BAG52685.1| unnamed protein product [Homo sapiens]
          Length = 499

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 171 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 230

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 231 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSA 290

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 291 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 350

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 351 QADVNLVNAKLLVKEAGLNVTT 372


>gi|56204623|emb|CAI22213.1| phosphoglycerate dehydrogenase [Homo sapiens]
 gi|56205098|emb|CAI22409.1| phosphoglycerate dehydrogenase [Homo sapiens]
          Length = 499

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 171 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 230

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 231 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSA 290

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 291 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 350

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 351 QADVNLVNAKLLVKEAGLNVTT 372


>gi|325963764|ref|YP_004241670.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323469851|gb|ADX73536.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 529

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 108/199 (54%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +L  +   K K+   ++N ARGGLVDE AL   LQ G +A AG DVF  
Sbjct: 201 IHMPKTPETVGMLGADAFKKMKNTAYVVNVARGGLVDEEALFTALQDGEIAGAGVDVFAK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMA--IIS 118
           EP+   P F L NV   P+LGAST E+QEK  + +A  +   L   +V +A+N+A  +I 
Sbjct: 261 EPSTDLPFFKLDNVVVTPHLGASTDEAQEKAGVSVAKSVRLALAGELVPDAVNVAGGVI- 319

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRV 177
              AP V+P + L + LG     L  +S+ +  +   G  + ++  VL  A L GI   V
Sbjct: 320 ---APDVRPGIPLVEKLGRIFTALTHDSLTQFDVEVAGEISSLDVKVLELAALKGIFADV 376

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+I ++  I
Sbjct: 377 VTEQVSYVNAPVIAEQRGI 395


>gi|5771521|gb|AAD51414.1|AF171236_1 3-phosphoglycerate dehydrogenase [Homo sapiens]
          Length = 405

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 77  VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 136

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 137 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSA 196

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 197 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 256

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 257 QADVNLVNAKLLVKEAGLNVTT 278


>gi|119577111|gb|EAW56707.1| phosphoglycerate dehydrogenase, isoform CRA_a [Homo sapiens]
          Length = 438

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 110 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 169

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 170 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSA 229

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 230 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 289

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 290 QADVNLVNAKLLVKEAGLNVTT 311


>gi|159031923|dbj|BAF91727.1| 3-phosphoglycerate dehydrogenase [Aphanothece halophytica]
          Length = 526

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 67/198 (33%), Positives = 113/198 (57%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T+N++N E L+K K    IINC+RGG++DE ALA  +++G +  A  DVF  
Sbjct: 199 LHIPRTPETENLINAEALAKMKPTTRIINCSRGGVIDEEALATAVENGTIGGAALDVFAE 258

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++ L  +  N+   P+LGAST E+Q  VA+ +A Q+ D L+     +A+N+  ++ 
Sbjct: 259 EPLGESKLREVGSNIVLTPHLGASTEEAQTNVAVDVAEQIRDVLLGLPARSAVNIPGLNP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
           +    ++PF+ LA+ LG  + QL    ++++ +   G      +  +  A L G++ +  
Sbjct: 319 DVLEQLRPFLQLAETLGNLVSQLAGGRVEQLNVRLQGELTDSQSQPIVIAALKGLLSQAL 378

Query: 179 RVGANIISAPIIIKENAI 196
           R   N ++A I  KE  I
Sbjct: 379 RERVNYVNASIEAKERGI 396


>gi|197098608|ref|NP_001126309.1| D-3-phosphoglycerate dehydrogenase [Pongo abelii]
 gi|71153760|sp|Q5R7M2|SERA_PONAB RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|55731044|emb|CAH92238.1| hypothetical protein [Pongo abelii]
          Length = 533

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRGRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G++       L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMRAWAGSPKGAIQVITQGTSLKNAGNCLSPAVIVGLLKEASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLNVTT 406


>gi|110667020|ref|YP_656831.1| D-3-phosphoglycerate dehydrogenase [Haloquadratum walsbyi DSM
           16790]
 gi|109624767|emb|CAJ51173.1| phosphoglycerate dehydrogenase [Haloquadratum walsbyi DSM 16790]
          Length = 534

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 112/209 (53%), Gaps = 6/209 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++T  +++   L     G  +INCARGG+VDE+ALA  ++ G +  A  DVF  
Sbjct: 201 VHTPLTSETAGMISTTELELMDGG-YLINCARGGVVDEDALAAAVEDGVLDGAAVDVFAD 259

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  + L  + N+   P+LGAST  +QE VA  +A Q+        V NALN   +  
Sbjct: 260 EPVAPDSALLSVDNIVVTPHLGASTEAAQENVATSIADQIDAAFAGAPVMNALNAPSVDE 319

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--V 177
              P ++P++ LA+  G    QL+   I  + + Y+G  A  +  +  ++ L G+     
Sbjct: 320 SVFPRIRPYIDLAETAGKIAAQLLDGRISSVSVSYEGDIADEDVELATASALKGVFEPLE 379

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
           W+V  N ++AP I +E  I ++  KR +S
Sbjct: 380 WQV--NAVNAPQIAEERGIDVTESKRLQS 406


>gi|228474509|ref|ZP_04059242.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus hominis SK119]
 gi|228271538|gb|EEK12900.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus hominis SK119]
          Length = 869

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 116/199 (58%), Gaps = 4/199 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KTK I++    ++ K  + IIN ARGG+++EN L   L    +A A  DVFE 
Sbjct: 540 VHTPLTPKTKGIIDAHFFNQAKPTLQIINVARGGIINENDLLNALNQHQIARAALDVFEN 599

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP L +PL    N+   P+LGAST+E+QEKVA+ +A ++ D L +G V+NA+N   ++  
Sbjct: 600 EPPLDSPLLDHKNIIVTPHLGASTIEAQEKVAVSVAEEIIDILENGNVTNAVNAPKLNLN 659

Query: 121 E-APLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
                 + ++ ++   G    QL+ ++ +EI++ ++G  A   + ++  +++  I++   
Sbjct: 660 HIDEKTQQWLRISQLSGELAIQLLDDAPREIKVTFNGENAKKESDLITRSIVTSILK-QN 718

Query: 180 VG--ANIISAPIIIKENAI 196
           +G   N+I+A  ++ E  I
Sbjct: 719 LGERVNLINAIALLNEQGI 737


>gi|223039567|ref|ZP_03609854.1| phosphoglycerate dehydrogenase [Campylobacter rectus RM3267]
 gi|222879138|gb|EEF14232.1| phosphoglycerate dehydrogenase [Campylobacter rectus RM3267]
          Length = 525

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 105/196 (53%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N++ +  ++K K GV +INCARGGL +E AL   L+SG +A AG DVF  
Sbjct: 202 IHTPKTKETTNMIGEAEIAKMKDGVRLINCARGGLYNEEALYNGLKSGKIAFAGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL  L NV   P+LGA+T+ESQ  +A+  A Q           NALN+ I + +
Sbjct: 262 EPATSHPLLELNNVSVTPHLGANTLESQANIAVAAAEQAISAARGISYPNALNLPIKTED 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V+P++ L   +     Q+  ++I+ I+I   G  +     +L  A++  +      
Sbjct: 322 LPPFVEPYIELTSKMAFLAAQINKKAIKAIRIETHGPISEYANSMLTFAIVGALKESLGD 381

Query: 181 GANIISAPIIIKENAI 196
             N I+A  +  E  I
Sbjct: 382 TINYINAKFLCDEKGI 397


>gi|224137644|ref|XP_002327177.1| predicted protein [Populus trichocarpa]
 gi|222835492|gb|EEE73927.1| predicted protein [Populus trichocarpa]
          Length = 597

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 116/205 (56%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  + N E+ S+ K GV I+N ARGG++DE AL   L SG VA+A  DVF  
Sbjct: 254 LHMPLTPATSKMFNDESFSQMKKGVRIVNVARGGVIDEEALVRALDSGTVAQAALDVFTE 313

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++    L  NV   P+LGAST E+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 314 EPPSKDSKLVLHENVTVTPHLGASTTEAQEGVAIEVAEAVVGALKGQLAATAVNAPMLPA 373

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + PF+TL++ LG    QL++    +Q +++ Y  +     ++T +L + +  G++
Sbjct: 374 EILSELAPFVTLSEKLGRLAVQLVAGGRGVQSVKVTYASARGPDDLDTRLLRAMITKGLI 433

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +  V  N+++A    K+  + ++
Sbjct: 434 EPISSVFINLVNADFSAKQRGLRIT 458


>gi|302522080|ref|ZP_07274422.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB78]
 gi|302430975|gb|EFL02791.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB78]
          Length = 531

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 106/199 (53%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K KS V I+N ARGG+VDE ALA  L+ G VA AG DV+  
Sbjct: 204 VHLPKTPETLGLIGDEALHKVKSSVRIVNAARGGIVDEEALASALKEGRVAGAGLDVYTK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 264 EPCTDSPLFQFDQVVCTPHLGASTDEAQEKAGIAVAKSVRLALAGELVPDAVNVQGGVIA 323

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 324 ED----VKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 379

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 380 VAETVSYVNAPLFAQERGV 398


>gi|168014318|ref|XP_001759699.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162689238|gb|EDQ75611.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 575

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 121/216 (56%), Gaps = 9/216 (4%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  TK + N +   K K GV ++N ARG ++DE AL   L SG VA+A  DVF V
Sbjct: 228 LHMPLTPTTKKVFNDDTFRKCKKGVRLVNVARGAVIDEEALLRALDSGIVAQAALDVFAV 287

Query: 61  EPAL-QNPLFGL---PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP    +  F L    NV   P+LGASTVE+QE VA+++A  ++  L   + + A+N  +
Sbjct: 288 EPPKGGDSSFALVQHKNVIATPHLGASTVEAQEGVALEIAEAVAGALAGDLAATAVNAPM 347

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISES--IQEIQIIYDGST--AVMNTMVLNSAVLA 172
           +  E    + P++ LA+ LG    QL+S S  +++++++Y  S     ++T +L + +  
Sbjct: 348 VPAEVIAELTPYVVLAEKLGRLTVQLVSGSAGVKQVKVVYKSSRDDGDLDTRLLRARISK 407

Query: 173 GIVR-VWRVGANIISAPIIIKENAIILSTIKRDKSG 207
           G++  V     N+++A  + K+  + +S  +    G
Sbjct: 408 GLIEPVSDAIINLVNADYVAKQRGLKISEEREPADG 443


>gi|85680324|gb|ABC72353.1| phosphoglycerate dehydrogenase [Haloquadratum walsbyi]
          Length = 536

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 112/209 (53%), Gaps = 6/209 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++T  +++   L     G  +INCARGG+VDE+ALA  ++ G +  A  DVF  
Sbjct: 203 VHTPLTSETAGMISTAELELMDGG-YLINCARGGVVDEDALAAAVEDGVLDGAAVDVFAD 261

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP A  + L  + N+   P+LGAST  +QE VA  +A Q+        V NALN   +  
Sbjct: 262 EPVAPDSALLSVDNIVVTPHLGASTEAAQENVATSIADQIDAAFAGAPVMNALNAPSVDE 321

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--V 177
              P ++P++ LA+  G    QL+   I  + + Y+G  A  +  +  ++ L G+     
Sbjct: 322 SVFPRIRPYIDLAETAGKIAAQLLDGRISSVSVSYEGDIADEDVELATASALKGVFEPLE 381

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
           W+V  N ++AP I +E  I ++  KR +S
Sbjct: 382 WQV--NAVNAPQIAEERGIDVTESKRLQS 408


>gi|291287172|ref|YP_003503988.1| D-3-phosphoglycerate dehydrogenase [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884332|gb|ADD68032.1| D-3-phosphoglycerate dehydrogenase [Denitrovibrio acetiphilus DSM
           12809]
          Length = 544

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 91/152 (59%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
            H PLT++TKN++ K+ ++K K GV IINCARGG+V+E  L +  +SG V  AG DVF  
Sbjct: 204 FHTPLTDETKNLITKDEIAKMKDGVVIINCARGGIVNELDLVDACKSGKVTAAGLDVFMS 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + +P F + N++  P++GA+T E Q  VA+ +A Q+ + L      NA+N+  +  +
Sbjct: 264 EPPVNHPFFDVENIYVTPHIGANTAEGQYGVAVIIAEQVVNALHGRSYKNAVNIPFMKTQ 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQI 152
               ++ +  L +++G    QL     + I+I
Sbjct: 324 LPEDMQKYFELLENIGHMAAQLTKGRPERIEI 355


>gi|329727877|gb|EGG64327.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU144]
          Length = 531

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 115/208 (55%), Gaps = 4/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KT+ I+     +K K  + IIN ARGG++DE AL E L +  +  A  DVFE 
Sbjct: 202 VHTPLTPKTRGIVGSSFFNKAKQNLQIINVARGGIIDETALIEALDNNLIDRAAIDVFEH 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL     +   P+LGASTVE+QEKVA+ ++ ++ + L  G V +A+N   +   
Sbjct: 262 EPPTDSPLIQHDKIIVTPHLGASTVEAQEKVAVSVSEEIIEILTKGNVEHAVNAPKMDLS 321

Query: 121 EA-PLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           +     + F+ L+  +G F  QL+  +  EI++ Y G  A  +T ++   ++  I++   
Sbjct: 322 KVDKTTQSFIGLSTTIGEFAIQLLDGAPSEIKVKYAGDLARNDTSLITRTIITNILK-ED 380

Query: 180 VG--ANIISAPIIIKENAIILSTIKRDK 205
           +G   NII+A  I+ +  +  +  K+ K
Sbjct: 381 LGNEVNIINALAILNQQGVTYNIEKQKK 408


>gi|318061963|ref|ZP_07980684.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. SA3_actG]
 gi|318077433|ref|ZP_07984765.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. SA3_actF]
          Length = 531

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 106/199 (53%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K KS V I+N ARGG+VDE ALA  L+ G VA AG DV+  
Sbjct: 204 VHLPKTPETLGLIGDEALHKVKSSVRIVNAARGGIVDEEALASALKEGRVAGAGLDVYTK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 264 EPCTDSPLFQFDQVVCTPHLGASTDEAQEKAGIAVAKSVRLALAGELVPDAVNVQGGVIA 323

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 324 ED----VKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 379

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 380 VAETVSYVNAPLFAQERGV 398


>gi|27468319|ref|NP_764956.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis ATCC
           12228]
 gi|57867245|ref|YP_188860.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           RP62A]
 gi|251811113|ref|ZP_04825586.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282875855|ref|ZP_06284722.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis SK135]
 gi|293366330|ref|ZP_06613010.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|27315865|gb|AAO05000.1|AE016748_234 D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis ATCC
           12228]
 gi|57637903|gb|AAW54691.1| D-3-phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           RP62A]
 gi|251805333|gb|EES57990.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281294880|gb|EFA87407.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis SK135]
 gi|291319568|gb|EFE59934.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329737454|gb|EGG73708.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU028]
 gi|329737488|gb|EGG73741.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis VCU045]
          Length = 531

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 115/208 (55%), Gaps = 4/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KT+ I+     +K K  + IIN ARGG++DE AL E L +  +  A  DVFE 
Sbjct: 202 VHTPLTPKTRGIVGSSFFNKAKQNLQIINVARGGIIDETALIEALDNNLIDRAAIDVFEH 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL     +   P+LGASTVE+QEKVA+ ++ ++ + L  G V +A+N   +   
Sbjct: 262 EPPTDSPLIQHDKIIVTPHLGASTVEAQEKVAVSVSEEIIEILTKGNVEHAVNAPKMDLS 321

Query: 121 EA-PLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           +     + F+ L+  +G F  QL+  +  EI++ Y G  A  +T ++   ++  I++   
Sbjct: 322 KVDKTTQSFIGLSTTIGEFAIQLLDGAPSEIKVKYAGDLAQNDTSLITRTIITNILK-ED 380

Query: 180 VG--ANIISAPIIIKENAIILSTIKRDK 205
           +G   NII+A  I+ +  +  +  K+ K
Sbjct: 381 LGNEVNIINALAILNQQGVTYNIEKQKK 408


>gi|289642877|ref|ZP_06475013.1| D-3-phosphoglycerate dehydrogenase [Frankia symbiont of Datisca
           glomerata]
 gi|289507354|gb|EFD28317.1| D-3-phosphoglycerate dehydrogenase [Frankia symbiont of Datisca
           glomerata]
          Length = 529

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/200 (34%), Positives = 106/200 (53%), Gaps = 8/200 (4%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ ++ L + + GV IIN ARGGLVDE ALA+ ++ G V  AG DVF  
Sbjct: 199 IHLPKTPETIGLIGRDELERVRPGVIIINDARGGLVDEEALADAVRDGRVGGAGIDVFAT 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM---AII 117
           EP   +PLF L NV   P+LGAST E+QEK  + +A  +   L    V +A+N+    ++
Sbjct: 259 EPTTSSPLFELDNVVVTPHLGASTAEAQEKAGVAVARSVRLALRGEFVPDAVNVQAGGVV 318

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VR 176
           + +    V+P + LA+ LG     L       I +   G     +  VL  A L G+   
Sbjct: 319 AED----VRPGLPLAEKLGQLFTGLAGGLAAAITVEVRGEIVAHDVSVLQLAALKGVFTD 374

Query: 177 VWRVGANIISAPIIIKENAI 196
           V       ++AP++ K+  +
Sbjct: 375 VIEEPVTYVNAPLLAKDRGV 394


>gi|167998190|ref|XP_001751801.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162696899|gb|EDQ83236.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 630

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 118/211 (55%), Gaps = 15/211 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  I N +   K K GV ++N ARGG++DE AL   + SG VA+A  DVF  
Sbjct: 283 LHMPLTPTTDKIFNDDTFKKCKKGVRLVNVARGGVIDEEALLRAIDSGVVAQAALDVFTT 342

Query: 61  EPALQN----PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP  +      L    NV   P+LGASTVE+QE VA+++A  ++  L   + + A+N  +
Sbjct: 343 EPPKEGDSSWALVQHKNVTATPHLGASTVEAQEGVAVEIAEAVAGALAGELAATAVNAPM 402

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIY-----DGSTAVMNTMVLNSA 169
           +  E    + P++TLA+ LG    QL+S    +++++++Y     DG    ++T +L + 
Sbjct: 403 VPAEVITELAPYVTLAEKLGRLAVQLVSGGAGVKQVKVVYRSARDDGD---LDTRLLRAM 459

Query: 170 VLAGIVR-VWRVGANIISAPIIIKENAIILS 199
           +  G++  V     N+++A  + K+  + +S
Sbjct: 460 ITKGLIEPVSSAFINLVNADYVAKQRGLKIS 490


>gi|172040439|ref|YP_001800153.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium urealyticum DSM
           7109]
 gi|171851743|emb|CAQ04719.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium urealyticum DSM
           7109]
          Length = 530

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 110/207 (53%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + + + L+K+K G  IIN ARGGLVDE ALA+ ++SGH+  AGFDV+  
Sbjct: 204 IHLPKTPETSGMFDADLLAKSKKGQIIINAARGGLVDEQALADAIKSGHIRGAGFDVYAS 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L  V   P+LGASTVE+Q++    +A  +   L    V +A+N++     
Sbjct: 264 EPCTDSPLFELDEVVVTPHLGASTVEAQDRAGTDVAASVLKALAGDFVPDAVNVSGGKVS 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V  ++ LA  LG    +L+  +   + +   G  +  +   L  A L G    V  
Sbjct: 324 EE--VALWLNLATKLGAVASKLLDGAPASVVVTARGELSSESIDALGLAALRGTFSGVLD 381

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
                ++AP I ++  + L    +D+S
Sbjct: 382 EQVTFVNAPSIAEQRGVALEVKSQDES 408


>gi|108563420|ref|YP_627736.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori HPAG1]
 gi|107837193|gb|ABF85062.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori HPAG1]
          Length = 524

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 107/196 (54%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + + + K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGTKEIERMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  L NV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLTNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I+I   G        ++   ++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIEISLCGEINQFKDALVAFTLVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|291398138|ref|XP_002715722.1| PREDICTED: phosphoglycerate dehydrogenase [Oryctolagus cuniculus]
          Length = 533

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 106/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    +   +N   ++  
Sbjct: 265 EPPRDRALVDHENVISCPHLGASTREAQSRCGEEIAVQFVDMVKGKSLVGVVNAEALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +P  KP++ LA+ LG  +          IQ++  G++       L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVVTQGASLKNAGNCLSPAVIVGLLKEASK 384

Query: 181 GA--NIISAPIIIKENAIILST 200
            A  N+++A +++KE  + ++T
Sbjct: 385 QAEVNLVNAKLLVKEAGLAVTT 406


>gi|227504457|ref|ZP_03934506.1| phosphoglycerate dehydrogenase [Corynebacterium striatum ATCC 6940]
 gi|227199105|gb|EEI79153.1| phosphoglycerate dehydrogenase [Corynebacterium striatum ATCC 6940]
          Length = 528

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 101/174 (58%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + + E L+K K G  IIN ARGGLVDE ALA+ +++GH   AGFDV+  
Sbjct: 201 IHLPKTEETAGMFDAELLAKAKEGQIIINAARGGLVDEQALADSIKAGHHRGAGFDVYAS 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V  +P+LGASTVE+Q++    +A  +   L    V++A+N++     
Sbjct: 261 EPCTDSPLFELPQVTVSPHLGASTVEAQDRAGTDVADSVLKALAGEFVADAVNVSGGRVG 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V  ++ LA  LG   G+L+ ++   I++   G  +  +   L  + + G+
Sbjct: 321 EE--VAGWLDLARKLGLTAGKLLGQAPVAIEVEARGELSNEDVSALGLSAVRGL 372


>gi|296119581|ref|ZP_06838139.1| phosphoglycerate dehydrogenase [Corynebacterium ammoniagenes DSM
           20306]
 gi|295967464|gb|EFG80731.1| phosphoglycerate dehydrogenase [Corynebacterium ammoniagenes DSM
           20306]
          Length = 528

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 99/174 (56%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + + E L+K K G  IIN ARGGLVDE ALA+ +++GH   AGFDV+  
Sbjct: 201 IHLPKTPETAGMFSSELLAKAKKGQIIINAARGGLVDEQALADSIKAGHHRGAGFDVYAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V   P+LGASTVE+Q++    +A  +   L    V +A+N++     
Sbjct: 261 EPCTDSPLFELPEVVVTPHLGASTVEAQDRAGTDVAESVLKALAGEFVPDAVNVSGGRVG 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V  ++ LA  LG   G+L+  +   I++   G  +  +  VL  + + G+
Sbjct: 321 EE--VAGWLDLARKLGLASGKLLGAAPVAIEVTACGQLSTEDVEVLGLSAVRGL 372


>gi|289523971|ref|ZP_06440825.1| phosphoglycerate dehydrogenase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289502627|gb|EFD23791.1| phosphoglycerate dehydrogenase [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 544

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 117/220 (53%), Gaps = 17/220 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT++T+N++N+E L  TK G  +INCARGG+V+E A A+ L+   +A A FDV  V
Sbjct: 202 LHVPLTHETRNMINEETLKSTKRGAYLINCARGGIVNEGACAKALKEDRLAGAAFDVHVV 261

Query: 61  EPALQNPLFG---LPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EPA ++ LF    +  V   P++GA+T E+Q  VA  +   +   L      NA+N+  +
Sbjct: 262 EPAKESSLFDPAIIEKVVVTPHIGANTREAQRAVAEIVVKNLIKALSGEPYENAVNLPYM 321

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGS-----------TAVMNTMVL 166
             +     + F++LA  +G     +I E + EI +   G                  M  
Sbjct: 322 ENKMTLQEREFLSLARRMGMIAACVIKEHVDEITVAMAGPLFEEVEISLPFEVPYRYMPF 381

Query: 167 NSAVLAGIVRVWRVG--ANIISAPIIIKENAIILSTIKRD 204
            +A L G++ V R+G   N +SAP++ KE+ I +   +R+
Sbjct: 382 TAAALKGLLEV-RLGPEVNAMSAPLLAKEHGISVFESRRE 420


>gi|15606928|ref|NP_214309.1| D-3-phosphoglycerate dehydrogenase [Aquifex aeolicus VF5]
 gi|2984165|gb|AAC07698.1| D-3-phosphoglycerate dehydrogenase [Aquifex aeolicus VF5]
          Length = 533

 Score =  114 bits (285), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 116/213 (54%), Gaps = 8/213 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++TKN+++++     K GV I+NCARGG+++E AL + ++SG +     DV+  
Sbjct: 202 IHAPLTHETKNMIDEKEFEIMKDGVYIVNCARGGIINEKALIKYMESGKIKGVALDVYSK 261

Query: 61  EPALQNPLFGLP------NVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM 114
           EP     +  L       N+  +P++GA+T ESQ  VA+ +A Q+   L    V  A+N 
Sbjct: 262 EPPPPEFIDELKRLADKVNISLSPHIGANTYESQRNVAVIVAQQVLKALKGQTVEYAVNA 321

Query: 115 AIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
                    L+KP++ LA+ LG F+ Q   E I+E+ I   G  A      ++SAVL GI
Sbjct: 322 PFPDLSVLTLIKPYLDLAEKLGKFLVQWTEEGIREVHIEVRGDIAEY-FQPISSAVLKGI 380

Query: 175 V-RVWRVGANIISAPIIIKENAIILSTIKRDKS 206
           +  V     NII+A  + K+  I +  +  +++
Sbjct: 381 LEEVVDFPVNIINAFYVAKDRGIKVEELSSEET 413


>gi|305682015|ref|ZP_07404819.1| phosphoglycerate dehydrogenase [Corynebacterium matruchotii ATCC
           14266]
 gi|305658488|gb|EFM47991.1| phosphoglycerate dehydrogenase [Corynebacterium matruchotii ATCC
           14266]
          Length = 531

 Score =  114 bits (285), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 62/174 (35%), Positives = 102/174 (58%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + + E L+K K G  IIN ARGGLV+E ALA+ ++SGH+  AGFDVF  
Sbjct: 205 IHLPKTPETAGMFDAELLAKAKKGQIIINAARGGLVNEQALADAIRSGHIRGAGFDVFTT 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   + LF LP V   P+LGAST E+Q++    +A  +   L    V++A+N++     
Sbjct: 265 EPCTDSLLFDLPEVVVTPHLGASTAEAQDRAGTDVAASVLKALAGEFVADAVNVSGGQVS 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V  ++ LA  LG  +G++++++   +++   G  +  +  VL  + + G+
Sbjct: 325 EE--VALWLELARKLGLVVGRMLAKAPVRLEVEARGELSTEDVNVLGLSAVRGL 376


>gi|51891147|ref|YP_073838.1| D-3-phosphoglycerate dehydrogenase [Symbiobacterium thermophilum
           IAM 14863]
 gi|51854836|dbj|BAD38994.1| phosphoglycerate dehydrogenase [Symbiobacterium thermophilum IAM
           14863]
          Length = 540

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 104/204 (50%), Gaps = 3/204 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H   T ++  ++    L+  K    I+NCARGG+VDE AL   L+ G +A A  DVF  
Sbjct: 199 IHAAKTPESARLIGAAELALMKPTARIVNCARGGMVDEEALYRALKEGRLAGAALDVFAA 258

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLFGLPNV   P+L AST E+Q+     +A  +   L   +V  A+N+  I  +
Sbjct: 259 EPCTDSPLFGLPNVVVTPHLSASTAEAQDANGRYIAQYVLRALRGELVPEAVNLPQIPRD 318

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
              +V   + LA+ LG F+ Q        I + Y G  A   T +L + VL G +   ++
Sbjct: 319 GVQVVTDHLPLAETLGSFLAQAFPGHADRITVAYSGELAKHPTALLTNTVLKGYL-ATQL 377

Query: 181 G--ANIISAPIIIKENAIILSTIK 202
           G   N I+AP + +   I ++  K
Sbjct: 378 GEHVNYINAPALARRRGIAVNESK 401


>gi|222481126|ref|YP_002567363.1| D-3-phosphoglycerate dehydrogenase [Halorubrum lacusprofundi ATCC
           49239]
 gi|222454028|gb|ACM58293.1| D-3-phosphoglycerate dehydrogenase [Halorubrum lacusprofundi ATCC
           49239]
          Length = 534

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 113/205 (55%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+ ++ ++ L++ + G  +INCARGG+VDE+ALAE +  G +A A  D F  
Sbjct: 200 VHTPLLPETEGMIGEDELAQLEGG-YLINCARGGIVDEDALAEAVDDGILAGAALDSFAE 258

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  Q+ PL  + ++   P+LGAST  +QE VAI  A  +     D  V  ALN   +  
Sbjct: 259 EPLSQDSPLLDVEDIVLTPHLGASTEAAQENVAIDTAEAVLAAFDDEPVLTALNAPSVDE 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--V 177
              P +KP++ +A+  G    QL+   I  ++  Y+G  A  +  ++ ++ L G+     
Sbjct: 319 TAFPRIKPYIAVAETAGKVAAQLLDGRITGVETTYEGDIAEEDVDLVTASALKGVFEPLE 378

Query: 178 WRVGANIISAPIIIKENAIILSTIK 202
           W+V  N ++AP + +E  I ++  K
Sbjct: 379 WQV--NAVNAPRLAEERGIEVTESK 401


>gi|317012830|gb|ADU83438.1| D-3-phosphoglycerate dehydrogenase [Helicobacter pylori
           Lithuania75]
          Length = 524

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 106/196 (54%), Gaps = 2/196 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + +   K GV +INCARGGL +E+AL E L++  V   G DVF  
Sbjct: 202 IHTPKNKETINMIGAKEIECMKKGVILINCARGGLYNEDALYEALETKKVRWLGIDVFSK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + N L  LPNV+  P++GA+T+ESQE+++ Q A  + + L      +ALN+ + +F+
Sbjct: 262 EPGIHNKLLDLPNVYATPHIGANTLESQEEISKQAAQGVMESLRGSSHPHALNLPMQAFD 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +   K ++ LA  LG F  Q+     Q+I+    G        ++   ++  +  V   
Sbjct: 322 AS--AKAYLNLAQKLGYFSSQIHKGVCQKIEFSLCGEINQFKDALVAFTLVGVLKPVVGD 379

Query: 181 GANIISAPIIIKENAI 196
             N I+AP + KE  I
Sbjct: 380 KINYINAPFVAKERGI 395


>gi|221633751|ref|YP_002522977.1| D-3-phosphoglycerate dehydrogenase [Thermomicrobium roseum DSM
           5159]
 gi|221157124|gb|ACM06251.1| phosphoglycerate dehydrogenase SerA [Thermomicrobium roseum DSM
           5159]
          Length = 745

 Score =  114 bits (285), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 64/159 (40%), Positives = 90/159 (56%), Gaps = 1/159 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
            HVP T +T+++L+   +++ K G  +INCARG +VD  ALAE L+SGH+A AG DVF  
Sbjct: 399 FHVPATPETRHMLDARAIARMKPGAIVINCARGEVVDVQALAEALKSGHLAAAGVDVFPE 458

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA Q+PLFGLPNV   P++G S+ E+ E V   +A      L   +V NA+N+   S  
Sbjct: 459 EPAYQSPLFGLPNVVLTPHIGGSSREALEAVGEIIATTTLAALRGEIVPNAVNLPAASL- 517

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTA 159
            AP ++    +A+  G  I  L        Q+   G  A
Sbjct: 518 HAPELRRLTRVAEAAGHLIAVLQPARPTTFQVTVHGQVA 556


>gi|116671082|ref|YP_832015.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter sp. FB24]
 gi|116611191|gb|ABK03915.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter sp. FB24]
          Length = 529

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 106/199 (53%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +L  E   K K    +IN ARGGLVDE AL   L+ G +A AG DVF  
Sbjct: 201 IHMPKTPETVGMLGAEAFKKMKKTAYVINVARGGLVDEEALHAALKDGEIAGAGVDVFVK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMA--IIS 118
           EP+   P F + NV   P+LGAST E+QEK  + +A  +   L   +V +A+N+A  +I 
Sbjct: 261 EPSTDLPFFAMDNVVVTPHLGASTDEAQEKAGVSVAKSVRLALAGELVPDAVNVAGGVI- 319

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRV 177
              AP V+P + L + LG     L   S+ +  +   G  A ++  VL  A L GI   V
Sbjct: 320 ---APDVRPGIPLIEKLGRIFTALTHASLTQFDVEVAGEIASLDVKVLELAALKGIFADV 376

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+I ++  I
Sbjct: 377 VTEQVSYVNAPVIAEQRGI 395


>gi|57167923|ref|ZP_00367063.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
 gi|57021045|gb|EAL57709.1| D-3-phosphoglycerate dehydrogenase [Campylobacter coli RM2228]
          Length = 527

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 103/199 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++    ++K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 204 IHTPKTKETDGMIGANEIAKMKDGIRLINCARGGLYTEEALCEGLKSGKIAWLGIDVFKK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    NV    +LGA+T+ESQ+ +A +   Q           NALN+ I + +
Sbjct: 264 EPATNHPLLDFENVSVTSHLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKTED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G+     T +L  A +  +  +   
Sbjct: 324 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGAIGEYATSMLTFAAVGALSGILGE 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 384 KINYVNAEFVAKEKGVDLS 402


>gi|153952246|ref|YP_001398036.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|152939692|gb|ABS44433.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           doylei 269.97]
          Length = 527

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 105/199 (52%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ K+ ++K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 204 IHTPKTKETNGMIGKQEIAKMKDGIRLINCARGGLYTEEALYEGLKSGKIAWLGIDVFDK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA+ +PL    N+    +LGA+T+ESQ+ +A +   Q  +        NALN+ I + +
Sbjct: 264 EPAINHPLLDFENISVTSHLGANTLESQDNIAREACEQALNAARGVAYPNALNLPIKTED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G        +L  A +  +  +   
Sbjct: 324 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGIIGEYANSMLTFAAVGALGGILGE 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 384 KINYVNAEFVAKEKGVELS 402


>gi|255324581|ref|ZP_05365698.1| phosphoglycerate dehydrogenase [Corynebacterium tuberculostearicum
           SK141]
 gi|255298487|gb|EET77787.1| phosphoglycerate dehydrogenase [Corynebacterium tuberculostearicum
           SK141]
          Length = 528

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 102/174 (58%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + +++ L+K K G  +IN ARGGLVDE ALAE ++S H   AGFDV+  
Sbjct: 201 IHLPKTPETAGMFDRQLLAKAKQGQILINAARGGLVDEAALAESIESRHHRGAGFDVYAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V  +P+LGASTVE+Q++    +A  +   L    V +A+N++  +  
Sbjct: 261 EPCTDSPLFKLPQVTVSPHLGASTVEAQDRAGTDVAESVLKALEGEFVPDAVNVSGGAVR 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           E   V  ++ LA  LG   G+L+ ++   +++   G  +  +  VL  + + G+
Sbjct: 321 EE--VAGWLDLARKLGLTAGRLLGQAPVAVEVEACGELSTEDVEVLGLSAVRGL 372


>gi|271969249|ref|YP_003343445.1| D-3-phosphoglycerate dehydrogenase [Streptosporangium roseum DSM
           43021]
 gi|270512424|gb|ACZ90702.1| D-3-phosphoglycerate dehydrogenase [Streptosporangium roseum DSM
           43021]
          Length = 529

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 106/207 (51%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P + +T  ++  + L   K  V +IN ARGG++DENAL   ++ G VA AG DVF  
Sbjct: 201 VHLPKSKETVGLIGDKELHTVKPSVRLINVARGGIIDENALYSAIKEGRVAGAGIDVFPK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L  V   P+LGAST E+QEK   Q+A  +   L    V +A+N+   +  
Sbjct: 261 EPVTDSPLFELDQVVVTPHLGASTHEAQEKAGTQVARSVKLALAGEFVPDAVNVQGGAVA 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVWR 179
           E   VKP + LA+ LG     L  E    + +   G  A  +  VL  A L GI   V  
Sbjct: 321 ED--VKPGLPLAEKLGRVFTALAGEVATRLDVEVRGEIASQDVRVLELAALKGIFTDVVE 378

Query: 180 VGANIISAPIIIKENAIILSTIKRDKS 206
                ++AP++ K+  + +  +   +S
Sbjct: 379 DSVTYVNAPLLAKDRGVTVELVTSSES 405


>gi|329936828|ref|ZP_08286507.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoaurantiacus
           M045]
 gi|329303753|gb|EGG47637.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseoaurantiacus
           M045]
          Length = 529

 Score =  114 bits (284), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 106/199 (53%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K GV I+N ARGG+VDE AL   L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGAEALRKVKPGVRIVNAARGGIVDEEALYAALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFELDQVVCTPHLGASTDEAQEKAGIAVAKSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 QD----VKPGLPLAEKLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|328778535|ref|XP_001121753.2| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Apis mellifera]
          Length = 513

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/217 (37%), Positives = 121/217 (55%), Gaps = 23/217 (10%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +TKN++N   L+K K GV IIN ARGG+VDE AL   L+SGH A A  DVF  
Sbjct: 204 VHTPLIPQTKNLINATTLAKCKKGVRIINVARGGIVDEEALLNALKSGHCAGAALDVFTE 263

Query: 61  EPALQNPLFGL---PNVFCAPYLGASTVESQEKVAIQLAHQM-------SDYLIDGVVSN 110
           EP   + +  L   P V   P+LGAST E+Q++VA ++A Q        ++Y+I G+V+ 
Sbjct: 264 EPPKNSVILELIAHPKVISTPHLGASTEEAQQRVAEEIAQQFLVLAGRSTEYVITGIVNA 323

Query: 111 ALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQ---EIQIIYDGSTAVMNTMVLN 167
            +  A IS E A     ++ L+  LG  I +++   +      QII  G+  +     ++
Sbjct: 324 PMLSAAISDENA----SWIELSKKLGNLISRILKGKLNITVHNQII--GNKEMEKKTFIH 377

Query: 168 SAVLAGIVR-VWRVGANIISAPIIIKENAIILSTIKR 203
           +AVL GI+    + G N+I+AP + +E  I    IKR
Sbjct: 378 TAVLVGILSGQTKNGLNLINAPTLAQEIGI---DIKR 411


>gi|224437370|ref|ZP_03658342.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
 gi|313143835|ref|ZP_07806028.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
 gi|313128866|gb|EFR46483.1| D-3-phosphoglycerate dehydrogenase [Helicobacter cinaedi CCUG
           18818]
          Length = 526

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 109/206 (52%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +TKN++  + + K K GV +INCARGGL +E  L   L+SG +  AG DVF+ 
Sbjct: 203 IHTPKNAETKNMITSKQIEKMKDGVILINCARGGLYNEKDLYAGLESGKIKWAGIDVFDK 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA+ N L  LPNV+  P++GA+T+ESQE++AIQ A    +        NALN+ +   E
Sbjct: 263 EPAIDNALLNLPNVYVTPHIGANTLESQEQIAIQAAQAAIEAARGSSYPNALNLPVKENE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
              +VKP++ L   LG    Q     I  I I   G  +     +    ++  +      
Sbjct: 323 LPKMVKPYLELMQKLGFLAVQANKGVITSIAIETQGEISEYADSLQTFGLVGALNASLGD 382

Query: 181 GANIISAPIIIKENAIILSTIKRDKS 206
             N ++AP + KE  I L TI + +S
Sbjct: 383 KINYVNAPFVAKERGIELKTICKKQS 408


>gi|55379323|ref|YP_137173.1| D-3-phosphoglycerate dehydrogenase [Haloarcula marismortui ATCC
           43049]
 gi|55232048|gb|AAV47467.1| D-3-phosphoglycerate dehydrogenase [Haloarcula marismortui ATCC
           43049]
          Length = 528

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 112/209 (53%), Gaps = 6/209 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+N++ ++ L+    G  ++NCARGG++DE ALAE ++ G +  A  DVF  
Sbjct: 200 IHTPLTPETENMIGEDELALLDGGY-VVNCARGGIIDEPALAEAVEDGVLKGAALDVFGE 258

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP   + PL  + ++   P+LGAST  +QE VA   A Q+        V+NALN    S 
Sbjct: 259 EPLPDDSPLLDVDDIIVTPHLGASTEAAQENVATSTADQIIAAANGQPVANALNAP--SL 316

Query: 120 EEAPL--VKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV 177
           +EA    V P++ LAD  G    QL    + E+Q+ Y G  A  +   + ++ L G+   
Sbjct: 317 DEATFKQVGPYLDLADTAGRIAVQLFGGHMSEVQVTYAGDIAEEDVEYVTASALKGVFAS 376

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
             +  N ++AP I K+  I ++  K   S
Sbjct: 377 SDLQVNAVNAPQIAKDRGIDVTESKTRTS 405


>gi|986918|gb|AAB67986.1| A10 [Mus musculus]
          Length = 485

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 106/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 157 VHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 216

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 217 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSA 276

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ +G  +          IQ++  G++       L+ AV+  ++R    
Sbjct: 277 FSPHTKPWIGLAEAMGTLMHAWAGSPKGTIQVVTQGTSLKNAGTWLSPAVIVALLREASK 336

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 337 QADVNLVNAKLLVKEAGLNVTT 358


>gi|302558214|ref|ZP_07310556.1| phosphoglycerate dehydrogenase [Streptomyces griseoflavus Tu4000]
 gi|302475832|gb|EFL38925.1| phosphoglycerate dehydrogenase [Streptomyces griseoflavus Tu4000]
          Length = 529

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K GV +IN ARGG+VDE AL   L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGDEALRKVKPGVRVINAARGGIVDEEALYSALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFEFDQVVCTPHLGASTDEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VAETVSYVNAPLFAQERGV 396


>gi|119963300|ref|YP_948230.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter aurescens TC1]
 gi|119950159|gb|ABM09070.1| D-3-phosphoglycerate dehydrogenase [Arthrobacter aurescens TC1]
          Length = 539

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 106/199 (53%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +L  +   K K    +IN ARGGLVDE AL   L+ G +A AG DVF  
Sbjct: 211 IHMPKTPETVGMLGADAFRKMKESAYVINVARGGLVDEEALYTALKEGQIAGAGVDVFVK 270

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMA--IIS 118
           EP+   P F   NV   P+LGAST E+QEK  + +A  +   L   +V +A+N+A  +I 
Sbjct: 271 EPSTDLPFFEFDNVVVTPHLGASTDEAQEKAGVSVAKSVRLALAGELVPDAVNVAGGVI- 329

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRV 177
              AP V+P + L + LG     L   S+ +I +   G  A ++  VL  A L G+   V
Sbjct: 330 ---APDVRPGIPLIEKLGRIFTALTHASLTQIDVEVAGEIAALDVKVLELAALKGVFADV 386

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+I ++  I
Sbjct: 387 VTEQVSYVNAPVIAEQRGI 405


>gi|302546895|ref|ZP_07299237.1| phosphoglycerate dehydrogenase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302464513|gb|EFL27606.1| phosphoglycerate dehydrogenase [Streptomyces himastatinicus ATCC
           53653]
          Length = 529

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 110/209 (52%), Gaps = 7/209 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE ALA  L+ G VA AG DVF  
Sbjct: 202 VHLPKTPETVGLIGDEALHKVKPEVRIVNAARGGIVDEQALASALKEGRVAAAGLDVFAQ 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF   NV   P+LGAST E+QEK  + +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFEFDNVVATPHLGASTDEAQEKAGVDVAKSVRLALAGELVPDAVNVEGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    V+P + LA++LG     L  E    + +   G     N  VL  + L G+   V
Sbjct: 322 ED----VRPCVPLAENLGRIFTALAGEVAVRLDVEVYGDITQHNVKVLELSALKGVFENV 377

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
                + ++AP++ +E  + +      KS
Sbjct: 378 VDQAVSYVNAPLLAQERKVDVRHTTSSKS 406


>gi|226289513|gb|EEH45017.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb18]
          Length = 598

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 117/220 (53%), Gaps = 16/220 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   +S+ K G  I+N ARGG VDE AL E L+SG +A A  DVF  
Sbjct: 209 IHTPLLASTKGMISSAEISQMKRGARILNVARGGTVDEVALLEALESGQLAAAAVDVFTS 268

Query: 61  EPALQN----PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP L +     L   P V   P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 269 EPPLADSSASKLIAHPRVVATPHLGASTVEAQENVSIDVCEQVLHILGGALPRSAVNAPL 328

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISES------IQEIQIIYDGS-TAVMNTMVLNSA 169
           I  EE   ++PF+ L + +G    Q  + S           +IY+G  + + NT  L +A
Sbjct: 329 ILPEEYKKLQPFVHLVEKMGSLYTQHYTSSSTYTANSTAFDLIYEGEISGINNTKPLFAA 388

Query: 170 VLAGIV----RVWRVGANIISAPIIIKENAIILS-TIKRD 204
           ++ G++        V  NI++A +I +E  I+++    RD
Sbjct: 389 LVKGLIAPISNTAGVNVNIVNAELIARERGIVVNEQFSRD 428


>gi|226502750|ref|NP_001148319.1| LOC100281928 [Zea mays]
 gi|195616328|gb|ACG29994.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
 gi|195617508|gb|ACG30584.1| D-3-phosphoglycerate dehydrogenase [Zea mays]
          Length = 590

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/202 (33%), Positives = 115/202 (56%), Gaps = 6/202 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  + N E  ++ + GV IIN +RGG+VDE AL   L +G V++A  DVF  
Sbjct: 246 LHMPLTPSTAKLFNDETFARMRKGVRIINVSRGGVVDEEALLRALDNGTVSQAALDVFTE 305

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L    NV   P+LGAST+E+QE VA+++A  +   L   + + A+N  ++  
Sbjct: 306 EPPPRDSKLVQHENVTVTPHLGASTIEAQEGVALEIAEAVIGALRGDLAATAVNAPMVPA 365

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG  + QL++    I+ ++++Y  +     ++T +L + V  GIV
Sbjct: 366 EVLSELSPYIVLAEKLGRLVVQLVAVGSGIKGVRVVYSSARDPDDLDTRLLRAMVTKGIV 425

Query: 176 R-VWRVGANIISAPIIIKENAI 196
             +     NI++A  + K+  +
Sbjct: 426 EPISSAFVNIVNADYVAKQRGL 447


>gi|149600926|ref|XP_001515318.1| PREDICTED: similar to Phosphoglycerate dehydrogenase
           [Ornithorhynchus anatinus]
          Length = 533

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/198 (31%), Positives = 104/198 (52%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    +K K GV ++NCARGG+VDE AL + LQ G    A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDATFAKCKKGVRVVNCARGGIVDEGALLQALQLGQCGGAALDVFTQ 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L   PNV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVNHPNVISCPHLGASTWEAQSRCGEEIALQFVDMVKGKSLAGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +P  KP+++LA+ LG  +          +Q+   G++       L+ AV+ G+++    
Sbjct: 325 FSPHTKPWLSLAEALGSLLQAWAGSPRGTVQVTTQGASLKNAGNYLSPAVIVGLLKSTAP 384

Query: 181 GA--NIISAPIIIKENAI 196
            A  N+++A ++++E  +
Sbjct: 385 QAEVNLVNARLLVQEAGL 402


>gi|147902547|ref|NP_001091250.1| phosphoglycerate dehydrogenase [Xenopus laevis]
 gi|120577618|gb|AAI30205.1| LOC100037051 protein [Xenopus laevis]
          Length = 509

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/200 (33%), Positives = 102/200 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  ++N    SK K GV +INCARGG++DE AL   LQSG    AG DVF  
Sbjct: 206 VHTPLLPSTTGLINDAAFSKCKQGVKVINCARGGIIDEAALLRALQSGQCGGAGLDVFIE 265

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  +  L   P V   P+LGAST E+Q +   ++A Q+ D + D  +  A+N   +   
Sbjct: 266 EPPRERALVEHPLVISLPHLGASTEEAQNRCGEEIAQQIVDLVKDRALVGAVNAPALFKA 325

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +P  KP++ L + +G  +  L+      +Q+   G         L SAV  G++R  + 
Sbjct: 326 FSPETKPWIQLGEAMGNLLQTLLPSINGNVQVTTSGEILKDAGSFLCSAVTVGLLRGNKE 385

Query: 181 GANIISAPIIIKENAIILST 200
             N+++  +  K   I +S+
Sbjct: 386 KINLVNGSLFAKSTGIQVSS 405


>gi|126696878|ref|YP_001091764.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9301]
 gi|126543921|gb|ABO18163.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9301]
          Length = 528

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 94/158 (59%), Gaps = 2/158 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T+N++N + L   KS   +INCARGGL+DE ALA+ L    +A A  DVF  
Sbjct: 199 LHLPRTPETENLVNMDVLKNMKSSAKLINCARGGLIDEEALAQALNQSLIAGAAIDVFSK 258

Query: 61  EPALQN-PLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP   N PL  +  N+   P+LGAST E+QE VA+ +A Q+ D L+      A+N+  +S
Sbjct: 259 EPLESNSPLLKVEKNLILTPHLGASTREAQENVAVDVAEQIRDVLLGLSARTAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDG 156
            +    +KP + LA+ +G  I QL    IQ++++   G
Sbjct: 319 PDIMDSLKPHLQLAETMGLLISQLSGGQIQKLEVKLQG 356


>gi|194707240|gb|ACF87704.1| unknown [Zea mays]
          Length = 589

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/202 (33%), Positives = 115/202 (56%), Gaps = 6/202 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  + N E  ++ + GV IIN +RGG+VDE AL   L +G V++A  DVF  
Sbjct: 245 LHMPLTPSTAKLFNDETFARMRKGVRIINVSRGGVVDEEALLRALDNGTVSQAALDVFTE 304

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L    NV   P+LGAST+E+QE VA+++A  +   L   + + A+N  ++  
Sbjct: 305 EPPPRDSKLVQHENVTVTPHLGASTIEAQEGVALEIAEAVIGALRGDLAATAVNAPMVPA 364

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG  + QL++    I+ ++++Y  +     ++T +L + V  GIV
Sbjct: 365 EVLSELSPYVVLAEKLGRLVVQLVAVGSGIKGVRVVYSSARDPDDLDTRLLRAMVTKGIV 424

Query: 176 R-VWRVGANIISAPIIIKENAI 196
             +     NI++A  + K+  +
Sbjct: 425 EPISSAFVNIVNADYVAKQRGL 446


>gi|305432051|ref|ZP_07401218.1| phosphoglycerate dehydrogenase [Campylobacter coli JV20]
 gi|304445135|gb|EFM37781.1| phosphoglycerate dehydrogenase [Campylobacter coli JV20]
          Length = 527

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 103/199 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++    ++K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 204 IHTPKTKETDGMIGANEIAKMKDGIRLINCARGGLYTEEALCEGLKSGKIAWLGIDVFKK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    NV    +LGA+T+ESQ+ +A +   Q  +        NALN+ I + +
Sbjct: 264 EPATNHPLLDFENVSVTSHLGANTLESQDNIAREACEQALNAARGVAYPNALNLPIKTED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G      T +L  A +  +  +   
Sbjct: 324 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGVIGEYATSMLTFAAVGALSGILGE 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 384 KINYVNAEFVAKEKGVDLS 402


>gi|320170533|gb|EFW47432.1| D-3-phosphoglycerate dehydrogenase [Capsaspora owczarzaki ATCC
           30864]
          Length = 552

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/187 (35%), Positives = 100/187 (53%), Gaps = 12/187 (6%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT  T+++LN   L+K K GV I+NCARGG+++E AL   L+SGHVA A  DVF+ 
Sbjct: 213 VHTPLTESTRHLLNDAVLAKCKKGVRIVNCARGGIIEEAALLRALESGHVAGAALDVFDE 272

Query: 61  EPA---LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP      N L   PN    P+LGAST E+Q KVA+++  Q+ +      +  A+N   +
Sbjct: 273 EPPKDIANNKLIQHPNCIVTPHLGASTEEAQAKVALEIGQQIVEATHGSQIMGAVNAPAM 332

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLI---------SESIQEIQIIYDGSTAVMNTMVLNS 168
                  +KP++ L   LG    QL+         S+ +  + +   G     ++  L +
Sbjct: 333 MHALRDDLKPWVILGSKLGLLAAQLMVGSAFEKGSSKWLHRLTVTAQGKAIQSSSSTLCA 392

Query: 169 AVLAGIV 175
           AVL GI+
Sbjct: 393 AVLMGIL 399


>gi|110645315|gb|AAI18689.1| hypothetical protein LOC548683 [Xenopus (Silurana) tropicalis]
          Length = 509

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 102/200 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  ++N    +K K GV +INCARGG++DE AL + LQSG    AG DVF  
Sbjct: 206 VHTPLLPSTTGLINDAAFAKCKRGVKVINCARGGIIDEAALLKALQSGQCGGAGLDVFVE 265

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L   P V   P+LGAST E+Q +   ++A Q+ D + D  +  A+N   +   
Sbjct: 266 EPPRDRALVEHPLVISLPHLGASTEEAQNRCGEEIAQQIVDLVKDRALVGAVNAPALFRA 325

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +P  KP++ L + +G  +  L  +    +Q+   G         L SAV  G++R  + 
Sbjct: 326 FSPETKPWIQLGEAMGSLLQTLFPKISGSVQVKTSGDLLKDAGSFLCSAVTVGLLRGNKE 385

Query: 181 GANIISAPIIIKENAIILST 200
             N+++  +  K   I +S+
Sbjct: 386 KINLVNGSLFAKSTGIQVSS 405


>gi|296228521|ref|XP_002759845.1| PREDICTED: D-3-phosphoglycerate dehydrogenase [Callithrix jacchus]
          Length = 533

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 106/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDGTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRTLVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ+I  G+        L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGAPLKNAGTCLSPAVIVGLLKEASK 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A ++++E  + ++T
Sbjct: 385 QADVNLVNAKLLVEEAGLNVTT 406


>gi|254526871|ref|ZP_05138923.1| phosphoglycerate dehydrogenase [Prochlorococcus marinus str. MIT
           9202]
 gi|221538295|gb|EEE40748.1| phosphoglycerate dehydrogenase [Prochlorococcus marinus str. MIT
           9202]
          Length = 528

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 93/158 (58%), Gaps = 2/158 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T+N++N + L   KS   +INCARGGL+DE ALAE L    +  A  DVF  
Sbjct: 199 LHLPRTPETENLVNMDVLKSMKSSAKLINCARGGLIDEEALAEALNKSLIGGAAIDVFSK 258

Query: 61  EPALQN-PLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP   N PL  +  N+   P+LGAST E+QE VA+ +A Q+ D L+      A+N+  +S
Sbjct: 259 EPLESNSPLLKVEKNLILTPHLGASTREAQENVAVDVAEQIRDVLLGLSARTAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDG 156
            +    +KP + LA+ +G  I QL    IQ++++   G
Sbjct: 319 PDIMDSLKPHLQLAETMGLLISQLSGGQIQKLEVKLQG 356


>gi|178056550|ref|NP_001116634.1| D-3-phosphoglycerate dehydrogenase [Sus scrofa]
 gi|166977567|sp|A5GFY8|SERA_PIG RecName: Full=D-3-phosphoglycerate dehydrogenase; Short=3-PGDH
 gi|147223383|emb|CAN13230.1| phosphoglycerate dehydrogenase [Sus scrofa]
          Length = 533

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 105/202 (51%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    +  K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDSTFALCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L     V   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHEKVISCPHLGASTREAQSRCGEEIAIQFVDMVKGRSLAGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ++  G++   +   L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGALMQAWAGSPKGTIQVVTQGTSLKNSGTCLSPAVIVGLLKEASH 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           R   N+++A ++ KE  + ++T
Sbjct: 385 RADVNLVNAKLLEKEAGLHVTT 406


>gi|123969087|ref|YP_001009945.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           AS9601]
 gi|123199197|gb|ABM70838.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. AS9601]
          Length = 528

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 93/158 (58%), Gaps = 2/158 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T+N++N + L   KS   +INCARGGL+DE ALAE L    +  A  DVF  
Sbjct: 199 LHLPRTPETENLVNMKVLKSMKSSAKLINCARGGLIDEEALAEALNESLIGGAAIDVFSK 258

Query: 61  EPALQN-PLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP   N PL  +  N+   P+LGAST E+QE VA+ +A Q+ D L+      A+N+  +S
Sbjct: 259 EPLESNSPLLKVEKNLILTPHLGASTREAQENVAVDVAEQIRDVLLGLSARTAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDG 156
            +    +KP + LA+ +G  I QL    IQ++++   G
Sbjct: 319 PDIMDSLKPHLQLAETMGLLISQLSGGQIQKLEVKLQG 356


>gi|157413916|ref|YP_001484782.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9215]
 gi|157388491|gb|ABV51196.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9215]
          Length = 528

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 93/158 (58%), Gaps = 2/158 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T+N++N + L   KS   +INCARGGL+DE ALAE L    +  A  DVF  
Sbjct: 199 LHLPRTPETENLVNMDVLKSMKSSAKLINCARGGLIDEGALAEALNKSLIGGAAIDVFSK 258

Query: 61  EPALQN-PLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP   N PL  +  N+   P+LGAST E+QE VA+ +A Q+ D L+      A+N+  +S
Sbjct: 259 EPLESNSPLLEVEKNLILTPHLGASTREAQENVAVDVAEQIRDVLLGLSARTAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDG 156
            +    +KP + LA+ +G  I QL    IQ++++   G
Sbjct: 319 PDIMDSLKPHLQLAETMGLLISQLSGGQIQKLEVKLQG 356


>gi|295657214|ref|XP_002789178.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb01]
 gi|226284495|gb|EEH40061.1| D-3-phosphoglycerate dehydrogenase [Paracoccidioides brasiliensis
           Pb01]
          Length = 608

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 118/222 (53%), Gaps = 16/222 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   +S+ K G  ++N ARGG VDE AL E L+SG +A A  DVF  
Sbjct: 214 IHTPLIASTKGMISSAEISQMKRGARVLNVARGGTVDEVALLEALESGQLAAAAVDVFTS 273

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP   +     L   P V   P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 274 EPPFADSSASRLIAHPRVVATPHLGASTVEAQENVSIDVCEQVLQILGGALPRSAVNAPL 333

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISES------IQEIQIIYDGS-TAVMNTMVLNSA 169
           I  EE   ++PF+ L + +G    Q  + S           +IY+G  + + NT  L +A
Sbjct: 334 ILPEEYKKLQPFVHLVEKMGSLYTQHYTSSSTYTANSTAFDLIYEGEISGINNTKPLFAA 393

Query: 170 VLAGIV----RVWRVGANIISAPIIIKENAIILS-TIKRDKS 206
           ++ G++        V  NI++A +I +E  I+++    RD++
Sbjct: 394 LVKGLIAPISNTAGVNVNIVNAELIARERGIVVNEQFSRDQA 435


>gi|296272027|ref|YP_003654658.1| D-3-phosphoglycerate dehydrogenase [Arcobacter nitrofigilis DSM
           7299]
 gi|296096202|gb|ADG92152.1| D-3-phosphoglycerate dehydrogenase [Arcobacter nitrofigilis DSM
           7299]
          Length = 527

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 90/156 (57%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T +++ ++ ++K K GV +INCARGGL +E AL   L+SG +A AG DVF+ 
Sbjct: 204 IHTPKNQETIDMIGEDEIAKMKDGVILINCARGGLYNEEALFNNLKSGKIAMAGIDVFKK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA+ NPL  LPN+    +LGA+T ESQ+++A+Q A    +        NALN+ I   +
Sbjct: 264 EPAINNPLLDLPNITVTAHLGANTRESQKEIAVQAARNAIESARGISYPNALNLPIDESK 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDG 156
               VKP++ L   +     Q    +I+ I +   G
Sbjct: 324 IPSFVKPYIELTQKIAFLSAQTDKTAIRSITVSAQG 359


>gi|289581556|ref|YP_003480022.1| D-3-phosphoglycerate dehydrogenase [Natrialba magadii ATCC 43099]
 gi|289531109|gb|ADD05460.1| D-3-phosphoglycerate dehydrogenase [Natrialba magadii ATCC 43099]
          Length = 528

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 115/205 (56%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ ++  + L   + G  ++N  RGG++ E+ALA  ++ G VA A  DVF  
Sbjct: 199 IHTPLTPETEGMIGPDELDLLEGG-YVVNVGRGGIIQEDALATKVEDGTVAGAALDVFAE 257

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP + ++PL    +V   P+LGAST  +QE VA   A Q++  L    V+NALN   I  
Sbjct: 258 EPLSPESPLLEHDDVIVTPHLGASTEAAQENVATSTAEQVNAALAAEPVANALNAPSIDE 317

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--V 177
              P ++P++ +A+  G    QL+ + I++I++ Y+G  A  +   + ++ L G+     
Sbjct: 318 SAFPRLEPYIDIAETGGKVAAQLLDDRIEDIEVTYEGDIADEDIEFVTASALKGVFEPLE 377

Query: 178 WRVGANIISAPIIIKENAIILSTIK 202
           W+V  N ++AP I ++  + ++  K
Sbjct: 378 WQV--NAVNAPQIAEDRGVDVTESK 400


>gi|62860140|ref|NP_001015929.1| phosphoglycerate dehydrogenase [Xenopus (Silurana) tropicalis]
 gi|89268114|emb|CAJ83914.1| phosphoglycerate dehydrogenase [Xenopus (Silurana) tropicalis]
          Length = 509

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 101/200 (50%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  ++N    +K K GV +INCARGG++DE AL   LQSG    AG DVF  
Sbjct: 206 VHTPLLPSTTGLINDAAFAKCKRGVKVINCARGGIIDEAALLRALQSGQCGGAGLDVFVE 265

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L   P V   P+LGAST E+Q +   ++A Q+ D + D  +  A+N   +   
Sbjct: 266 EPPRDRALVEHPLVISLPHLGASTEEAQNRCGEEIAQQIVDLVKDRALVGAVNAPALFRA 325

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +P  KP++ L + +G  +  L  +    +Q+   G         L SAV  G++R  + 
Sbjct: 326 FSPETKPWIQLGEAMGSLLQTLFPKISGSVQVKTSGDLLKDAGSFLCSAVTVGLLRGNKE 385

Query: 181 GANIISAPIIIKENAIILST 200
             N+++  +  K   I +S+
Sbjct: 386 KINLVNGSLFAKSTGIQVSS 405


>gi|295836361|ref|ZP_06823294.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB74]
 gi|295825983|gb|EFG64595.1| phosphoglycerate dehydrogenase [Streptomyces sp. SPB74]
          Length = 531

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE ALA  L+ G VA AG DV+  
Sbjct: 204 VHLPKTPETLGLIGDEALHKVKPSVRIVNAARGGIVDEEALASALKEGRVAGAGLDVYAK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 264 EPCTDSPLFQFDQVVCTPHLGASTDEAQEKAGIAVAKSVRLALAGELVPDAVNVQGGVIA 323

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 324 ED----VKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 379

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 380 VAETVSYVNAPLFAQERGV 398


>gi|326490081|dbj|BAJ94114.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326504998|dbj|BAK02886.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 613

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 112/202 (55%), Gaps = 6/202 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDV-FE 59
           LH+PLT  T  + N E  +K   GV IIN ARGG+VDE AL   L +G VA+A  DV FE
Sbjct: 270 LHMPLTPSTTKLFNDETFAKMTKGVRIINVARGGVVDEEALLRALDNGTVAQAALDVFFE 329

Query: 60  VEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
             P   + L    NV   P+LGAST E+QE VA+++A  +   L   + + A+N  ++S 
Sbjct: 330 EPPPKDSKLVHHENVTVTPHLGASTTEAQEGVALEIAEAVIGALRGELAATAVNAPMVSA 389

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL++    I+ ++++Y  +     ++T +L + V  GIV
Sbjct: 390 EVLAELSPYVILAEKLGRLAVQLVAGGSGIKAVKVVYSSARDPDDLDTRILRAMVTKGIV 449

Query: 176 R-VWRVGANIISAPIIIKENAI 196
             +     N+++A  + K+  +
Sbjct: 450 EPISSAFVNMVNADYVAKQRGL 471


>gi|301786056|ref|XP_002928441.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Ailuropoda
           melanoleuca]
 gi|281341105|gb|EFB16689.1| hypothetical protein PANDA_018382 [Ailuropoda melanoleuca]
          Length = 533

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    +V   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVDHESVISCPHLGASTKEAQSRCGEEIAIQFVDMVKGKSLAGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ++  G++       L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVVTQGTSLKNAGNCLSPAVIVGLLKDTSS 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 385 QADVNLVNAKLLVKEAGLNVTT 406


>gi|284163372|ref|YP_003401651.1| D-3-phosphoglycerate dehydrogenase [Haloterrigena turkmenica DSM
           5511]
 gi|284013027|gb|ADB58978.1| D-3-phosphoglycerate dehydrogenase [Haloterrigena turkmenica DSM
           5511]
          Length = 528

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 114/205 (55%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ ++ +E L   + G  I+N  RGG++ E+ALA  ++ G +A A  DVF  
Sbjct: 199 IHTPLTPETEGMIGEEELDLLEGG-YIVNVGRGGIIQEDALAAKVEDGTLAGAALDVFAE 257

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP +  +PL     +   P+LGAST  +QE VA   A Q++  L    V+NALN   I  
Sbjct: 258 EPLSPDSPLLEHDEIIVTPHLGASTEAAQENVATSTADQVNAALAGEPVANALNAPSIDE 317

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--V 177
              P ++P++ +A+  G    QL+   I++I+++Y+G  A  +   + ++ L G+     
Sbjct: 318 SAFPRLEPYIDIAETAGKIAAQLLEGRIEDIEVVYEGDIADEDVEFVTASALKGVFEPLE 377

Query: 178 WRVGANIISAPIIIKENAIILSTIK 202
           W+V  N ++AP I ++  + ++  K
Sbjct: 378 WQV--NAVNAPQIAEDRGVDVTESK 400


>gi|224100535|ref|XP_002311914.1| predicted protein [Populus trichocarpa]
 gi|222851734|gb|EEE89281.1| predicted protein [Populus trichocarpa]
          Length = 637

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 115/205 (56%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T+ + N +  +K K+GV IIN ARGG++DE+AL   L SG VA+A  DVF  
Sbjct: 294 LHMPLTPSTEKVFNDDTFAKVKTGVRIINVARGGVIDEDALVRALDSGKVAQAALDVFTE 353

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L     V   P+LGAST E+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 354 EPPPKDSKLVQHERVTVTPHLGASTKEAQEGVAIEIAEAVVGALQGELAATAVNAPMVPA 413

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL++    I+  +++Y  S     ++T +L + +  GI+
Sbjct: 414 EVLSELAPYVVLAEKLGRLAVQLVAGGSGIKSAKVVYRSSRDPDDLDTRLLRAMITKGII 473

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +     N+++A    K+  + +S
Sbjct: 474 EPISDSFINLVNADFTAKQKGLRIS 498


>gi|15791207|ref|NP_281031.1| D-3-phosphoglycerate dehydrogenase [Halobacterium sp. NRC-1]
 gi|169236963|ref|YP_001690163.1| D-3-phosphoglycerate dehydrogenase [Halobacterium salinarum R1]
 gi|10581831|gb|AAG20511.1| phosphoglycerate dehydrogenase [Halobacterium sp. NRC-1]
 gi|167728029|emb|CAP14817.1| phosphoglycerate dehydrogenase [Halobacterium salinarum R1]
          Length = 527

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 108/209 (51%), Gaps = 6/209 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPLT++T  ++ +  L++   G  +IN ARGG+VDE+ALA+  Q G +A A  DVF  
Sbjct: 199 IHVPLTDETDGLIGEAELARMDGG-YVINVARGGVVDEDALADAAQDGVIAGAALDVFRT 257

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP    +PL    ++   P+LGAST  +QE VA   A Q+   L    V NALN      
Sbjct: 258 EPLPAASPLHDADSIITTPHLGASTKAAQENVATDTADQVVAALAGDPVVNALNAPSAER 317

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRV-- 177
                ++PF+ LA+  G     L    I+ + + Y G  A  +  ++ +A   G      
Sbjct: 318 SAFDRIRPFVDLAETAGTVAAALFDPRIERVDVTYQGEVADEDVALVTAAAQQGAFAGLE 377

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDKS 206
           W+V  N ++AP + +E  I ++  K  +S
Sbjct: 378 WQV--NAVNAPRVAEERGIAVTETKNHRS 404


>gi|169619920|ref|XP_001803372.1| hypothetical protein SNOG_13160 [Phaeosphaeria nodorum SN15]
 gi|111058367|gb|EAT79487.1| hypothetical protein SNOG_13160 [Phaeosphaeria nodorum SN15]
          Length = 571

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 110/213 (51%), Gaps = 14/213 (6%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PL   TK ++ K  L   K    I+N ARGG++DE+AL E L +G +A AG DVF  
Sbjct: 208 LHTPLIASTKGMIGKAELETMKPTARILNVARGGMIDEDALVEALDAGTIAGAGIDVFTS 267

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP   N     L   P V   P+LGAST E+QE V+I +  Q+   L   +  +A+N  I
Sbjct: 268 EPPQPNSSATRLIAHPKVVATPHLGASTREAQENVSIDVCEQVVSILSGELPRSAVNAPI 327

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLIS----ESIQ-EIQIIYDGSTAVMNTM-----VL 166
           I  EE   ++PF+ L + +G    Q  S    +S +    IIY+G  A +NT       L
Sbjct: 328 ILPEEYRTLQPFVALVEKMGSLYTQHYSSVKLDSFRTTFDIIYEGKLANINTTKPLFAAL 387

Query: 167 NSAVLAGIVRVWRVGANIISAPIIIKENAIILS 199
              +L  I     +  NI++A ++ KE  I+++
Sbjct: 388 VKGLLTPITSSDGLNINIVNAELLAKERGILIN 420


>gi|320101741|ref|YP_004177332.1| D-3-phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
 gi|319749023|gb|ADV60783.1| D-3-phosphoglycerate dehydrogenase [Isosphaera pallida ATCC 43644]
          Length = 544

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 114/211 (54%), Gaps = 11/211 (5%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVF-E 59
           LHVPLT +T++++     +  K GV I+NCARGGL+DE AL   L +G VA A  DVF  
Sbjct: 206 LHVPLTEETRHLIGPAQFAAMKPGVRIVNCARGGLIDEPALIAALDAGKVAGAAIDVFEP 265

Query: 60  VEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
             P   +PL   P V   P+LGAST E+Q  VA++ A  + D+L +G V  A+NM  +  
Sbjct: 266 EPPPADDPLVRHPKVLVTPHLGASTEEAQISVAVEAARLLIDFLGEGRVRFAVNMPNLDK 325

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
            E   ++  + L   LG    Q+   + + +++ Y G  A  NT ++++A  AG    W 
Sbjct: 326 AELDELRHHLELGRRLGMLHAQMDRGAARSVKLDYRGDIASRNTRLISAAFTAG----WM 381

Query: 180 VGA-----NIISAPIIIKENAI-ILSTIKRD 204
             A     N+++A ++ +E  I I  +  RD
Sbjct: 382 ETALTESVNLVNALVLAQERGIQITESHSRD 412


>gi|86153461|ref|ZP_01071665.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|85843187|gb|EAQ60398.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni HB93-13]
          Length = 527

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 103/199 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ K+ ++K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 204 IHTPKTKETNGMIGKQEIAKMKDGIRLINCARGGLYTEEALYEGLKSGKIAWLGIDVFDK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    N+    +LGA+T+ESQ+ +A +   Q           NALN+ I + +
Sbjct: 264 EPATNHPLLDFENISVTSHLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKTED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G        +L  A +  +  +   
Sbjct: 324 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGIIGEYANSMLTFAAVGALGGILGE 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 384 KINYVNAEFVAKEKGVELS 402


>gi|317969029|ref|ZP_07970419.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CB0205]
          Length = 528

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 116/209 (55%), Gaps = 3/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N E L   KS   I+NCARGG++DE ALAE +++G +A A  DV+  
Sbjct: 199 LHLPRTPDTENLVNAELLRTMKSTARIVNCARGGIIDEAALAEAVENGVIAGAALDVYAK 258

Query: 61  EP-ALQNPLFGLP-NVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP A  +PL  +   +   P+LGAST E+QE VA+ +A Q+ D L+     +A+N+  ++
Sbjct: 259 EPLAADSPLRKVSERLILTPHLGASTEEAQENVAVDVAEQIRDVLLGLPARSAVNIPGLN 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
            E    +KP + LA+ LG  + QL    I E+++   G  A      L  A   G++   
Sbjct: 319 AEVMERLKPHLQLAEILGQLVSQLAGGQISELEVRLQGEFANHPAQPLVIASQKGLLSTA 378

Query: 179 RVGA-NIISAPIIIKENAIILSTIKRDKS 206
              + N ++A +  KE  I +  +K D +
Sbjct: 379 LGDSINFVNAGLEAKERGIHVVEVKDDAA 407


>gi|315929501|gb|EFV08695.1| ACT domain protein [Campylobacter jejuni subsp. jejuni 305]
          Length = 330

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 103/199 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ K+ ++K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 7   IHTPKTKETNGMIGKQEIAKMKDGIRLINCARGGLYTEEALYEGLKSGKIAWLGIDVFDK 66

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    N+    +LGA+T+ESQ+ +A +   Q           NALN+ I + +
Sbjct: 67  EPATNHPLLDFENISVTSHLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKTED 126

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G        +L  A +  +  +   
Sbjct: 127 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGIIGEYANSMLTFAAVGALGGILGE 186

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 187 KINYVNAEFVAKEKGVELS 205


>gi|257069029|ref|YP_003155284.1| D-3-phosphoglycerate dehydrogenase [Brachybacterium faecium DSM
           4810]
 gi|256559847|gb|ACU85694.1| D-3-phosphoglycerate dehydrogenase [Brachybacterium faecium DSM
           4810]
          Length = 535

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 113/211 (53%), Gaps = 7/211 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E  +  K  + I+N ARGGL+DE+AL E L +G +A AG DV+  
Sbjct: 201 VHMPKTPETTGLIGAEQFAIAKPNLHIVNAARGGLIDEDALYEALSTGRIAGAGLDVYSS 260

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP   +     L  L N+   P+LGAST E+QEK  + +A  +   L   +V +A+N+A 
Sbjct: 261 EPPATSESAQRLLELENITLTPHLGASTAEAQEKAGVAVAKSVRLALAGELVPDAVNVAG 320

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR 176
            + ++  LV+P + LAD LG     L  ES + + I   G  A  +   L  + L G+ R
Sbjct: 321 GAIDD--LVRPGVALADRLGQLFTALAGESPELLDIEVHGEIASRDVTALKLSALRGVFR 378

Query: 177 -VWRVGANIISAPIIIKENAIILSTIKRDKS 206
            V     + ++AP++ +E  I +  +  + S
Sbjct: 379 SVVTEQVSYVNAPVLAEERGITVQLVTDETS 409


>gi|315932626|gb|EFV11557.1| phosphoglycerate dehydrogenase [Campylobacter jejuni subsp. jejuni
           327]
          Length = 527

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 103/199 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ K+ ++K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 204 IHTPKTKETNGMIGKQEIAKMKDGIRLINCARGGLYTEEALYEGLKSGKIAWLGIDVFDK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    N+    +LGA+T+ESQ+ +A +   Q           NALN+ I + +
Sbjct: 264 EPATNHPLLDFENISVTSHLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKTED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G        +L  A +  +  +   
Sbjct: 324 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGIIGEYANSMLTFAAVGALGGILGE 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 384 KINYVNAEFVAKEKGVELS 402


>gi|307747791|gb|ADN91061.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni M1]
          Length = 527

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 103/199 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ K+ ++K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 204 IHTPKTKETNGMIGKQEIAKMKDGIRLINCARGGLYTEEALYEGLKSGKIAWLGIDVFDK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    N+    +LGA+T+ESQ+ +A +   Q           NALN+ I + +
Sbjct: 264 EPATNHPLLDFENISVTSHLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKTED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G        +L  A +  +  +   
Sbjct: 324 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGIIGEYANSMLTFAAVGALGGILGE 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 384 KINYVNAEFVAKEKGVELS 402


>gi|283956236|ref|ZP_06373716.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283791956|gb|EFC30745.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 527

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 103/199 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ K+ ++K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 204 IHTPKTKETNGMIGKQEIAKMKDGIRLINCARGGLYTEEALYEGLKSGKIAWLGIDVFDK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    N+    +LGA+T+ESQ+ +A +   Q           NALN+ I + +
Sbjct: 264 EPATNHPLLDFENISVTSHLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKTED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G        +L  A +  +  +   
Sbjct: 324 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGIIGEYANSMLTFAAVGALGGILGE 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 384 KINYVNAEFVAKEKGVELS 402


>gi|332018401|gb|EGI58995.1| D-3-phosphoglycerate dehydrogenase [Acromyrmex echinatior]
          Length = 511

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 114/204 (55%), Gaps = 15/204 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +TKN++N   L+K K GV I+N ARGG+VDE AL   L+SGH   A  DVF  
Sbjct: 204 VHTPLMPETKNLINATTLAKCKKGVYIVNVARGGIVDEEALLNSLKSGHCGGAALDVFVE 263

Query: 61  EP---ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQM-------SDYLIDGVVSN 110
           EP   A+   L   P V   P+LGAST E+Q++VA+++A Q        ++Y + G+V+ 
Sbjct: 264 EPPKNAITLELIKHPKVVATPHLGASTEEAQQRVAVEIAQQFLALSGKSTEYTVTGIVNA 323

Query: 111 ALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAV 170
            +  A ++ E     +P++ L+  LG   G+ +   +  +        A+ +   +++AV
Sbjct: 324 PVLSAAMTAEN----EPWIELSKKLGQLAGRFLKGKLNTVIHSRTVGNAMQDKKFIHTAV 379

Query: 171 LAGIVR-VWRVGANIISAPIIIKE 193
           L GI+    + G N+++AP + ++
Sbjct: 380 LVGILTGQTKNGLNLVNAPTLAQD 403


>gi|312128646|ref|YP_003993520.1| d-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778665|gb|ADQ08151.1| D-3-phosphoglycerate dehydrogenase [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 531

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 112/215 (52%), Gaps = 8/215 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T N+++++   K K GV I+NCARGG+++E  L   ++ G VA A  DV E 
Sbjct: 199 IHTPKTAETYNLISEKEFKKMKRGVRIVNCARGGVINEKDLYNAIKEGIVAAAALDVMER 258

Query: 61  EPALQ-------NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP  +       NPL  L NV   P+LGAST E+Q  +A+ +A ++   L  G+  NA+N
Sbjct: 259 EPNFEIEKQDYYNPLLELDNVVITPHLGASTQEAQVNIAVSIAKEVVAVLKGGIAKNAVN 318

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
           +     E+   + P + LA+ +G    Q       +I+IIY G      T  L  A+L  
Sbjct: 319 LPAFEKEKVDEILPHLELAEAIGKIYIQAERTFANKIEIIYSGEIDPKMTTWLTRALLKA 378

Query: 174 IVRVW-RVGANIISAPIIIKENAIILSTIKRDKSG 207
            +    +   N ++A ++ +E  I +   ++ +SG
Sbjct: 379 YLEFSVQDTVNYVNAQVLAQEQGIEVIESRKQESG 413


>gi|57237720|ref|YP_178968.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni RM1221]
 gi|86150274|ref|ZP_01068501.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88597554|ref|ZP_01100788.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|218562511|ref|YP_002344290.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|57166524|gb|AAW35303.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni RM1221]
 gi|85839390|gb|EAQ56652.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|88190146|gb|EAQ94121.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|112360217|emb|CAL35012.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|284926125|gb|ADC28477.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|315058331|gb|ADT72660.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni S3]
 gi|315927558|gb|EFV06891.1| phosphoglycerate dehydrogenase [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 527

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 103/199 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ K+ ++K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 204 IHTPKTKETNGMIGKQEIAKMKDGIRLINCARGGLYTEEALYEGLKSGKIAWLGIDVFDK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    N+    +LGA+T+ESQ+ +A +   Q           NALN+ I + +
Sbjct: 264 EPATNHPLLDFENISVTSHLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKTED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G        +L  A +  +  +   
Sbjct: 324 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGIIGEYANSMLTFAAVGALGGILGE 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 384 KINYVNAEFVAKEKGVELS 402


>gi|260904884|ref|ZP_05913206.1| D-3-phosphoglycerate dehydrogenase [Brevibacterium linens BL2]
          Length = 530

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 109/197 (55%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++ E     KSG   IN ARGG++DE+ALAE + +G V  AG DV+  
Sbjct: 201 VHMPKTPETIGMISTEEFKAAKSGARFINVARGGIIDEDALAEAVAAGEVGGAGIDVWST 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   + L  L  V   P+LGAST E+QEK  + +A  +   L   +V +A+N+A  +  
Sbjct: 261 EPPEHSALMDLDAVNVTPHLGASTAEAQEKAGVAVAKSVRKALAGELVPDAVNVAGGAIH 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
           E   V+P + LA+ LG  +  L + S+   ++  +G  A  +  VL  + L G+ + V  
Sbjct: 321 ED--VRPGIPLAERLGRVVNSLANSSVTHFKVEVNGEIADKDVSVLKLSALKGLFKDVVS 378

Query: 180 VGANIISAPIIIKENAI 196
              + ++AP++ +E  I
Sbjct: 379 DQVSYVNAPLLAEERGI 395


>gi|157415148|ref|YP_001482404.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|157386112|gb|ABV52427.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81116]
          Length = 527

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 103/199 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ K+ ++K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 204 IHTPKTKETNGMIGKQEIAKMKDGIRLINCARGGLYTEEALYEGLKSGKIAWLGIDVFDK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    N+    +LGA+T+ESQ+ +A +   Q           NALN+ I + +
Sbjct: 264 EPATNHPLLDFENISVTSHLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKTED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G        +L  A +  +  +   
Sbjct: 324 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGIIGEYANSMLTFAAVGALGGILGE 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 384 KINYVNAEFVAKEKGVELS 402


>gi|148926576|ref|ZP_01810258.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|145845270|gb|EDK22364.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8486]
          Length = 529

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 103/199 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ K+ ++K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 206 IHTPKTKETNGMIGKQEIAKMKDGIRLINCARGGLYTEEALYEGLKSGKIAWLGIDVFDK 265

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    N+    +LGA+T+ESQ+ +A +   Q           NALN+ I + +
Sbjct: 266 EPATNHPLLDFENISVTSHLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKTED 325

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G        +L  A +  +  +   
Sbjct: 326 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGIIGEYANSMLTFAAVGALGGILGE 385

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 386 KINYVNAEFVAKEKGVELS 404


>gi|121612205|ref|YP_001000566.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167005499|ref|ZP_02271257.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|87249339|gb|EAQ72299.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 81-176]
          Length = 527

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 103/199 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ K+ ++K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 204 IHTPKTKETNGMIGKQEIAKMKDGIRLINCARGGLYTEEALYEGLKSGKIAWLGIDVFDK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    N+    +LGA+T+ESQ+ +A +   Q           NALN+ I + +
Sbjct: 264 EPATNHPLLDFENISVTSHLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKTED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G        +L  A +  +  +   
Sbjct: 324 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGIIGEYANSMLTFAAVGALGGILGE 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 384 KINYVNAEFVAKEKGVELS 402


>gi|320008407|gb|ADW03257.1| D-3-phosphoglycerate dehydrogenase [Streptomyces flavogriseus ATCC
           33331]
          Length = 530

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE ALA  L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGDEALHKVKPSVRIVNAARGGIVDEEALASALKEGRVAGAGLDVYTK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFQFDQVVCTPHLGASTDEAQEKAGIAVAKSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    V+P + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VRPGLPLAEKLGRIFTALAGEVAARLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|113477612|ref|YP_723673.1| D-3-phosphoglycerate dehydrogenase [Trichodesmium erythraeum
           IMS101]
 gi|110168660|gb|ABG53200.1| D-3-phosphoglycerate dehydrogenase [Trichodesmium erythraeum
           IMS101]
          Length = 527

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 116/207 (56%), Gaps = 3/207 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T++T + +N E  +K K    IINC+RGG++DE AL++ L+ G +A A  DV+E 
Sbjct: 199 LHIPKTDETYHSINAETFAKMKPTARIINCSRGGIIDEVALSKALKEGKIAGAALDVYEN 258

Query: 61  EP-ALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  +++PL  L   +   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  + 
Sbjct: 259 EPLEVESPLRDLGQKIVMTPHLGASTAEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGMY 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RV 177
            +    +KP++ LA+ LG  + QL    I  + +  +G  A  ++  +    L G++ + 
Sbjct: 319 PDTLKKLKPYLRLAETLGNLVSQLAGGRIDFLNVRLEGDLAGGDSKPVVVGALKGLLSQA 378

Query: 178 WRVGANIISAPIIIKENAIILSTIKRD 204
            R   N ++A I  KE  I +   + D
Sbjct: 379 LRERVNYVNAFIEAKERGIRVVETRDD 405


>gi|282861276|ref|ZP_06270341.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. ACTE]
 gi|282563934|gb|EFB69471.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. ACTE]
          Length = 530

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE ALA  L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGDEALHKVKPSVRIVNAARGGIVDEEALASALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFQFDQVVCTPHLGASTDEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    V+P + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VRPGLPLAEKLGRIFTALSGEVAARLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|242242988|ref|ZP_04797433.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis W23144]
 gi|242233589|gb|EES35901.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis W23144]
          Length = 531

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 114/208 (54%), Gaps = 4/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KT+ I+     +K K  + IIN ARGG++DE AL E L +  +  A  DVFE 
Sbjct: 202 VHTPLTPKTRGIVGSSFFNKAKKNLQIINVARGGIIDETALIEALDNNLIDRAAIDVFEH 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL     +   P+LGASTVE+QEKVA+ ++ ++ + L  G V +A+N   +   
Sbjct: 262 EPPTDSPLIQHDKIIVTPHLGASTVEAQEKVAVSVSEEIIEILTKGNVEHAVNAPKMDLS 321

Query: 121 EAP-LVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           +     + F+ L+  +G    QL+  +  EI++ Y G  A  +T ++   ++  I++   
Sbjct: 322 KVDETTQSFIGLSTTIGELAIQLLDGAPSEIKVKYAGDLAQNDTSLITRTIITNILK-ED 380

Query: 180 VG--ANIISAPIIIKENAIILSTIKRDK 205
           +G   NII+A  I+ +  +  +  K+ K
Sbjct: 381 LGNEVNIINALAILNQQGVTYNIEKQKK 408


>gi|33240885|ref|NP_875827.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
 gi|33238414|gb|AAQ00480.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 528

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 105/178 (58%), Gaps = 4/178 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T++T+N+++ + LS  K    ++NCARGG++DE ALAE L S  +  A  DV+  
Sbjct: 199 LHLPRTSETENLVDAKLLSSMKQNARLVNCARGGIIDETALAEALNSNVIGGAALDVYSQ 258

Query: 61  EPALQN--PLFGLP-NVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP L+N  PL  +  N+   P+LGAST E+Q+ VAI +A Q+ D L+     +A+N+  +
Sbjct: 259 EP-LKNDSPLLNVKNNLILTPHLGASTAEAQQNVAIDVAEQIRDVLLGLPARSAVNIPGL 317

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
           S E    +KP + LA+ LG    Q+    IQ+I++   G  +   +  L  A L G++
Sbjct: 318 SAEIMDSLKPHLQLAESLGLLASQVSGGQIQKIEVKLQGEFSQHPSQPLVIATLKGLL 375


>gi|330934580|ref|XP_003304604.1| hypothetical protein PTT_17253 [Pyrenophora teres f. teres 0-1]
 gi|311318673|gb|EFQ87289.1| hypothetical protein PTT_17253 [Pyrenophora teres f. teres 0-1]
          Length = 586

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 112/214 (52%), Gaps = 16/214 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PL   TK ++ K  LS  K    I+N ARGG++DE+AL E L +G +A AG DVF  
Sbjct: 208 LHTPLIASTKGMIGKSELSTMKPTARILNVARGGMIDEDALVEALDAGTIAGAGIDVFTS 267

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP  Q+     L   P V   P+LGAST E+QE V+I +  Q+   L   +  +A+N  I
Sbjct: 268 EPPEQDSSASRLIAHPKVVATPHLGASTKEAQENVSIDVCEQVVSILSGELPRSAVNAPI 327

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQ------EIQIIYDGSTAVMNTM-----V 165
           +  +E   ++P++ L + +G    Q  S S++         +IY+G  A +NT       
Sbjct: 328 VLPDEYRTLQPYINLVEKMGSLYTQHYS-SVKLGSFRTTFDLIYEGKLATINTTKPLFAA 386

Query: 166 LNSAVLAGIVRVWRVGANIISAPIIIKENAIILS 199
           L   +L  I     +  NI++A ++ KE  I+++
Sbjct: 387 LVKGLLTPITSNDGLNINIVNAELLAKERGILIN 420


>gi|319401036|gb|EFV89255.1| phosphoglycerate dehydrogenase [Staphylococcus epidermidis FRI909]
          Length = 531

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 114/208 (54%), Gaps = 4/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT KT+ I+     +K K  + IIN ARGG++DE AL E L +  +  A  DVFE 
Sbjct: 202 VHTPLTPKTRGIVGSSFFNKAKQNLQIINVARGGIIDETALIEALDNDLIDRAAIDVFEH 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL     +   P+LGASTVE+QEKVA+ ++ ++ + L  G V +A+N   +   
Sbjct: 262 EPPTDSPLIQHDKIIVTPHLGASTVEAQEKVAVSVSEEIIEILTKGNVEHAVNAPKMDLS 321

Query: 121 EA-PLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           +     + F+ L+  +G    QL+  +  EI++ Y G  A  +T ++   ++  I++   
Sbjct: 322 KVDETTQSFIGLSTTIGELAIQLLDGAPSEIKVKYAGDLAQNDTSLITRTIITNILK-ED 380

Query: 180 VG--ANIISAPIIIKENAIILSTIKRDK 205
           +G   NII+A  I+ +  +  +  K+ K
Sbjct: 381 LGNEVNIINALAILNQQGVTYNIEKQKK 408


>gi|295394378|ref|ZP_06804602.1| phosphoglycerate dehydrogenase [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294972730|gb|EFG48581.1| phosphoglycerate dehydrogenase [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 527

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 109/199 (54%), Gaps = 3/199 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ +E  +K K  V IIN ARGG+VDE ALA+ ++ G V  AG DVF  
Sbjct: 200 VHMPKTPETIGMIGEEAFTKVKPTVRIINVARGGIVDEAALAKAVEDGRVGGAGIDVFTQ 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP + +PL     +   P+LGAST E+QEK  I +A  +   L   +V +A+N+A  + +
Sbjct: 260 EPPVDSPLMAHDRINVTPHLGASTAEAQEKAGIAVAQSVRKALAGELVPDAVNVAGGAID 319

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVWR 179
             P V+P + L + LG  +  +  + +  +++   G     +  VL  + L G+ + V  
Sbjct: 320 --PQVRPGIALTERLGRVVSAMAGDPVTHLRVEVRGEVTQKDVSVLKLSALKGLFLDVVD 377

Query: 180 VGANIISAPIIIKENAIIL 198
              + ++AP+  +E  + +
Sbjct: 378 GAVSYVNAPLFAQERGVTV 396


>gi|189201403|ref|XP_001937038.1| D-3-phosphoglycerate dehydrogenase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187984137|gb|EDU49625.1| D-3-phosphoglycerate dehydrogenase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 573

 Score =  112 bits (280), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 111/213 (52%), Gaps = 16/213 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PL   TK ++ K  LS  K    I+N ARGG++DE+AL E L +G +A AG DVF  
Sbjct: 208 LHTPLIASTKGMIGKSELSTMKPTARILNVARGGMIDEDALVEALDAGTIAGAGIDVFTS 267

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP  Q+     L   P V   P+LGAST E+QE V+I +  Q+   L   +  +A+N  I
Sbjct: 268 EPPEQDSSASRLIAHPKVVATPHLGASTKEAQENVSIDVCEQVVSILSGELPRSAVNAPI 327

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQ------EIQIIYDGSTAVMNTM-----V 165
           +  +E   ++P++ L + +G    Q  S S++         + Y+G  A +NT       
Sbjct: 328 VLPDEYRTLQPYINLVEKMGSLYTQHYS-SVKLGSFRTTFDLTYEGKLATINTTKPLFAA 386

Query: 166 LNSAVLAGIVRVWRVGANIISAPIIIKENAIIL 198
           L   +L  I   + +  NI++A ++ KE  I++
Sbjct: 387 LVKGLLTPITSNYGLNINIVNAVLLAKERGILI 419


>gi|78223581|ref|YP_385328.1| D-3-phosphoglycerate dehydrogenase [Geobacter metallireducens
           GS-15]
 gi|78194836|gb|ABB32603.1| D-3-phosphoglycerate dehydrogenase [Geobacter metallireducens
           GS-15]
          Length = 541

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 118/210 (56%), Gaps = 7/210 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++T+N++ +  L+  K GV I+N ARGG+++E AL + L+SG +  A  DVF V
Sbjct: 200 VHTPLTDETRNMIGERELAMMKDGVIIVNAARGGIIEEEALLKYLESGKITGAAIDVFSV 259

Query: 61  EPALQNPLFGL---PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP   + L  L     V   P+LGA+T E+Q  VA+ ++ ++ +YL D  + NA+N+   
Sbjct: 260 EPPKTDVLQKLIAHERVIVTPHLGANTFEAQVNVAVDVSKEILNYLDDLPLENAVNIPRF 319

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-R 176
                  ++PF+ L   +  F+ QL+  +I  +   Y G+ A  +   L+   L+ I+ R
Sbjct: 320 DLALMDQMRPFLNLMSVMSDFVIQLVDANIDTVTFSYAGNIAHYDCTPLSVCGLSSILNR 379

Query: 177 VWRVGANIISAPIIIKENAIILSTIKRDKS 206
           +     N+++A +I  +  I   T++ +KS
Sbjct: 380 LVEQDVNMVNATLIADQMGI---TVEENKS 406


>gi|78779836|ref|YP_397948.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9312]
 gi|78713335|gb|ABB50512.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9312]
          Length = 528

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 93/158 (58%), Gaps = 2/158 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T+N++N + L   KS   +INCARGGL+DE ALAE L    +  A  DVF  
Sbjct: 199 LHLPRTPETENLVNMKVLKSMKSSAKLINCARGGLIDEEALAEALNQSFIGGAAIDVFSK 258

Query: 61  EP-ALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP    +PL  +  N+   P+LGAST E+QE VA+ +A Q+ D L+      A+N+  +S
Sbjct: 259 EPLESDSPLLQVEKNLILTPHLGASTREAQENVAVDVAEQIRDVLLGLSARTAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDG 156
            +    +KP + LA+ +G  + QL    IQ++++   G
Sbjct: 319 PDIMDSLKPHLQLAETMGLLVSQLAGGQIQKLEVKLQG 356


>gi|297156963|gb|ADI06675.1| D-3-phosphoglycerate dehydrogenase [Streptomyces bingchenggensis
           BCW-1]
          Length = 534

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE ALA  L+ G VA AG DVF  
Sbjct: 206 VHLPKTPETVGLIGDEALHKVKPEVRIVNAARGGIVDEEALAAALKEGRVAAAGLDVFSK 265

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF   NV   P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 266 EPCTDSPLFEFDNVVATPHLGASTGEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 325

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    V+P + LA+ LG     L  E    + +   G     +  VL  + L G+   +
Sbjct: 326 EE----VRPGLPLAEKLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDI 381

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 382 VDETVSYVNAPLFAQERGV 400


>gi|78184104|ref|YP_376539.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9902]
 gi|78168398|gb|ABB25495.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CC9902]
          Length = 528

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 65/177 (36%), Positives = 103/177 (58%), Gaps = 2/177 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N + L   K    I+NCARGG+VDE A++E +  G +A AG DV+  
Sbjct: 199 LHIPRTKDTENLVNADLLRTMKPTARIVNCARGGVVDEAAISEAINQGVIAGAGLDVYAS 258

Query: 61  EP-ALQNPLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP A  +PL  +   +   P+LGAST E+QE VAI +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLAEDSPLRAVERGLVLTPHLGASTEEAQENVAIDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            E    +KP + L++ +G  + QL    ++E+++   G  A   +  L  A L G++
Sbjct: 319 AEIMERLKPHLQLSETVGLLVSQLAGGHVKEMELRLQGEFASHPSQPLVIAALKGLL 375


>gi|319441148|ref|ZP_07990304.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium variabile DSM
           44702]
          Length = 531

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 111/210 (52%), Gaps = 9/210 (4%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + N E L+K+K G  IIN ARGGLVDE ALA+ ++ G +  AGFDV+  
Sbjct: 204 IHLPKTKETAGMFNAELLAKSKKGQIIINAARGGLVDEQALADAIKDGQIRGAGFDVYSK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L  V   P+LGASTVE+Q++    +A  +   L    V +A+N+      
Sbjct: 264 EPCTDSPLFELDEVVVTPHLGASTVEAQDRAGTDVAASVLKALAGDFVPDAVNVTGGRVS 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDG--STAVMNTMVLNS--AVLAGIVR 176
           E   V  ++ LA  LG     L+   +  + +   G  S+  ++ + L++   V AG+V 
Sbjct: 324 EE--VALWLNLATKLGKVASALLDAPVASVSVEARGELSSESVDALGLSALRGVFAGVVD 381

Query: 177 VWRVGANIISAPIIIKENAIILSTIKRDKS 206
                   ++ P I +E  + LS    D+S
Sbjct: 382 EQ---VTFVNTPQIAEERGVELSVSTADES 408


>gi|84498265|ref|ZP_00997062.1| probable D-3-phosphoglycerate dehydrogenase [Janibacter sp.
           HTCC2649]
 gi|84381765|gb|EAP97648.1| probable D-3-phosphoglycerate dehydrogenase [Janibacter sp.
           HTCC2649]
          Length = 528

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 110/198 (55%), Gaps = 9/198 (4%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P + +T  +L KE  +K K  V IIN ARGG+VDE ALA+ L+ G VA AG DVF +
Sbjct: 201 VHLPKSPETLGLLGKEAFAKVKPSVRIINAARGGIVDEQALADALRDGLVAGAGIDVFAI 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMA--IIS 118
           EP  ++PLF   +V   P+LGAST E+QEK  + +A  +   L   +V +A+N+A  +++
Sbjct: 261 EPTTESPLFEFESVVVTPHLGASTDEAQEKAGVAVAKSVRLALGGDLVPDAVNVAGGVVA 320

Query: 119 FEEAPLVKPFMTLADHLG-CFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VR 176
            E    V+P + L + LG  F G   S  +Q + I   G     +  V   A L G+   
Sbjct: 321 EE----VRPGIDLVEKLGRIFTGVAGSVPVQ-LDIDVRGEITEHDVSVWELAALKGVFTD 375

Query: 177 VWRVGANIISAPIIIKEN 194
           V       ++AP++ KE 
Sbjct: 376 VTEDAVTYVNAPLLAKER 393


>gi|290957185|ref|YP_003488367.1| D-3-phosphoglycerate dehydrogenase [Streptomyces scabiei 87.22]
 gi|260646711|emb|CBG69808.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces scabiei
           87.22]
          Length = 529

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE AL   L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETVGLIGAEALQKVKPSVRIVNAARGGIVDEAALYSALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFELDEVVCTPHLGASTDEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|116071264|ref|ZP_01468533.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. BL107]
 gi|116066669|gb|EAU72426.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. BL107]
          Length = 528

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 65/177 (36%), Positives = 103/177 (58%), Gaps = 2/177 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N + L   K    I+NCARGG+VDE A++E +  G +A AG DV+  
Sbjct: 199 LHIPRTKDTENLVNADLLRTMKPTARIVNCARGGVVDEAAISEAINQGVIAGAGLDVYAS 258

Query: 61  EP-ALQNPLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP A  +PL  +   +   P+LGAST E+QE VAI +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLAEDSPLRAVERGLVLTPHLGASTEEAQENVAIDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            E    +KP + L++ +G  + QL    ++E+++   G  A   +  L  A L G++
Sbjct: 319 AEIMERLKPHLQLSETVGLLVSQLAGGHVKEMELRLQGEFASHPSQPLVIAALKGLL 375


>gi|311898491|dbj|BAJ30899.1| putative D-3-phosphoglycerate dehydrogenase [Kitasatospora setae
           KM-6054]
          Length = 528

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE+AL   LQ G VA AG DV+  
Sbjct: 203 VHLPKTPETIGLIGDEALHKVKPSVRIVNAARGGIVDEDALLRALQEGRVAGAGLDVYSK 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF   NV   P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 263 EPCTDSPLFAFDNVVATPHLGASTDEAQEKAGIAVAKSVRLALAGELVPDAVNVQGGVIA 322

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    V+P + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 323 ED----VRPGLPLAEKLGRIFTALAGEVAVRLDVEVRGEITQHDVKVLELSALKGVFEDV 378

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 379 VAETVSYVNAPLFAQERGV 397


>gi|322419774|ref|YP_004198997.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M18]
 gi|320126161|gb|ADW13721.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M18]
          Length = 532

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 116/210 (55%), Gaps = 4/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++T N++ K+ L+  K GV +IN ARGG+++E A+ E L SG VA A FDV+  
Sbjct: 200 VHTPLTSETHNMIGKKELAHMKEGVIVINAARGGIINEEAMLEALDSGRVAGAAFDVWSQ 259

Query: 61  EPALQNPLFGL---PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP   + L  L     +   P+LGA+T E+Q  VA+ ++ ++  YL +  + NA+N+   
Sbjct: 260 EPPDSDVLKKLIAHEKMVVTPHLGANTFEAQVNVAVDVSREILHYLDEQPIENAINIPRF 319

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-R 176
                  ++P++ L + L  FI QL+  ++ +I   Y G  A+ +   +    LA ++ R
Sbjct: 320 DASLMGQMRPYLNLMNVLSDFIIQLVDTNLNKITFSYTGHLALHDCTPITVCGLAALLNR 379

Query: 177 VWRVGANIISAPIIIKENAIILSTIKRDKS 206
                 N+++A ++     I++  +K  +S
Sbjct: 380 RVEQDVNMVNAQLVADNMGIVVEEVKSSQS 409


>gi|194210920|ref|XP_001501069.2| PREDICTED: similar to phosphoglycerate dehydrogenase isoform 1
           [Equus caballus]
          Length = 545

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 217 VHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 276

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 277 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAIQFVDMVKGKSLAGVVNAQALTSV 336

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW-- 178
            +P  K ++ LA+ LG  +          IQ++  G++       L++AV+ G+++    
Sbjct: 337 FSPHTKAWIGLAEALGALMRAWAGSPKGTIQVVTQGTSLKDAGSCLSAAVIVGLLKKTSD 396

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A +++KE  + ++T
Sbjct: 397 QTDVNLVNAKLLVKEAGLNITT 418


>gi|39996300|ref|NP_952251.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens PCA]
 gi|39983180|gb|AAR34574.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens PCA]
 gi|298505310|gb|ADI84033.1| D-3-phosphoglycerate dehydrogenase [Geobacter sulfurreducens KN400]
          Length = 542

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 114/206 (55%), Gaps = 4/206 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++T+N++ +  L+  K GV I+N ARGG+++E AL + L+SG VA A  DVF  
Sbjct: 200 VHTPLTDETRNMIGERELAMMKDGVIIVNAARGGIIEEAALLKYLESGKVAGAAVDVFSE 259

Query: 61  EPALQ---NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP        L G   V   P+LGA+T E+Q  VA+ ++ ++ +YL D  + NA+N+   
Sbjct: 260 EPPKSEYLKKLIGHERVVVTPHLGANTFEAQVNVAVDVSREILNYLDDQPLENAVNIPRF 319

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-R 176
                  ++PF+ L + L  F  QL+  +I +I   + GS A  +   L    LA I+ R
Sbjct: 320 DLALMDQMRPFLNLMNTLCEFGIQLLDANISKIVFGFSGSIAHYDCTPLTVCGLASILNR 379

Query: 177 VWRVGANIISAPIIIKENAIILSTIK 202
           +     N+++A +I +   I++   K
Sbjct: 380 MVDQDVNMVNASLIAEGMGIVVEESK 405


>gi|328885238|emb|CCA58477.1| D-3-phosphoglycerate dehydrogenase [Streptomyces venezuelae ATCC
           10712]
          Length = 529

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE AL   L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGDEALHKVKPSVRIVNAARGGIVDEAALYTALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFELDQVVCTPHLGASTDEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VKPGLPLAEKLGRIFTALAGEVAARLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|154147887|ref|YP_001406068.1| D-3-phosphoglycerate dehydrogenase [Campylobacter hominis ATCC
           BAA-381]
 gi|153803896|gb|ABS50903.1| phosphoglycerate dehydrogenase [Campylobacter hominis ATCC BAA-381]
          Length = 525

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 92/167 (55%), Gaps = 1/167 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++  + ++K K GV +INCARGGL +ENAL   L+SG +A  G DVFE 
Sbjct: 202 IHTPKTKETIGMIGDKEIAKMKDGVRLINCARGGLYNENALINGLKSGKIAYLGMDVFEK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA QN L    N+   P+LGA+TVESQ  +A +   Q           NALN+ I +  
Sbjct: 262 EPATQNELLEFENLTATPHLGANTVESQSNIATEAVEQAISAARGLCYPNALNLPIKTDN 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTA-VMNTMVL 166
               V+P+M L   +     Q+    I+ I++  +G     +N+M++
Sbjct: 322 LPDFVEPYMNLVSKMAYMAAQIDKNQIKAIKLEGNGKVVDYLNSMLV 368


>gi|296394457|ref|YP_003659341.1| D-3-phosphoglycerate dehydrogenase [Segniliparus rotundus DSM
           44985]
 gi|296181604|gb|ADG98510.1| D-3-phosphoglycerate dehydrogenase [Segniliparus rotundus DSM
           44985]
          Length = 531

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 97/175 (55%), Gaps = 2/175 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++   L +TK GV I N ARGGL+DE ALA+ + SGHV  AG DVF  
Sbjct: 204 VHLPKTPETAGLIDAAALRRTKPGVVIANAARGGLIDEQALADAVSSGHVRSAGLDVFVQ 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PLFGL  V   P+LGASTVE+Q++    +A  +   L    V  A+N++     
Sbjct: 264 EPPGESPLFGLEQVVLTPHLGASTVEAQDRAGTDVAKSVQLALAGEFVPEAVNVSAGPVG 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
           E   V P++ LA  LG  +  +  ++   ++I   G  A     VL  A L G +
Sbjct: 324 EE--VLPWLDLARKLGVLLAAVAEQAAVALEIKVYGELAAEPVGVLGLAALRGFL 376


>gi|159903950|ref|YP_001551294.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9211]
 gi|159889126|gb|ABX09340.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9211]
          Length = 528

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 67/177 (37%), Positives = 104/177 (58%), Gaps = 2/177 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T+N++N + LS  KS   ++NCARGG++DE ALA+ L S  +A A  DV+  
Sbjct: 199 LHLPRTPETENLVNAQLLSTMKSTARLVNCARGGIIDEAALADALNSEVIAGAALDVYAE 258

Query: 61  EPALQN-PLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  ++ PL  +   +   P+LGAST E+QE VAI +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLKKDSPLLSVNKGLILTPHLGASTAEAQENVAIDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            E    +KP + LA+ LG    Q+    IQ++++   G  A   +  L  A L G++
Sbjct: 319 AEIMDSLKPHLQLAETLGLLASQISGGHIQKLEVRLQGEFAQHPSQPLVVATLKGLL 375


>gi|227832959|ref|YP_002834666.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium aurimucosum
           ATCC 700975]
 gi|262182554|ref|ZP_06041975.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium aurimucosum
           ATCC 700975]
 gi|227453975|gb|ACP32728.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium aurimucosum
           ATCC 700975]
          Length = 528

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 89/152 (58%), Gaps = 2/152 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + + E L+K K G  IIN ARGGLVDE ALAE ++SGH   AGFDV+  
Sbjct: 201 IHLPKTPETAGMFDAELLAKAKKGQIIINAARGGLVDEAALAESIKSGHHRGAGFDVYAS 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP V  +P+LGASTVE+Q++    +A  +   L    V++A+N+      
Sbjct: 261 EPCTDSPLFELPQVTVSPHLGASTVEAQDRAGTDVAASVLKALAGEFVADAVNVEGGKVG 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQI 152
           E   V  ++ L   LG   G L+  +   I++
Sbjct: 321 EE--VSGWLDLTRKLGLVAGNLLGAAPVAIEV 350


>gi|227488059|ref|ZP_03918375.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227091921|gb|EEI27233.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glucuronolyticum ATCC 51867]
          Length = 531

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 66/201 (32%), Positives = 107/201 (53%), Gaps = 3/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T+ + +++ LS  K G  IIN ARGGLVDE ALA+ +  G +  AGFDV+  
Sbjct: 204 IHLPKTPETERMFDRDLLSSAKQGQIIINAARGGLVDEQALADAINEGRIRGAGFDVYAT 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP     P+LGAST E+Q++    +A  +   L   +V +A+N  +    
Sbjct: 264 EPCTDSPLFSLPETVVTPHLGASTFEAQDRAGSDVADSVLMALAGDLVPDAVN--VPGGR 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
            +  V  ++ LA  LG     ++ ++   ++I+  G  +  N   L  + L GI  RV  
Sbjct: 322 PSQEVSSWLNLARKLGLIASAVLEKAPSTVEIVARGEISHENIEPLGLSALRGIFSRVVD 381

Query: 180 VGANIISAPIIIKENAIILST 200
              + ++   I +E  + +ST
Sbjct: 382 EDVSFVNVSRIAEERNVTVST 402


>gi|294815271|ref|ZP_06773914.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
 gi|294327870|gb|EFG09513.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 538

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE+AL   L+ G VA AG DV+  
Sbjct: 210 VHLPKTPETLGLIGDEALHKVKPTVRIVNAARGGIVDEDALYSALKEGRVAGAGLDVYAK 269

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 270 EPCTDSPLFQFDQVVCTPHLGASTDEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 329

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 330 ED----VKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 385

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 386 VDETVSYVNAPLFAQERGV 404


>gi|227541455|ref|ZP_03971504.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glucuronolyticum ATCC 51866]
 gi|227182737|gb|EEI63709.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium
           glucuronolyticum ATCC 51866]
          Length = 531

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 66/201 (32%), Positives = 107/201 (53%), Gaps = 3/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T+ + +++ LS  K G  IIN ARGGLVDE ALA+ +  G +  AGFDV+  
Sbjct: 204 IHLPKTPETERMFDRDLLSSAKQGQIIINAARGGLVDEQALADAINEGRIRGAGFDVYAT 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF LP     P+LGAST E+Q++    +A  +   L   +V +A+N  +    
Sbjct: 264 EPCTDSPLFSLPETVVTPHLGASTFEAQDRAGSDVADSVLMALAGDLVPDAVN--VPGGR 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVWR 179
            +  V  ++ LA  LG     ++ ++   ++I+  G  +  N   L  + L GI  RV  
Sbjct: 322 PSQEVSSWLNLARKLGLIASAVLEKAPSTVEIVARGEISHENIEPLGLSALRGIFSRVVD 381

Query: 180 VGANIISAPIIIKENAIILST 200
              + ++   I +E  + +ST
Sbjct: 382 EDVSFVNVSRIAEERNVTVST 402


>gi|205356376|ref|ZP_03223141.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|205345761|gb|EDZ32399.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni CG8421]
          Length = 489

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 102/199 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ K+ + K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 166 IHTPKTKETNGMIGKQEIVKMKDGIRLINCARGGLYTEEALYEGLKSGKIAWLGIDVFDK 225

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    N+    +LGA+T+ESQ+ +A +   Q           NALN+ I + +
Sbjct: 226 EPATNHPLLDFENISVTSHLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKTED 285

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G        +L  A +  +  +   
Sbjct: 286 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGIIGEYANSMLTFAAVGALGGILGE 345

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 346 KINYVNAEFVAKEKGVELS 364


>gi|254392671|ref|ZP_05007846.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
 gi|197706333|gb|EDY52145.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 532

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE+AL   L+ G VA AG DV+  
Sbjct: 204 VHLPKTPETLGLIGDEALHKVKPTVRIVNAARGGIVDEDALYSALKEGRVAGAGLDVYAK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 264 EPCTDSPLFQFDQVVCTPHLGASTDEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 323

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 324 ED----VKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 379

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 380 VDETVSYVNAPLFAQERGV 398


>gi|224113315|ref|XP_002316453.1| predicted protein [Populus trichocarpa]
 gi|222865493|gb|EEF02624.1| predicted protein [Populus trichocarpa]
          Length = 633

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 103/180 (57%), Gaps = 5/180 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  TK + N ++ +K K GV IIN ARGG++DE AL   L SG VA+A  DVF  
Sbjct: 290 LHMPLTPATKKVFNDDSFAKVKKGVRIINVARGGVIDEEALVRALDSGKVAQAALDVFTE 349

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L     V   P+LGAST E+QE VAI++A  +   L   + + A+N  ++  
Sbjct: 350 EPPPKDSKLVQHERVTVTPHLGASTKEAQEGVAIEIAEAVVGALKGELAATAVNAPMVPA 409

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG    QL++    ++  +++Y  +     ++T +L + +  GI+
Sbjct: 410 EVLSELAPYVVLAERLGRLAVQLVAGGSGMKSAKVVYKSARDPDDLDTRLLRAMITKGII 469


>gi|326443626|ref|ZP_08218360.1| D-3-phosphoglycerate dehydrogenase [Streptomyces clavuligerus ATCC
           27064]
          Length = 525

 Score =  111 bits (277), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE+AL   L+ G VA AG DV+  
Sbjct: 197 VHLPKTPETLGLIGDEALHKVKPTVRIVNAARGGIVDEDALYSALKEGRVAGAGLDVYAK 256

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 257 EPCTDSPLFQFDQVVCTPHLGASTDEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 316

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 317 ED----VKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 372

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 373 VDETVSYVNAPLFAQERGV 391


>gi|255538186|ref|XP_002510158.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gi|223550859|gb|EEF52345.1| d-3-phosphoglycerate dehydrogenase, putative [Ricinus communis]
          Length = 598

 Score =  111 bits (277), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 70/202 (34%), Positives = 111/202 (54%), Gaps = 6/202 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  + N +  SK K GV I+N ARGG++DE+AL   L SG V++A  DVF  
Sbjct: 255 LHMPLTPATSKMFNDDTFSKMKKGVRIVNVARGGVIDEDALVRALDSGIVSQAALDVFTE 314

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  Q     L  NV   P+LGAST E+QE VAI+++  +   L   + + A+N  ++  
Sbjct: 315 EPPPQGSKLVLHENVIATPHLGASTTEAQEGVAIEVSEAVIGALKGELAATAVNAPMVPA 374

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +   + LA+ LG    QL+S    +Q +++ Y  S     ++T +L + ++ G+V
Sbjct: 375 EVLSELAASVVLAEKLGRLAVQLVSGGSGVQSVKVTYASSRDPDDLDTRLLRAMIIKGLV 434

Query: 176 R-VWRVGANIISAPIIIKENAI 196
             +  V  N++++    K+  I
Sbjct: 435 EPISDVSVNLVNSDFTAKQRGI 456


>gi|86152140|ref|ZP_01070352.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315124387|ref|YP_004066391.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85840925|gb|EAQ58175.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|315018109|gb|ADT66202.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
          Length = 527

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 103/199 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ K+ ++K K G+ +INCARGGL  E AL E L++G +A  G DVF+ 
Sbjct: 204 IHTPKTKETNGMIGKQEIAKMKDGIRLINCARGGLYTEEALYEGLKNGKIAWLGIDVFDK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    N+    +LGA+T+ESQ+ +A +   Q           NALN+ I + +
Sbjct: 264 EPATNHPLLDFENISVTSHLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKTED 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V P++ L   +     Q+    I+ I++  +G        +L  A +  +  +   
Sbjct: 324 LPPFVAPYIELVSKMAFLAVQIDKNPIKSIKLEAEGIIGEYANSMLTFAAVGALGGILGE 383

Query: 181 GANIISAPIIIKENAIILS 199
             N ++A  + KE  + LS
Sbjct: 384 KINYVNAEFVAKEKGVELS 402


>gi|297191887|ref|ZP_06909285.1| D-3-phosphoglycerate dehydrogenase [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|197721137|gb|EDY65045.1| D-3-phosphoglycerate dehydrogenase [Streptomyces pristinaespiralis
           ATCC 25486]
          Length = 530

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE AL   L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGDEALHKVKPAVRIVNAARGGIVDEQALYTALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFELDQVVCTPHLGASTDEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    V+P + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VRPGLPLAEKLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|294631551|ref|ZP_06710111.1| phosphoglycerate dehydrogenase [Streptomyces sp. e14]
 gi|292834884|gb|EFF93233.1| phosphoglycerate dehydrogenase [Streptomyces sp. e14]
          Length = 529

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ +E L K K  V I+N ARGG+VDE AL   L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGEEALHKVKPSVRIVNAARGGIVDEEALYSALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFEFDQVVCTPHLGASTDEAQEKAGIAVAKSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|119491306|ref|ZP_01623360.1| D-3-phosphoglycerate dehydrogenase [Lyngbya sp. PCC 8106]
 gi|119453470|gb|EAW34632.1| D-3-phosphoglycerate dehydrogenase [Lyngbya sp. PCC 8106]
          Length = 527

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 109/199 (54%), Gaps = 3/199 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T ++++ +   K K    IINCARGG++DE AL E L+ G +A A  DV+E 
Sbjct: 199 LHMPKTKDTYHMIDAKAFEKMKPTARIINCARGGIIDEAALVEALKQGQIAGAAIDVYEN 258

Query: 61  EP-ALQNPLFGLP-NVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP   ++PL  L   +   P+LGAST E+Q  VA+ +A Q+ D L+     +A+N+  + 
Sbjct: 259 EPLEAESPLRALDQKLVLTPHLGASTEEAQVNVAVDVAEQIRDVLLGLPARSAVNIPGLY 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RV 177
            +    +KP++ LA+ LG  + QL    +  + +   G  A  N+  +  A L G++ + 
Sbjct: 319 PDALEKLKPYLQLAETLGNLVSQLAGGRVDFLDVRLQGELATNNSQPVVVASLKGLLSQA 378

Query: 178 WRVGANIISAPIIIKENAI 196
            R   N ++A I  KE  I
Sbjct: 379 LRERVNYVNASIEAKERGI 397


>gi|239928756|ref|ZP_04685709.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
 gi|291437078|ref|ZP_06576468.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
 gi|291339973|gb|EFE66929.1| D-3-phosphoglycerate dehydrogenase [Streptomyces ghanaensis ATCC
           14672]
          Length = 529

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 104/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V +IN ARGG+VDE AL   L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGDEALRKVKPSVRVINAARGGIVDEEALYSALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFEFDQVVCTPHLGASTDEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|33861910|ref|NP_893471.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|33640278|emb|CAE19813.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
          Length = 528

 Score =  110 bits (276), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 94/158 (59%), Gaps = 2/158 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T++T+N++N + L   K    +INCARGG++DE ALAE L +  +  A  DVF  
Sbjct: 199 LHLPRTSETENLVNMKVLKSMKKNAKLINCARGGIIDEEALAEALNNSLIGGAAIDVFAK 258

Query: 61  EPALQN-PLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP   N PL  +  N+   P+LGAST E+QE VA+ +A Q+ D L+      A+N+  +S
Sbjct: 259 EPLDSNSPLLKVDKNLILTPHLGASTREAQENVAVDVAEQIRDVLLGLSARTAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDG 156
            +    +KP + LA+ +G  I QL    IQ++++   G
Sbjct: 319 PDIMDSLKPHLQLAETMGLLISQLSGGQIQKLEVRLQG 356


>gi|269127749|ref|YP_003301119.1| D-3-phosphoglycerate dehydrogenase [Thermomonospora curvata DSM
           43183]
 gi|268312707|gb|ACY99081.1| D-3-phosphoglycerate dehydrogenase [Thermomonospora curvata DSM
           43183]
          Length = 531

 Score =  110 bits (276), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 103/197 (52%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  + L   K  V IIN ARGG+VDENAL   L+ G VA AG DVF  
Sbjct: 201 VHLPKTPETIGLIGDKELHLVKPSVRIINAARGGIVDENALEAALKEGRVAGAGLDVFAN 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF   NV   P+LGAST E+QEK   Q+A  +   L    V +A+N+   +  
Sbjct: 261 EPCTDSPLFHHDNVVVTPHLGASTHEAQEKAGTQVARSVKLALSGEFVPDAVNVQGGAVA 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVWR 179
           E   VKP + LA+ LG     L       ++++  G     +  VL  A L G+ + V  
Sbjct: 321 ED--VKPGLPLAEKLGRIFTALAGGVPVRLEVVVRGEITAHDVKVLELAALKGVFLDVVE 378

Query: 180 VGANIISAPIIIKENAI 196
                ++AP++ ++  +
Sbjct: 379 DAVTFVNAPLLARDRGV 395


>gi|284032768|ref|YP_003382699.1| D-3-phosphoglycerate dehydrogenase [Kribbella flavida DSM 17836]
 gi|283812061|gb|ADB33900.1| D-3-phosphoglycerate dehydrogenase [Kribbella flavida DSM 17836]
          Length = 536

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 104/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE AL   L+ G VA AG DVF  
Sbjct: 208 VHLPKTPETIGLIGDEQLHKVKPEVIIVNAARGGIVDEQALYTALKEGRVAAAGLDVFAK 267

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF   NV   P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 268 EPCTDSPLFEFENVVATPHLGASTDEAQEKAGIAVAKSVRLALSGELVPDAVNVQGGVIA 327

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRV 177
            +    V+P + L + LG     L     Q++ +   G     +  VL  A L G+   V
Sbjct: 328 ED----VRPGIALTEKLGRIFTALAGGVAQQLDVEVRGEITQYDVKVLELAALKGVFADV 383

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP++  E  +
Sbjct: 384 VEDNVSYVNAPLLAAERGL 402


>gi|258645797|ref|ZP_05733266.1| phosphoglycerate dehydrogenase [Dialister invisus DSM 15470]
 gi|260403167|gb|EEW96714.1| phosphoglycerate dehydrogenase [Dialister invisus DSM 15470]
          Length = 530

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 114/208 (54%), Gaps = 3/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT +TK ++  + + K K GV I+N +RG ++D +ALAE L++G VA AG DV+  
Sbjct: 199 LHTPLTEETKGMIGAKEIEKMKDGVRIVNASRGAVIDIDALAEALKTGKVAGAGIDVWTN 258

Query: 61  EP--ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP     NP  G+ NV   P+LGASTVE+Q  VA  +A  ++D L    V+ A+N + I+
Sbjct: 259 EPLKPENNPFLGMKNVTLTPHLGASTVEAQTGVATDVARGVADALHGEPVATAVNASPIT 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
                +++P+  L + +G     L    I  + + Y G      T  L +AVL G++  +
Sbjct: 319 RATLAVIQPYFNLCERMGNIGIDLADGRISRVSVEYTGELTETETTPLTTAVLKGLLTPI 378

Query: 178 WRVGANIISAPIIIKENAIILSTIKRDK 205
            +   N ++A  I +E  + +  +K  K
Sbjct: 379 LQQTVNFVNARNIAEERHMEIREVKAKK 406


>gi|29829272|ref|NP_823906.1| D-3-phosphoglycerate dehydrogenase [Streptomyces avermitilis
           MA-4680]
 gi|29606379|dbj|BAC70441.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces
           avermitilis MA-4680]
          Length = 529

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V ++N ARGG+VDE AL   L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGDEALRKVKPTVRVVNAARGGIVDEEALFSALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFELDEVVCTPHLGASTDEAQEKAGISVARSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VKPGLPLAEKLGRIFTALSGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|242096578|ref|XP_002438779.1| hypothetical protein SORBIDRAFT_10g026070 [Sorghum bicolor]
 gi|241917002|gb|EER90146.1| hypothetical protein SORBIDRAFT_10g026070 [Sorghum bicolor]
          Length = 613

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 112/202 (55%), Gaps = 6/202 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  + N E  +K + GV IIN ARGG+VDE AL   L +G VA+A  DVF  
Sbjct: 270 LHMPLTPSTAKLFNDETFAKMRKGVRIINVARGGVVDEEALLRALDNGTVAQAALDVFTE 329

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L    NV   P+LGAST E+QE VA+++A  +   L   + + A+N   +  
Sbjct: 330 EPPPRDSKLVQHENVTVTPHLGASTTEAQEGVALEIAEAVIGALRGDLAATAVNAPTVPA 389

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    +  ++ LA+ LG  + QL++    I+ I++++  +     ++T +L + V  GI+
Sbjct: 390 EVLSELSSYVVLAEKLGRLVVQLVAGGSGIKGIKVVFSSARDPDDLDTRILRAMVTKGII 449

Query: 176 R-VWRVGANIISAPIIIKENAI 196
             +     NI++A  + K+  +
Sbjct: 450 EPISSAFVNIVNADYVAKQRGL 471


>gi|322801282|gb|EFZ21969.1| hypothetical protein SINV_07911 [Solenopsis invicta]
          Length = 557

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 115/205 (56%), Gaps = 17/205 (8%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+N++N   L+K K GV I+N ARGG+VDE AL   L+SGH   A  DVF  
Sbjct: 250 VHTPLIPQTRNLINATTLAKCKKGVYIVNVARGGIVDEEALLNSLKSGHCGGAALDVFVE 309

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQM-------SDYLIDGVVS 109
           EP  +NP    L   P V   P+LGAST E+Q++VA+++A Q        +++ + G+V+
Sbjct: 310 EPP-KNPITLELIKHPKVVPTPHLGASTAEAQQRVAVEIAQQFLALSGKSTEFDVTGIVN 368

Query: 110 NALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSA 169
             +  A ++ E     +P++ L+  LG   G+ +   +  +   +     + +   +++A
Sbjct: 369 APVLSAAMTSEN----EPWIELSKKLGQLAGRFLKGKLNTVVHSHTVGNGMQDKQFIHTA 424

Query: 170 VLAGIVR-VWRVGANIISAPIIIKE 193
           VL GI+    + G N+++AP + ++
Sbjct: 425 VLVGILTGQTKNGLNLVNAPTLAQD 449


>gi|325116300|emb|CBZ51853.1| hypothetical protein NCLIV_016450 [Neospora caninum Liverpool]
          Length = 398

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/182 (35%), Positives = 100/182 (54%), Gaps = 9/182 (4%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPL   T++++N E L   K G CIIN ARGG++DE A+AE L +  +A A  DVFE 
Sbjct: 188 LHVPLLENTRHLINAEKLKLIKKGACIINAARGGVIDEKAVAEALMTNELAGAALDVFEN 247

Query: 61  EPAL--QNPLFGL----PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM 114
           E      NPL        NV   P++GAST E+Q  VA+ +A Q  + L+ G+  +A+N+
Sbjct: 248 EKEFTKDNPLIQAKENGKNVILTPHIGASTFEAQHNVAVDVALQFKETLLGGLPQSAVNL 307

Query: 115 AIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
             +  +    +  F+ LA+ LG    +L+ E ++ + +   GS    +  VL  +   G+
Sbjct: 308 QCVRSQH---LASFVNLAETLGRLCSKLVDEPVETLHLKIRGSIESADADVLLLSAAQGM 364

Query: 175 VR 176
           +R
Sbjct: 365 LR 366


>gi|125556326|gb|EAZ01932.1| hypothetical protein OsI_23958 [Oryza sativa Indica Group]
          Length = 613

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 115/205 (56%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  + + E  +  K GV IIN ARGG+VDE+AL   L +G V++A  DVF  
Sbjct: 270 LHMPLTPSTAKLFDDETFANMKKGVRIINVARGGVVDEDALLRALDNGTVSQAALDVFTE 329

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L    +V   P+LGAST E+QE VA+++A  +   L   + + A+N  ++  
Sbjct: 330 EPPPKDSKLVHHEHVTVTPHLGASTSEAQEGVALEIAEAVLGALKGELAATAVNAPMVPA 389

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG  + QL++    I+ ++I Y  S     ++T VL + V  GI+
Sbjct: 390 EVLSELSPYVVLAEKLGRLVVQLVAGGSGIKGVKIGYSSSRDPDDLDTRVLRAMVTKGII 449

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +     NI++A  + K+  + +S
Sbjct: 450 EPISSAFVNIVNADYVAKQRGLRIS 474


>gi|88856753|ref|ZP_01131408.1| D-3-phosphoglycerate dehydrogenase [marine actinobacterium
           PHSC20C1]
 gi|88814050|gb|EAR23917.1| D-3-phosphoglycerate dehydrogenase [marine actinobacterium
           PHSC20C1]
          Length = 530

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 107/202 (52%), Gaps = 3/202 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++ E  +  KS   I+N ARGGL+DE+AL   L+S  +A AG DVF  
Sbjct: 201 IHMPKTPETTGMISTEQFAHMKSTAYIVNVARGGLIDEDALYTALKSRRIAGAGLDVFVS 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL GL NV   P+LGAST E+QEK  + +A  +   L   +V +A+N+A    +
Sbjct: 261 EPPTGSPLLGLDNVIVTPHLGASTAEAQEKAGVSVAKSVRLALGGELVPDAVNVAGGIID 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVWR 179
           E+  V+P + L + LG     L    +  + I   G     +  VL  A L GI   V  
Sbjct: 321 ES--VRPGIPLMEKLGQVFSGLAHSPLTSVDIEVRGEIVEFDVNVLKLAALKGIFTNVVS 378

Query: 180 VGANIISAPIIIKENAIILSTI 201
              + ++AP++  +  + +  I
Sbjct: 379 ETVSYVNAPVLADQRGLTVRLI 400


>gi|283954452|ref|ZP_06371972.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794069|gb|EFC32818.1| D-3-phosphoglycerate dehydrogenase [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 521

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/200 (33%), Positives = 106/200 (53%), Gaps = 2/200 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P T +T  ++ K+ ++K K G+ +INCARGGL  E AL E L+SG +A  G DVF+ 
Sbjct: 198 IHTPKTKETNGMIGKQEIAKMKDGIRLINCARGGLYTEEALCESLKSGKIAWLGIDVFDK 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL    NV    +LGA+T+ESQ+ +A +   Q           NALN+ I + E
Sbjct: 258 EPATSHPLLDFENVSVTSHLGANTLESQDNIAREACEQALSAARGVAYPNALNLPIKT-E 316

Query: 121 EAPL-VKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWR 179
           + PL V P++ L   +     Q+    I+ I++  +G  +     +L  A +  +  +  
Sbjct: 317 DLPLFVAPYIELVSKMAFLAIQIDKNPIKSIKLEAEGIISEYANSMLTFAAVGALGGILG 376

Query: 180 VGANIISAPIIIKENAIILS 199
              N ++A  + KE  + LS
Sbjct: 377 EKINYVNAEFVAKEKGVELS 396


>gi|239944498|ref|ZP_04696435.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|239990958|ref|ZP_04711622.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           11379]
 gi|291447964|ref|ZP_06587354.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
 gi|291350911|gb|EFE77815.1| D-3-phosphoglycerate dehydrogenase [Streptomyces roseosporus NRRL
           15998]
          Length = 530

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 104/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE AL   L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGDEALHKVKPSVRIVNAARGGIVDEEALYSALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFQFDQVVCTPHLGASTDEAQEKAGIAVAKSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    V+P + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VRPGLPLAEKLGRIFTALAGEVAARLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|126313575|ref|XP_001367170.1| PREDICTED: similar to Phosphoglycerate dehydrogenase [Monodelphis
           domestica]
          Length = 533

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 108/202 (53%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN+   ++ K GV ++NCARGG+VDE AL   LQSG    A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNENTFAQCKKGVRVVNCARGGIVDEGALLHALQSGQCGGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L    NV  +P+LGAST E+Q +   ++A Q  + +    ++  +N   ++  
Sbjct: 265 EPPRDLALVNHENVISSPHLGASTKEAQSRCGEEIAVQFVNMVKGKSLTGVVNAQALASA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            +P  KP++ LA+ LG  I          IQ++  G +   +   L+ AV+ G+++    
Sbjct: 325 FSPSTKPWIGLAEALGTLIRAWAGSPKGTIQVMTQGPSLKNSGSSLSPAVIVGLLKETAT 384

Query: 181 GA--NIISAPIIIKENAIILST 200
            A  N+++A ++++E  + ++T
Sbjct: 385 QAEVNLVNAKLLMQEAGLNVTT 406


>gi|182435790|ref|YP_001823509.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|326776414|ref|ZP_08235679.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
 gi|178464306|dbj|BAG18826.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|326656747|gb|EGE41593.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 530

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 104/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE AL   L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGDEALHKVKPSVRIVNAARGGIVDEEALYSALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFQFDQVVCTPHLGASTDEAQEKAGIAVAKSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    V+P + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VRPGLPLAEKLGRIFTALAGEVAARLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|148272280|ref|YP_001221841.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|147830210|emb|CAN01143.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
          Length = 529

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 106/197 (53%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T  T  ++  E  +  K  + I+N +RGG++DE+AL   L+S  +A AG DVF  
Sbjct: 201 IHIPKTPDTTGLIGTEQFALAKPSLRIVNASRGGIIDEDALYTALKSKRIAGAGLDVFVS 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL  L N+   P+LGAST E+QEK  + +A  +   L   +V +A+N+A    +
Sbjct: 261 EPPTGSPLLDLDNIIVTPHLGASTDEAQEKAGVSVARSVRLALGGELVPDAVNVAGGVID 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVWR 179
             P V+P + L + LG     L  E++  I ++  G  A  +  VL  A L G+   V  
Sbjct: 321 --PYVRPGIPLMEKLGQVFSGLAHEALTSIDVVVRGELAGYDVSVLKLAALKGVFTNVVS 378

Query: 180 VGANIISAPIIIKENAI 196
              + ++AP++ ++  +
Sbjct: 379 ENVSYVNAPLLAEQRGL 395


>gi|125598081|gb|EAZ37861.1| hypothetical protein OsJ_22207 [Oryza sativa Japonica Group]
          Length = 613

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 115/205 (56%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  + + E  +  K GV IIN ARGG+VDE+AL   L +G V++A  DVF  
Sbjct: 270 LHMPLTPSTAKLFDDETFANMKKGVRIINVARGGVVDEDALLRALDNGTVSQAALDVFTE 329

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L    +V   P+LGAST E+QE VA+++A  +   L   + + A+N  ++  
Sbjct: 330 EPPPKDSKLVHHEHVTVTPHLGASTSEAQEGVALEIAEAVLGALKGELAATAVNAPMVPA 389

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG  + QL++    I+ ++I Y  S     ++T VL + V  GI+
Sbjct: 390 EVLSELSPYVILAEKLGRLVVQLVAGGSGIKGVKIGYSSSRDPDDLDTRVLRAMVTKGII 449

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +     NI++A  + K+  + +S
Sbjct: 450 EPISSAFVNIVNADYVAKQRGLRIS 474


>gi|239736188|gb|ACS12894.1| 3-phosphoglycerate dehydrogenase-like protein [Chironex fleckeri]
          Length = 520

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 102/198 (51%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +TK ++N +   K K  + +IN ARGG++DE+ L + L +G  A AG DVF  
Sbjct: 205 VHTPLIPQTKGLVNAKTFDKCKKTIRVINVARGGIIDESDLLDALNAGKCAGAGLDVFSS 264

Query: 61  EP--ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP   + + L   P V C P+LGAST E+Q +VA ++A Q+ D          +N   IS
Sbjct: 265 EPPSGVVSELVKHPRVVCTPHLGASTAEAQVRVAKEIAEQIVDACNGKTAVGLVNAPAIS 324

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
                 VKP+M L   LG  + ++     + + I   G      T  L SAV  G+++  
Sbjct: 325 EAGKEDVKPWMALGQALGAVLCKISPTLPKLVNIKTRGEKPKGLTRALTSAVSLGLLKFQ 384

Query: 179 RVGANIISAPIIIKENAI 196
               N+++AP + KE  I
Sbjct: 385 GGNINLLNAPSVAKEKGI 402


>gi|154270428|ref|XP_001536069.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150409996|gb|EDN05384.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 603

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 116/222 (52%), Gaps = 16/222 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   LS+ K G  ++N ARGG  DE AL E L+S H+A A  DVF  
Sbjct: 214 IHTPLIASTKGMISSAELSQMKRGARVLNVARGGTFDEAALLEALESNHLAGAAIDVFTS 273

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP   +     L   P V   P+LGASTVE+QE V++ +  Q+   L   +  +A+N  +
Sbjct: 274 EPPASDSSASRLIAHPRVVATPHLGASTVEAQENVSMDVCEQVLQILNGALPRSAVNAPL 333

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESI------QEIQIIYDGSTA-VMNTMVLNSA 169
           I  EE   ++PF+ L + +G    Q  + +           +IY+G  A V NT  L +A
Sbjct: 334 ILPEEYKKLQPFVHLVEKMGNLYTQHFTSTATPTANSSTFDLIYEGEIAMVNNTKPLFAA 393

Query: 170 VLAGIV----RVWRVGANIISAPIIIKENAIILS-TIKRDKS 206
           ++ G++        +  NI++A +I +E  ++++    RD +
Sbjct: 394 LIKGLIAPISSTAGINVNIVNAELIARERGLVVNERFSRDPT 435


>gi|312216238|emb|CBX96189.1| similar to d-3-phosphoglycerate dehydrogenase [Leptosphaeria
           maculans]
          Length = 620

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 111/213 (52%), Gaps = 14/213 (6%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PL   TK ++ K  L+  K    I+N ARGG++DE+AL E L +G +A AG DVF  
Sbjct: 242 LHTPLIASTKGMIGKAELATMKPTARILNVARGGMIDEDALVEALNAGTIAGAGIDVFTS 301

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP   +     L   P V   P+LGAST E+QE V+I +  Q+   L   +  +A+N  I
Sbjct: 302 EPPQPDSSASRLIAHPKVVATPHLGASTKEAQENVSIDVCEQVVSILSGELPRSAVNAPI 361

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLIS----ESIQ-EIQIIYDGSTAVMNTM-----VL 166
           +  +E   ++P+++L + +G    Q  S    +S +    I Y+G  A +NT       L
Sbjct: 362 VLPDEYRTLQPYISLVEKMGSLYTQHYSSVKIDSFRTTFDITYEGKLATINTTKPLFAAL 421

Query: 167 NSAVLAGIVRVWRVGANIISAPIIIKENAIILS 199
              +L  I     +  NI++A I+ KE  I+++
Sbjct: 422 VKGLLTPITSSDGLNINIVNAEILAKERGILIN 454


>gi|253700874|ref|YP_003022063.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M21]
 gi|251775724|gb|ACT18305.1| D-3-phosphoglycerate dehydrogenase [Geobacter sp. M21]
          Length = 532

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 119/212 (56%), Gaps = 8/212 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T N++ K+ L+  K GV +IN ARGG+++E A+ E L+SG VA A FDV+  
Sbjct: 200 VHTPLTAETSNMIGKKELAAMKEGVIVINAARGGIINEEAMLEALESGKVAGAAFDVWSQ 259

Query: 61  EP---ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP        L G   +   P+LGA+T E+Q  VA+ ++ ++  YL +  + NA+N  I 
Sbjct: 260 EPPDTETLKKLIGHEKMVVTPHLGANTFEAQVNVAVDVSREIIHYLDEQPLENAIN--IP 317

Query: 118 SFEEAPL--VKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            F+ A +  ++P++ L + L  F+ QL+  ++ +I   Y G+ A  +   +    LA ++
Sbjct: 318 RFDAALMGQMRPYLNLMNVLSDFVIQLVDTNLNKITFTYTGNLAQYDCTPITVLGLASLL 377

Query: 176 -RVWRVGANIISAPIIIKENAIILSTIKRDKS 206
            R      N+++A ++     I++  +K  ++
Sbjct: 378 NRRVEQDVNMVNAQLVADSMGIVVEEVKSSQA 409


>gi|326381545|ref|ZP_08203239.1| D-3-phosphoglycerate dehydrogenase [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326199792|gb|EGD56972.1| D-3-phosphoglycerate dehydrogenase [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 531

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 93/174 (53%), Gaps = 2/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +L  E  +K K GV ++N ARGGL+DE ALA+ ++SG V  AG DVF+ 
Sbjct: 204 IHLPKTKETAGLLGAEQFAKVKDGVIVVNAARGGLIDEQALADAIKSGKVRGAGLDVFDS 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+     +
Sbjct: 264 EPCTDSPLFELDQVVVTPHLGASTAEAQDRAGTDVAASVKLALAGHFVPDAVNITGGPVD 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           +   V P++ L+  LG   G +       + +   G  A     VL  + L G+
Sbjct: 324 DE--VAPWLELSRKLGVLAGVVAGGMPTNLTVEVRGELAASPVDVLGLSALRGL 375


>gi|227548065|ref|ZP_03978114.1| phosphoglycerate dehydrogenase [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227079863|gb|EEI17826.1| phosphoglycerate dehydrogenase [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 554

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/179 (35%), Positives = 101/179 (56%), Gaps = 6/179 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + N + L+K K G  IIN ARGGL+DE ALA+ + SG +  AGFDV+  
Sbjct: 228 IHLPKTKETAGMFNADLLAKAKQGQVIINAARGGLIDEQALADAIVSGRIRGAGFDVYSS 287

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V++A+N  I    
Sbjct: 288 EPCTDSPLFALDQVVVTPHLGASTEEAQDRAGTDVADSVLKALRGEFVADAVN--ITGGR 345

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDG--STAVMNTMVLNS--AVLAGIV 175
               V  ++ L+  LG   G+L+  +   +++   G  ST  ++T+ L++   + +GIV
Sbjct: 346 VGEEVSSWLDLSRKLGLIAGKLLDAAPVSLRVTARGELSTEDVDTLGLSAVRGLFSGIV 404


>gi|302390824|ref|YP_003826644.1| D-3-phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM
           5501]
 gi|302202901|gb|ADL11579.1| D-3-phosphoglycerate dehydrogenase [Acetohalobium arabaticum DSM
           5501]
          Length = 527

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 109/205 (53%), Gaps = 3/205 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++T +IL K+  ++ K GV I+N ARG  VD   LAE ++ G VA A  DV E 
Sbjct: 199 IHTPLTDETYHILGKKEFAQMKEGVRIVNAARGENVDTYELAEAIKEGKVAGAALDVHEE 258

Query: 61  EP-ALQNPLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP   ++PL  L + V  +P+LG +TVE+ + VAI  A Q    L   +    LN   + 
Sbjct: 259 EPLKEEHPLLELEDRVIVSPHLGGTTVEAMDNVAIDAAKQAISVLRGDLPRTPLNAPALQ 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            E    ++P++ LA  LG F  Q     I+E+ I Y G  A      + +A+L GI+  +
Sbjct: 319 PEAMKEIEPYVNLAKKLGAFYAQWGEGRIKELTISYRGELAEKEIGPVTTALLIGILNPI 378

Query: 178 WRVGANIISAPIIIKENAIILSTIK 202
                N ++A +I +E  I ++  K
Sbjct: 379 LDTTVNSVNAGLIAEERGIDITESK 403


>gi|186685295|ref|YP_001868491.1| D-3-phosphoglycerate dehydrogenase [Nostoc punctiforme PCC 73102]
 gi|186467747|gb|ACC83548.1| D-3-phosphoglycerate dehydrogenase [Nostoc punctiforme PCC 73102]
          Length = 526

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 111/198 (56%), Gaps = 2/198 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T +++N   L+K K    IINCARGG++DE ALA  L++G +  A  DVFE 
Sbjct: 199 LHIPKTPETTHLINATTLAKMKPTARIINCARGGIIDEVALAAALKAGKIGGAALDVFES 258

Query: 61  EPALQNPLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++ L  L   V   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  +  
Sbjct: 259 EPLGESELRSLGKEVILTPHLGASTAEAQVNVAIDVAEQIRDVLLGLPARSAVNIPGLGP 318

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
           +    +KP+M LA+ LG  +GQL    ++ + I   G  A   +  L  A L G++ +  
Sbjct: 319 DVLEELKPYMQLAETLGNLVGQLAGGRVEVLNIRLQGELATNKSQPLVVAALKGLLYQAL 378

Query: 179 RVGANIISAPIIIKENAI 196
           R   N ++A I  KE  I
Sbjct: 379 RERVNYVNASIEAKERGI 396


>gi|73981259|ref|XP_849835.1| PREDICTED: similar to D-3-phosphoglycerate dehydrogenase (3-PGDH)
           [Canis familiaris]
 gi|73981286|ref|XP_849919.1| PREDICTED: similar to D-3-phosphoglycerate dehydrogenase (3-PGDH)
           [Canis familiaris]
 gi|73981343|ref|XP_850035.1| PREDICTED: similar to D-3-phosphoglycerate dehydrogenase (3-PGDH)
           [Canis familiaris]
          Length = 533

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 105/202 (51%), Gaps = 2/202 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   L+SG  A A  DVF  
Sbjct: 205 VHTPLLPSTTGLLNDSTFAQCKKGVRVVNCARGGIVDEGALLRALRSGQCAGAALDVFTE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L     V   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++  
Sbjct: 265 EPPRDRALVEHERVISCPHLGASTKEAQSRCGEEIAIQFVDMVKGKSLAGVVNAQALTSA 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VW 178
            +P  KP++ LA+ LG  +          IQ++  G+        L+ AV+ G+++    
Sbjct: 325 FSPHTKPWIGLAEALGTLMQAWAGSPKGTIQVVTQGTPLKNAGNCLSPAVIVGLLKDTAS 384

Query: 179 RVGANIISAPIIIKENAIILST 200
           +   N+++A ++++E  + ++T
Sbjct: 385 QADVNLVNAKLLVQEAGLSVTT 406


>gi|51535610|dbj|BAD37553.1| putative D-3 [Oryza sativa Japonica Group]
 gi|51536377|dbj|BAD37570.1| putative D-3 [Oryza sativa Japonica Group]
          Length = 625

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 115/205 (56%), Gaps = 6/205 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT  T  + + E  +  K GV IIN ARGG+VDE+AL   L +G V++A  DVF  
Sbjct: 282 LHMPLTPSTAKLFDDETFANMKKGVRIINVARGGVVDEDALLRALDNGTVSQAALDVFTE 341

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++  L    +V   P+LGAST E+QE VA+++A  +   L   + + A+N  ++  
Sbjct: 342 EPPPKDSKLVHHEHVTVTPHLGASTSEAQEGVALEIAEAVLGALKGELAATAVNAPMVPA 401

Query: 120 EEAPLVKPFMTLADHLGCFIGQLIS--ESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIV 175
           E    + P++ LA+ LG  + QL++    I+ ++I Y  S     ++T VL + V  GI+
Sbjct: 402 EVLSELSPYVILAEKLGRLVVQLVAGGSGIKGVKIGYSSSRDPDDLDTRVLRAMVTKGII 461

Query: 176 R-VWRVGANIISAPIIIKENAIILS 199
             +     NI++A  + K+  + +S
Sbjct: 462 EPISSAFVNIVNADYVAKQRGLRIS 486


>gi|240277875|gb|EER41382.1| D-3-phosphoglycerate dehydrogenase [Ajellomyces capsulatus H143]
 gi|325095932|gb|EGC49242.1| D-3-phosphoglycerate dehydrogenase [Ajellomyces capsulatus H88]
          Length = 598

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 116/222 (52%), Gaps = 16/222 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   LS+ K G  ++N ARGG  DE AL E L+S H+A A  DVF  
Sbjct: 209 IHTPLIASTKGMISSAELSQMKRGARVLNVARGGTFDEAALLEALESNHLAGAAIDVFTS 268

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP   +     L   P V   P+LGASTVE+QE V++ +  Q+   L   +  +A+N  +
Sbjct: 269 EPPAADSSASRLIAHPRVVATPHLGASTVEAQENVSMDVCEQVLQILNGALPRSAVNAPL 328

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQE------IQIIYDGSTA-VMNTMVLNSA 169
           I  EE   ++PF+ L + +G    Q  + +           +IY+G  A V NT  L +A
Sbjct: 329 ILPEEYKKLQPFVHLVEKMGNLYTQHFTSTATSTANSSTFDLIYEGEIAMVNNTKPLFAA 388

Query: 170 VLAGIV----RVWRVGANIISAPIIIKENAIILS-TIKRDKS 206
           ++ G++        +  NI++A +I +E  ++++    RD +
Sbjct: 389 LIKGLIAPISSTAGINVNIVNAELIARERGLVVNERFSRDPT 430


>gi|239982472|ref|ZP_04704996.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
 gi|291454320|ref|ZP_06593710.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
 gi|291357269|gb|EFE84171.1| D-3-phosphoglycerate dehydrogenase [Streptomyces albus J1074]
          Length = 533

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 104/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE ALA  L+ G VA AG DV+  
Sbjct: 205 VHLPKTPETLGLIGDEALHKVKPSVRIVNAARGGIVDEEALASALKEGRVAGAGLDVYAK 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V   P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 265 EPCTDSPLFQFDQVVATPHLGASTDEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 324

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    V+P + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 325 ED----VRPGLPLAEKLGRIFTSLAGEVATRLDVEVYGEITQHDVKVLELSALKGVFEDV 380

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 381 VDETVSYVNAPLFAQERGV 399


>gi|163781587|ref|ZP_02176587.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882807|gb|EDP76311.1| D-3-phosphoglycerate dehydrogenase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 530

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 108/200 (54%), Gaps = 5/200 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++T+N++        K GV I+NCARGG+++E AL + L+SG V     DVF  
Sbjct: 202 IHAPLTHETRNMIGDAEFELMKEGVFIVNCARGGIINEEALIKNLESGKVKGVALDVFSK 261

Query: 61  EPA---LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP    L + L    NV  +P++GA+T ESQE VA+ +A Q+   L        +N    
Sbjct: 262 EPPPPELVDRLRKFENVSLSPHIGANTHESQENVAVIVAQQVIKALKGKSPEYVVNAPFP 321

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-R 176
                 L+KP + LA+ +G F+ Q   E I+E+ I   G  +  +   +++AVL GI+  
Sbjct: 322 DLSVLTLIKPHLDLAEKMGRFMVQWAEEGIREVHIEVRGDIS-EHFHPISAAVLKGILEE 380

Query: 177 VWRVGANIISAPIIIKENAI 196
           V     NII+A  + ++  I
Sbjct: 381 VVDFPVNIINATYVARDRGI 400


>gi|50954968|ref|YP_062256.1| D-3-phosphoglycerate dehydrogenase [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50951450|gb|AAT89151.1| D-3-phosphoglycerate dehydrogenase [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 530

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++ + L++ K    ++N ARGGL+DE+AL   L S  +A AG DVF  
Sbjct: 201 IHMPKTPETTGMISDDQLAQMKPTAFLVNVARGGLIDEDALHRALASQSIAGAGLDVFVS 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMA--IIS 118
           EP   +PL GL NV   P+LGAST E+QEK  + +A  +   L   +V +A+N+A  II 
Sbjct: 261 EPPTDSPLLGLENVIVTPHLGASTGEAQEKAGVSVAKSVRLALSGELVPDAVNVAGGIID 320

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRV 177
               P V+P + L + LG     L    +  + +   G     +  VL  A L GI   V
Sbjct: 321 ----PYVRPGIPLVEKLGQVFSGLAHSPVTSVDVEVRGEIVEFDVSVLKLAALKGIFTNV 376

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP++  +  I
Sbjct: 377 VSETVSYVNAPLLADQRGI 395


>gi|326481542|gb|EGE05552.1| phosphoglycerate dehydrogenase [Trichophyton equinum CBS 127.97]
          Length = 571

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 117/218 (53%), Gaps = 14/218 (6%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   L++ K G  I+N ARGG +DE AL   L++GH+A A  DVF  
Sbjct: 211 IHTPLIASTKGMISSAELTQMKPGSRILNVARGGTIDEPALLNALETGHIAGAALDVFAT 270

Query: 61  EP----ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP    +    L   P V   P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 271 EPPTPGSTSAQLIAHPRVIPTPHLGASTVEAQENVSIDVCEQVLQILGGSLPRSAVNAPL 330

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQEI------QIIYDGSTAVM-NTMVLNSA 169
           I  EE   ++PF+ L + +G    Q    +   +       +IY+G  + M NT  L +A
Sbjct: 331 ILPEEYKKLQPFVHLVEKIGSIYTQHYGSAKSPLSNRNTFDLIYEGEVSEMNNTKPLFAA 390

Query: 170 VLAGIVR--VWRVGANIISAPIIIKENAIILSTIK-RD 204
           ++ G++      +  NI++A ++ +E  II++  + RD
Sbjct: 391 LIKGLMSPISKDLNVNIVNAELVARERGIIVNEQRSRD 428


>gi|261198128|ref|XP_002625466.1| phosphoglycerate dehydrogenase [Ajellomyces dermatitidis SLH14081]
 gi|239595429|gb|EEQ78010.1| phosphoglycerate dehydrogenase [Ajellomyces dermatitidis SLH14081]
 gi|239615717|gb|EEQ92704.1| phosphoglycerate dehydrogenase [Ajellomyces dermatitidis ER-3]
 gi|327356769|gb|EGE85626.1| phosphoglycerate dehydrogenase [Ajellomyces dermatitidis ATCC
           18188]
          Length = 602

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 116/220 (52%), Gaps = 16/220 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T+ +++   LS+ K G  ++N ARGG  DE +L E L+SGH+A A  DVF  
Sbjct: 209 IHTPLIASTRGMISSAELSQLKRGARVLNVARGGTFDETSLLEALESGHLAGAAIDVFTS 268

Query: 61  EP----ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP    +    L   P V   P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 269 EPPAIGSSAAKLIAHPRVLATPHLGASTVEAQENVSIDVCEQVLQILSGALPRSAVNAPL 328

Query: 117 ISFEEAPLVKPFMTLADHLGC-FIGQLISESI-----QEIQIIYDGS-TAVMNTMVLNSA 169
           I  E    ++PF+ L + +G  +I    S +          +IY+G  + + NT  L +A
Sbjct: 329 ILPEVYKKLQPFVHLVEKMGSLYIQHFTSAATSTANSSTFDMIYEGEISGINNTKPLFAA 388

Query: 170 VLAGIV----RVWRVGANIISAPIIIKENAIILS-TIKRD 204
           ++ G++        V  NI++A +I KE  I+++    RD
Sbjct: 389 LIKGLIAPISSTAGVNVNIVNAELIAKERGIVVNERFSRD 428


>gi|225561271|gb|EEH09552.1| D-3-phosphoglycerate dehydrogenase [Ajellomyces capsulatus G186AR]
          Length = 598

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 116/222 (52%), Gaps = 16/222 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   LS+ K G  ++N ARGG  DE AL E L+S H+A A  DVF  
Sbjct: 209 IHTPLIASTKGMISSAELSQMKRGARVLNVARGGTFDEAALLEALESNHLAGAAIDVFTS 268

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP   +     L   P V   P+LGASTVE+QE V++ +  Q+   L   +  +A+N  +
Sbjct: 269 EPPAADSSASRLIAHPRVVATPHLGASTVEAQENVSMDVCEQVLQILKGALPRSAVNAPL 328

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQE------IQIIYDGSTAVM-NTMVLNSA 169
           I  EE   ++PF+ L + +G    Q  + +           +IY+G  A+  NT  L +A
Sbjct: 329 ILPEEYKKLQPFVHLVEKMGNLYTQHFTSTATSTANSSTFDLIYEGEIAMANNTKPLFAA 388

Query: 170 VLAGIV----RVWRVGANIISAPIIIKENAIILS-TIKRDKS 206
           ++ G++        +  NI++A +I +E  ++++    RD +
Sbjct: 389 LIKGLIAPISSTAGINVNIVNAELIARERGLVVNERFSRDPT 430


>gi|307196749|gb|EFN78208.1| D-3-phosphoglycerate dehydrogenase [Harpegnathos saltator]
          Length = 512

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 116/209 (55%), Gaps = 24/209 (11%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+ ++N  +L+K K GV IIN ARGG+VDE AL   L SGH   A  DVF  
Sbjct: 204 VHTPLIPQTRYMINAVSLAKCKKGVNIINVARGGIVDEEALLNSLNSGHCGGAALDVFTQ 263

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQM-------SDYLIDGVVS 109
           EP + NP    L   P V   P+LGAST E+Q++VA+++A Q        ++Y I G+V+
Sbjct: 264 EPPM-NPFIIELIQHPKVIPTPHLGASTAEAQQRVAVEIAQQFLALSGKSTEYAITGIVN 322

Query: 110 NALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTM----V 165
             +  A ++ E     +P++ L+  LG   G+ +   +     +Y  S  V N M     
Sbjct: 323 APVLTAAMTNEN----RPWIELSKKLGQLAGRFLKGKLN-TNTVY--SQTVGNGMQEKRF 375

Query: 166 LNSAVLAGIVR-VWRVGANIISAPIIIKE 193
           +++AVL G++    + G N+++AP + +E
Sbjct: 376 IHTAVLVGVLTGQTKNGLNLVNAPTLAQE 404


>gi|302542286|ref|ZP_07294628.1| phosphoglycerate dehydrogenase [Streptomyces hygroscopicus ATCC
           53653]
 gi|302459904|gb|EFL22997.1| phosphoglycerate dehydrogenase [Streptomyces himastatinicus ATCC
           53653]
          Length = 533

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L + K  V I+N ARGG+VDE ALA  L+ G VA AG DVF  
Sbjct: 206 VHLPKTPETVGLIGDEALRRVKPDVRIVNAARGGIVDEVALAAALKEGRVAGAGLDVFSK 265

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF   NV   P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 266 EPCTDSPLFEFDNVVATPHLGASTGEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 325

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    V+P + LA+ LG     L  E    + +   G     +  VL  + L G+   +
Sbjct: 326 ED----VRPGLPLAEKLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDI 381

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 382 VDETVSYVNAPLFAQERGV 400


>gi|40226201|gb|AAH32110.3| PHGDH protein [Homo sapiens]
          Length = 322

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 103/194 (53%), Gaps = 2/194 (1%)

Query: 9   TKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPL 68
           T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  EP     L
Sbjct: 2   TTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRAL 61

Query: 69  FGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEEAPLVKPF 128
               NV   P+LGAST E+Q +   ++A Q  D +    ++  +N   ++   +P  KP+
Sbjct: 62  VDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPW 121

Query: 129 MTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR--VWRVGANIIS 186
           + LA+ LG  +          IQ+I  G++       L+ AV+ G+++    +   N+++
Sbjct: 122 IGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVN 181

Query: 187 APIIIKENAIILST 200
           A +++KE  + ++T
Sbjct: 182 AKLLVKEAGLNVTT 195


>gi|78777073|ref|YP_393388.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas denitrificans DSM
           1251]
 gi|78497613|gb|ABB44153.1| D-3-phosphoglycerate dehydrogenase [Sulfurimonas denitrificans DSM
           1251]
          Length = 529

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 101/200 (50%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N+++   ++K K GV +INCARGGL +E AL   L SG +  AG DVF  
Sbjct: 204 IHTPKNKETVNMIDVAEIAKMKDGVVLINCARGGLYNEEALYAGLTSGKIRFAGIDVFMK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL  L NV  +P+LGA+T ESQ  + +Q A            ++A+N+ I   +
Sbjct: 264 EPATNHPLLDLDNVTVSPHLGANTYESQYNIGVQAAENAIAAAKGISYAHAMNLPIDESK 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P VKPF+ +   +G    QL    I  I++   G  A     +     +  + ++   
Sbjct: 324 IPPFVKPFLEMGQTIGFLETQLNQSQIVTIKVSGQGEIAKYVDSLATFVAVGAMSQISDN 383

Query: 181 GANIISAPIIIKENAIILST 200
             N ++A  + KE  I + T
Sbjct: 384 TINYVNADFVAKEKGIKIET 403


>gi|313682014|ref|YP_004059752.1| d-3-phosphoglycerate dehydrogenase [Sulfuricurvum kujiense DSM
           16994]
 gi|313154874|gb|ADR33552.1| D-3-phosphoglycerate dehydrogenase [Sulfuricurvum kujiense DSM
           16994]
          Length = 529

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/200 (32%), Positives = 103/200 (51%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T  ++  + ++K K GV +INCARGGL DE+AL + L+SG +  AG DVF  
Sbjct: 205 IHTPKNKETVGMIGADEIAKMKDGVVLINCARGGLYDEDALYDGLKSGKIRFAGIDVFNK 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA+ N L  L N+  +P+LGA+T ESQ  +A++ A Q  +        +ALN+ I   +
Sbjct: 265 EPAIDNKLLDLDNICVSPHLGANTFESQYNIAVEAAQQAIEAAKGIAYPHALNLPIDETK 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               VKPF+ +   +G    Q+    I  I++   G  A     +     +  +  +   
Sbjct: 325 IPAFVKPFLEMGQKIGFLASQMNKAPIVSIKVSGRGDIAEYVNSLATFVTVGALADISGD 384

Query: 181 GANIISAPIIIKENAIILST 200
             N ++A  + KE  I + T
Sbjct: 385 TINYVNADFVAKERGIKVET 404


>gi|296803933|ref|XP_002842819.1| D-3-phosphoglycerate dehydrogenase [Arthroderma otae CBS 113480]
 gi|238846169|gb|EEQ35831.1| D-3-phosphoglycerate dehydrogenase [Arthroderma otae CBS 113480]
          Length = 571

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 117/218 (53%), Gaps = 14/218 (6%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK++++   L++ K G  I+N ARGG +DE AL   L+SGH+A A  DVF  
Sbjct: 211 IHTPLIASTKDMISTAELAQMKPGSRILNVARGGTIDELALLNALESGHIAGAAIDVFAT 270

Query: 61  EP----ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP    +    L   P V   P+LGAST+E+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 271 EPPSPGSASAKLVAHPQVIPTPHLGASTIEAQENVSIDVCEQVLQILGGALPRSAVNAPL 330

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQEI------QIIYDGSTAVM-NTMVLNSA 169
           I  EE   ++P++ L + +G    Q       ++       +IY+G  A M NT  L +A
Sbjct: 331 ILPEEYKKLQPYVRLVEKIGSIYTQHYGAVKDQVSNCNTFDLIYEGEVAEMTNTKPLFTA 390

Query: 170 VLAGIVRVWRVGAN--IISAPIIIKENAIILSTIK-RD 204
           ++ G++       N  I++A ++ +E  II++  + RD
Sbjct: 391 LIKGLISPISKDLNVSIVNAELVARERGIIINERRSRD 428


>gi|327301994|ref|XP_003235689.1| D-3-phosphoglycerate dehydrogenase [Trichophyton rubrum CBS 118892]
 gi|326461031|gb|EGD86484.1| D-3-phosphoglycerate dehydrogenase [Trichophyton rubrum CBS 118892]
          Length = 571

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 116/218 (53%), Gaps = 14/218 (6%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   L++ K G  I+N ARGG +DE AL   L++GH+A A  DVF  
Sbjct: 211 IHTPLIASTKGMISSVELAQMKPGSRILNVARGGTIDEPALMNALETGHIAGAALDVFAT 270

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP         L   P V   P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 271 EPPTSGSTSAQLIAHPRVIPTPHLGASTVEAQENVSIDVCEQVLQILGGSLPRSAVNAPL 330

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQEI------QIIYDGSTAVM-NTMVLNSA 169
           I  EE   ++PF+ L + +G    Q    +   +       +IY+G  + M NT  L +A
Sbjct: 331 ILPEEYKKLQPFVHLVEKIGSIYTQHYGSAKSPLSNRNTFDLIYEGEVSEMNNTKPLFAA 390

Query: 170 VLAGIVR--VWRVGANIISAPIIIKENAIILSTIK-RD 204
           ++ G++      +  NI++A ++ +E  II++  + RD
Sbjct: 391 LIKGLMSPISKDLNVNIVNAELVARERGIIVNEQRSRD 428


>gi|302503639|ref|XP_003013779.1| hypothetical protein ARB_07891 [Arthroderma benhamiae CBS 112371]
 gi|291177345|gb|EFE33139.1| hypothetical protein ARB_07891 [Arthroderma benhamiae CBS 112371]
          Length = 575

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/218 (32%), Positives = 116/218 (53%), Gaps = 14/218 (6%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   L++ K G  I+N ARGG +DE AL   L++GH+A A  DVF  
Sbjct: 215 IHTPLIASTKGMISSAELAQMKRGSRILNVARGGTIDEPALLNALETGHIAGAALDVFAT 274

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP         L   P V   P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 275 EPPTSGSASAQLIAHPRVIPTPHLGASTVEAQENVSIDVCEQVLQILGGSLPRSAVNAPL 334

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQEI------QIIYDGSTAVM-NTMVLNSA 169
           I  EE   ++PF+ L + +G    Q    +   +       +IY+G  + M NT  L +A
Sbjct: 335 ILPEEYKKLQPFVHLVEKIGSIYTQHYGSAKSPLSNRNTFDLIYEGEVSEMNNTKPLFAA 394

Query: 170 VLAGIVR--VWRVGANIISAPIIIKENAIILSTIK-RD 204
           ++ G++      +  NI++A ++ +E  I+++  + RD
Sbjct: 395 LIKGLMSPISKDLNVNIVNAELVARERGIVVNEQRSRD 432


>gi|296270774|ref|YP_003653406.1| D-3-phosphoglycerate dehydrogenase [Thermobispora bispora DSM
           43833]
 gi|296093561|gb|ADG89513.1| D-3-phosphoglycerate dehydrogenase [Thermobispora bispora DSM
           43833]
          Length = 529

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 102/199 (51%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++    L   K  V +IN ARGG++DENAL   L+ G VA A  DVF  
Sbjct: 201 VHLPKTKETIGLIGDRELQLVKPTVRLINVARGGIIDENALYAALKEGRVAGAALDVFAK 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP  ++PLF   NV   P+LGAST E+QEK   Q+A  +   L    V +A+N+   +I+
Sbjct: 261 EPCTESPLFEFDNVVVTPHLGASTHEAQEKAGTQVARSVKLALAGEFVPDAVNVQGGVIA 320

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRV 177
            E    +KP + L + LG     L  E    + +   G  A  +  V+  A L G+   V
Sbjct: 321 EE----IKPGLPLTEKLGRIFTALAGEVASRLDVEVRGEIAEKDVRVIELAALKGVFTDV 376

Query: 178 WRVGANIISAPIIIKENAI 196
                  ++AP++ K+  +
Sbjct: 377 VEDAVTYVNAPLLAKDRGM 395


>gi|46198894|ref|YP_004561.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB27]
 gi|46196518|gb|AAS80934.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB27]
          Length = 521

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 119/210 (56%), Gaps = 6/210 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ ++ +  L     G  ++N ARGG++DE AL E+L+ GH+  AG DVF  
Sbjct: 197 VHTPLTEETRGMIGRRELYLLPRGAVVVNAARGGIIDEKALLEVLEEGHLFAAGLDVFAE 256

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++ PL   P V    +LGA+T+E+QE+V   +  ++   L +G +S ALN      
Sbjct: 257 EPPPKDHPLIHHPRVVHTAHLGANTLEAQERVGEAILERVVRTL-EGDLSYALNTG-FDP 314

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
           E    +K F+ L + LG  + Q+     + +++ + G     +   + SAV  G++ RV 
Sbjct: 315 EALEALKGFLPLGEALGKLLAQITRGRPEALEVRFLGQFE-KDPEPIASAVAKGLLARVL 373

Query: 179 RVGA-NIISAPIIIKENAIILSTIKRDKSG 207
             GA N++SA  ++K+  I L+T++ +++G
Sbjct: 374 GEGAVNLVSARPLLKDRGIHLTTLRSEEAG 403


>gi|115691163|ref|XP_001203904.1| PREDICTED: similar to D-3-phosphoglycerate dehydrogenase
           [Strongylocentrotus purpuratus]
 gi|115735613|ref|XP_795649.2| PREDICTED: similar to D-3-phosphoglycerate dehydrogenase
           [Strongylocentrotus purpuratus]
          Length = 493

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 92/186 (49%), Gaps = 2/186 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +TK +L   +    K GV ++N ARGG++DE  L   L +G    A  DVF  
Sbjct: 168 VHTPLIPQTKGLLGDASFKLCKPGVKVVNVARGGIIDEEGLVRALDAGQCGGAALDVFVQ 227

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     L   P V   P+LGASTVE+QE+VA ++A Q  D +    +  A+N   +S  
Sbjct: 228 EPPTYTALIQHPKVIVTPHLGASTVEAQERVACEIAEQFVDGVNGKSLFGAINAQALSNA 287

Query: 121 EAPLVKPFMTLADHLGCFIGQLISE--SIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
             P  KP ++L   LG     L     S   IQ+   G +       L +AV AGI+RV 
Sbjct: 288 LTPETKPMVSLGQGLGVVAASLAKGQLSAASIQVTTYGPSLKKAGSYLKAAVSAGILRVQ 347

Query: 179 RVGANI 184
             G N+
Sbjct: 348 TGGNNV 353


>gi|308177181|ref|YP_003916587.1| phosphoglycerate dehydrogenase [Arthrobacter arilaitensis Re117]
 gi|307744644|emb|CBT75616.1| phosphoglycerate dehydrogenase [Arthrobacter arilaitensis Re117]
          Length = 531

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 66/197 (33%), Positives = 107/197 (54%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +L K+  +K K    ++N ARGGLVD++AL E L+   +A AG DVF  
Sbjct: 203 IHMPKTPETLGMLGKDAFTKMKKSAYVVNVARGGLVDQDALYEALKDEEIAGAGIDVFVK 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP+   P F   NV   P+LGAST E+QEK  + +A  +   L   +V +A+N+A    +
Sbjct: 263 EPSTDLPFFEFENVTVTPHLGASTDEAQEKAGVSVAKSVRLALAGELVPDAVNVAGGVID 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVWR 179
           E   V+P + L + LG     L S S+  I +   G  A ++   L  + L G+ + V  
Sbjct: 323 EN--VRPGIPLIEKLGRIFNALTSGSLTSIDVEVAGEIASLDVKALELSALKGVFMDVVS 380

Query: 180 VGANIISAPIIIKENAI 196
              + ++AP++ ++  +
Sbjct: 381 DQVSYVNAPVLAEQRGV 397


>gi|197118344|ref|YP_002138771.1| D-3-phosphoglycerate dehydrogenase [Geobacter bemidjiensis Bem]
 gi|197087704|gb|ACH38975.1| D-3-phosphoglycerate dehydrogenase [Geobacter bemidjiensis Bem]
          Length = 532

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 119/212 (56%), Gaps = 8/212 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T N++ K+ L+  K GV +IN ARGG+++E A+ E L SG V  A FDV+  
Sbjct: 200 VHTPLTAETSNMIGKKELAAMKEGVIVINAARGGIINEEAMLEALDSGKVTGAAFDVWSQ 259

Query: 61  EPALQN---PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP   +    L G   +   P+LGA+T E+Q  VA+ ++ ++  YL +  + NA+N  I 
Sbjct: 260 EPPDTDTLKKLIGHEKMVVTPHLGANTFEAQVNVAVDVSREIIHYLDEQPLENAIN--IP 317

Query: 118 SFEEAPL--VKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            F+ A +  ++P++ L + L  F+ QL+  ++ +I   Y G+ A  +   +    LA ++
Sbjct: 318 RFDAALMGQMRPYLNLMNVLSDFVIQLVDTNLNKITFTYTGNLAQYDCTPITVLGLASLL 377

Query: 176 -RVWRVGANIISAPIIIKENAIILSTIKRDKS 206
            R      N+++A ++     I++  +K +++
Sbjct: 378 NRRVEQDVNMVNAQLVADNMGIVVEEVKSNQA 409


>gi|237752566|ref|ZP_04583046.1| d-3-phosphoglycerate dehydrogenase [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376055|gb|EEO26146.1| d-3-phosphoglycerate dehydrogenase [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 527

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 71/210 (33%), Positives = 112/210 (53%), Gaps = 4/210 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N+++   ++K K GV +INCARGGL +E+AL   L+SG V  AG DVF  
Sbjct: 204 IHTPKNKETINMIDTPQIAKMKDGVILINCARGGLYNEDALYAALESGKVRWAGIDVFTK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   N L  L N++  P++GA+T+ESQEK+AIQ A    +        NALN+ I   E
Sbjct: 264 EPGTSNKLLDLKNIYVTPHIGANTLESQEKIAIQAAQAALEAARGSSFPNALNLPIKENE 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               +K ++ L   +  F  Q+  + ++ I +  +G         L++  L GI+    V
Sbjct: 324 LPNFMKAYLELVQKMAFFAIQVNKDEVRSITLEAEGEIKKY-LASLSTFALVGILNA-TV 381

Query: 181 G--ANIISAPIIIKENAIILSTIKRDKSGV 208
           G   N ++AP + +E  I +    ++  G+
Sbjct: 382 GDKVNYVNAPYVAQERGIEVKLEGKESQGI 411


>gi|170781815|ref|YP_001710147.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169156383|emb|CAQ01531.1| D-3-phosphoglycerate dehydrogenase [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 529

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/197 (31%), Positives = 107/197 (54%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T  T  +++ E  +  K  + I+N +RGG++DE+AL   L+S  +A AG DVF  
Sbjct: 201 IHIPKTPDTTGLISTEQFALAKPSLRIVNASRGGIIDEDALYTALKSKRIAGAGLDVFVS 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL  + N+   P+LGAST E+QEK  + +A  +   L   +V +A+N+A    +
Sbjct: 261 EPPTGSPLLEVDNIIVTPHLGASTDEAQEKAGVSVARSVRLALGGELVPDAVNVAGGVID 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVWR 179
             P V+P + L + LG     L  E++  I ++  G  A  +  VL  A L G+   V  
Sbjct: 321 --PYVRPGIPLMEKLGQVFSGLAHEALTSIDVVVRGELAGYDVSVLKLAALKGVFTNVVS 378

Query: 180 VGANIISAPIIIKENAI 196
              + ++AP++ ++  +
Sbjct: 379 ENVSYVNAPLLAEQRGL 395


>gi|154313912|ref|XP_001556281.1| hypothetical protein BC1G_04899 [Botryotinia fuckeliana B05.10]
 gi|150849045|gb|EDN24238.1| hypothetical protein BC1G_04899 [Botryotinia fuckeliana B05.10]
          Length = 487

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 123/225 (54%), Gaps = 19/225 (8%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T +++ KE L+K K    ++N ARGG+ +E AL + L +G +A AG DVF  
Sbjct: 218 IHTPLIASTLDLIGKEELAKMKKTAKVLNVARGGVYNEQALLDALDAGIIAGAGLDVFTS 277

Query: 61  EPALQN----PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP + +     L     V   P+LGAST+E+QE V++ +  Q+   L  G+ ++A+N  +
Sbjct: 278 EPPVPSSPAQKLTQHSKVVATPHLGASTIEAQESVSVDVCTQVRAILSGGLPTSAVNAPL 337

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISE---SIQEIQIIYDGSTA-VMNTMVLNSAVLA 172
           I  EE   ++PF+ L + +G    Q         ++ +++Y+G  A + NT  L +A++ 
Sbjct: 338 ILPEEYKKLQPFVKLMEKMGGLYTQHYRGKGVGGKKFEVVYEGELAGIANTRPLFAALVK 397

Query: 173 GIV-----RVWRVGANIISAPIIIKENAIILSTIK-----RDKSG 207
           G+V     R  R   NI++A ++ KE  I++S  +      D+SG
Sbjct: 398 GLVGSISERGGR-DVNIVNASLLAKERGIVISETRVSETALDRSG 441


>gi|302537104|ref|ZP_07289446.1| phosphoglycerate dehydrogenase [Streptomyces sp. C]
 gi|302445999|gb|EFL17815.1| phosphoglycerate dehydrogenase [Streptomyces sp. C]
          Length = 529

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE AL   ++ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGDEALHKVKPSVRIVNAARGGIVDEAALYSAIKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V C P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFELDQVVCTPHLGASTDEAQEKAGIAVAKSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    V+P + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VRPGLPLAEKLGRIFTALAGEVAVRLDVEVCGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|254383224|ref|ZP_04998577.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. Mg1]
 gi|194342122|gb|EDX23088.1| D-3-phosphoglycerate dehydrogenase [Streptomyces sp. Mg1]
          Length = 529

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 105/199 (52%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE AL   ++ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGDEALHKVKPSVRIVNAARGGIVDEAALYTAIKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF L  V C P+LGAST E+QEK  + +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFELDQVVCTPHLGASTDEAQEKAGVSVAKSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    V+P + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VRPGLPLAEKLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|159128988|gb|EDP54102.1| D-3-phosphoglycerate dehydrogenase [Aspergillus fumigatus A1163]
          Length = 584

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 112/213 (52%), Gaps = 15/213 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   L++ K G  I+N ARGG +DE AL E L+SGH+A A  DVF  
Sbjct: 207 IHTPLIASTKGMISTAELAQMKPGARILNVARGGTIDEAALLESLESGHLAAAAIDVFTT 266

Query: 61  EP----ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP    +    L   P     P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 267 EPPQPESTAARLVAHPRAVVTPHLGASTVEAQENVSIDVCEQVLQILNGSLPRSAVNAPL 326

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESI------QEIQIIYDGSTA-VMNTMVLNSA 169
           I  +E   ++PF+ L + +G    Q  + ++          +IY G  A + NT  L +A
Sbjct: 327 ILPDEYRKLQPFVRLVEKMGSLYTQHYASTVGGSMTRNTFDLIYHGEVAGISNTRPLFAA 386

Query: 170 VLAGIVRVWR----VGANIISAPIIIKENAIIL 198
           ++ G++        +  NI++A ++ +E  I +
Sbjct: 387 LIKGLLAPISGSEGININIVNAELVARERGIFV 419


>gi|307326525|ref|ZP_07605720.1| D-3-phosphoglycerate dehydrogenase [Streptomyces violaceusniger Tu
           4113]
 gi|306887933|gb|EFN18924.1| D-3-phosphoglycerate dehydrogenase [Streptomyces violaceusniger Tu
           4113]
          Length = 533

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 106/199 (53%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  + I+N ARGG+VDE ALA  L+ G VA AG DVF  
Sbjct: 206 VHLPKTPETVGLIGDEALHKVKPELRIVNAARGGIVDEVALAAALKEGRVAGAGLDVFSQ 265

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP  ++PLF   NV   P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 266 EPCTESPLFEFDNVVVTPHLGASTGEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 325

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    V+P + LA+ LG     L  E    + +   G     +  VL  + L G+   +
Sbjct: 326 ED----VRPGLPLAEKLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDI 381

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 382 VDETVSYVNAPLFAQERGV 400


>gi|123966748|ref|YP_001011829.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           MIT 9515]
 gi|123201114|gb|ABM72722.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. MIT 9515]
          Length = 528

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 92/158 (58%), Gaps = 2/158 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T++T+N+++ + L   K    +INCARGG++DE ALAE L    +  A  DVF  
Sbjct: 199 LHLPRTSETENLVDMKVLKSMKDNAKLINCARGGIIDEEALAEALNKSLIGGAAIDVFAE 258

Query: 61  EPALQN-PLFGL-PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP   N PL  +  N+   P+LGAST E+QE VA+ +A Q+ D L+      A+N+  +S
Sbjct: 259 EPLDSNSPLLKVDKNLILTPHLGASTREAQENVAVDVAEQIRDVLLGLSARTAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDG 156
            +    +KP + LA+ +G  I QL    IQ++ +   G
Sbjct: 319 PDIMDSLKPHLQLAETMGLLISQLSGGKIQKLDLRLQG 356


>gi|189425146|ref|YP_001952323.1| D-3-phosphoglycerate dehydrogenase [Geobacter lovleyi SZ]
 gi|189421405|gb|ACD95803.1| D-3-phosphoglycerate dehydrogenase [Geobacter lovleyi SZ]
          Length = 535

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 115/206 (55%), Gaps = 4/206 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT++TK ++    L+  K GV ++N ARGG++DE AL + + +G +A AG DV+  
Sbjct: 200 VHTPLTDETKGMIGARELAMMKDGVIVMNVARGGIIDEPALLDAMNNGKIAIAGVDVWSE 259

Query: 61  EPALQNPLFGL---PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAII 117
           EP   + L GL   P V   P+LGA+T E+Q  VA+ ++ ++ +YL +  + NA+N+   
Sbjct: 260 EPPKTDVLKGLIAHPRVTVTPHLGANTHEAQINVAVDVSKEILNYLDEKPLENAVNIPRF 319

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-R 176
                  ++PF+ L + +  F  QL+    ++I   Y G+ A  +   L    LA ++ R
Sbjct: 320 DMALMDQMRPFLNLVNVMADFGIQLLDGHPEKITFSYAGAIAHYDCSPLTVCGLAALLGR 379

Query: 177 VWRVGANIISAPIIIKENAIILSTIK 202
           V     N+++A +I ++  I++   K
Sbjct: 380 VVDQDVNMVNASLIAEQMGIVVEETK 405


>gi|318042229|ref|ZP_07974185.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. CB0101]
          Length = 528

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 112/209 (53%), Gaps = 3/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N E L   K    I+NCARGG++DE+A+AE ++ G +A A  DV+  
Sbjct: 199 LHLPRTPDTENLVNAELLRTMKPTARIVNCARGGIIDESAIAEAVEKGVIAGAALDVYAK 258

Query: 61  EPALQNPLFG--LPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP   +         +   P+LGAST E+QE VAI +A Q+ D L+     +A+N+  ++
Sbjct: 259 EPLEADSALRSVSERLILTPHLGASTEEAQENVAIDVAEQIRDVLLGLPARSAVNIPGLN 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
            E    +KP + LA+ LG  + QL    I E+++   G  A      L  A L G++   
Sbjct: 319 AEVMEQLKPHLQLAETLGQLLSQLAGGQISELEVRLQGEFASHPAQPLVIAALKGLLSTA 378

Query: 179 RVGA-NIISAPIIIKENAIILSTIKRDKS 206
              + N ++A +  K+  I +  +K D +
Sbjct: 379 LGDSINYVNAGLEAKDRGIHVLEVKDDAA 407


>gi|284992450|ref|YP_003411004.1| D-3-phosphoglycerate dehydrogenase [Geodermatophilus obscurus DSM
           43160]
 gi|284065695|gb|ADB76633.1| D-3-phosphoglycerate dehydrogenase [Geodermatophilus obscurus DSM
           43160]
          Length = 533

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 98/177 (55%), Gaps = 7/177 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++    L+ TK GV I+N ARGGLVDE ALAE L SG V  AG DV+  
Sbjct: 203 IHLPKTPETLGLIGVAELATTKRGVIIVNAARGGLVDEAALAEALASGQVGAAGIDVYAT 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM---AII 117
           EP   +PLFGL N    P+LGAST E+Q+K    +AH +   L    V +A+N+    ++
Sbjct: 263 EPCTDSPLFGLANTVVTPHLGASTTEAQDKAGTAVAHSVRLALQGEFVPDAVNVQAGGVV 322

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           + +    V+P + LA+ LG     +     Q + +   G  A  +  VL  AVL G+
Sbjct: 323 AED----VRPGLPLAEKLGRVFTAVAGGLAQSVTVDVRGRIAEFDDSVLQLAVLRGV 375


>gi|70989461|ref|XP_749580.1| D-3-phosphoglycerate dehydrogenase [Aspergillus fumigatus Af293]
 gi|66847211|gb|EAL87542.1| D-3-phosphoglycerate dehydrogenase [Aspergillus fumigatus Af293]
          Length = 635

 Score =  108 bits (269), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 112/213 (52%), Gaps = 15/213 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   L++ K G  I+N ARGG +DE AL E L+SGH+A A  DVF  
Sbjct: 258 IHTPLIASTKGMISTAELAQMKPGARILNVARGGTIDEAALLESLESGHLAAAAIDVFTT 317

Query: 61  EP----ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP    +    L   P     P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 318 EPPQPESTAARLVAHPRAVVTPHLGASTVEAQENVSIDVCEQVLQILNGSLPRSAVNAPL 377

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESI------QEIQIIYDGSTA-VMNTMVLNSA 169
           I  +E   ++PF+ L + +G    Q  + ++          +IY G  A + NT  L +A
Sbjct: 378 ILPDEYRKLQPFVRLVEKMGSLYTQHYASTVGGSMTRNTFDLIYHGEVAGISNTRPLFAA 437

Query: 170 VLAGIVRVWR----VGANIISAPIIIKENAIIL 198
           ++ G++        +  NI++A ++ +E  I +
Sbjct: 438 LIKGLLAPISGSEGININIVNAELVARERGIFV 470


>gi|237749847|ref|ZP_04580327.1| d-3-phosphoglycerate dehydrogenase [Helicobacter bilis ATCC 43879]
 gi|229374597|gb|EEO24988.1| d-3-phosphoglycerate dehydrogenase [Helicobacter bilis ATCC 43879]
          Length = 535

 Score =  107 bits (268), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 89/156 (57%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++  + ++K K GV +INCARGGL +EN L E L+S  +A AG DVF+ 
Sbjct: 207 IHTPKNKQTTNMITSKEIAKMKDGVILINCARGGLYNENDLYEGLKSKKIAWAGLDVFDS 266

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  N L  L N++  P++GA+T+ESQEK+AI+ AH            NALN+   + +
Sbjct: 267 EPATNNKLLDLDNIYVTPHIGANTLESQEKIAIEAAHAAISAARGSAFPNALNLPTKTQD 326

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDG 156
               +  ++ L   L  F  Q I  +I  + +  +G
Sbjct: 327 MPDSIIAYLELTQKLAYFAAQAIDGAISALHVYING 362


>gi|302666561|ref|XP_003024878.1| hypothetical protein TRV_00953 [Trichophyton verrucosum HKI 0517]
 gi|291188954|gb|EFE44267.1| hypothetical protein TRV_00953 [Trichophyton verrucosum HKI 0517]
          Length = 571

 Score =  107 bits (268), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 116/218 (53%), Gaps = 14/218 (6%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   L++ K G  I+N ARGG +DE AL   L++GH+A A  DVF  
Sbjct: 211 IHTPLIASTKGMISSAELAQMKPGSRILNVARGGTIDEPALLNALETGHIAGAALDVFAT 270

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP         L   P V   P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 271 EPPTSGSASAQLIAHPRVIPTPHLGASTVEAQENVSIDVCEQVLQILGGSLPRSAVNAPL 330

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQEI------QIIYDGSTAVM-NTMVLNSA 169
           I  EE   ++P++ L + +G    Q    +   +       +IY+G  + M NT  L +A
Sbjct: 331 ILPEEYKKLQPYVHLVEKIGSIYTQHYGSAKSPLSNRNTFDLIYEGEVSEMNNTKPLFAA 390

Query: 170 VLAGIVR--VWRVGANIISAPIIIKENAIILSTIK-RD 204
           ++ G++      +  NI++A ++ +E  I+++  + RD
Sbjct: 391 LIKGLMSPISKDLNVNIVNAELVARERGIVVNEQRSRD 428


>gi|302554336|ref|ZP_07306678.1| phosphoglycerate dehydrogenase [Streptomyces viridochromogenes DSM
           40736]
 gi|302471954|gb|EFL35047.1| phosphoglycerate dehydrogenase [Streptomyces viridochromogenes DSM
           40736]
          Length = 529

 Score =  107 bits (268), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 103/199 (51%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE AL   L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGDEALRKVKPSVRIVNAARGGIVDEEALYSALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V   P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFEFDQVVSTPHLGASTDEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|297202558|ref|ZP_06919955.1| phosphoglycerate dehydrogenase [Streptomyces sviceus ATCC 29083]
 gi|197709915|gb|EDY53949.1| phosphoglycerate dehydrogenase [Streptomyces sviceus ATCC 29083]
          Length = 529

 Score =  107 bits (267), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 103/199 (51%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE AL   L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETVGLIGDEALRKVKPSVRIVNAARGGIVDEEALYSALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V   P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFEFDQVVATPHLGASTDEAQEKAGIAVARSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VAETVSYVNAPLFAQERGV 396


>gi|218295353|ref|ZP_03496166.1| D-3-phosphoglycerate dehydrogenase [Thermus aquaticus Y51MC23]
 gi|218243985|gb|EED10511.1| D-3-phosphoglycerate dehydrogenase [Thermus aquaticus Y51MC23]
          Length = 521

 Score =  107 bits (267), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 117/210 (55%), Gaps = 6/210 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ ++ +  L     G  ++N ARGG+VDE AL E+L+ GH+  AG DVF  
Sbjct: 197 VHTPLTEETRGMIGRRELYLLPRGAVVVNAARGGIVDERALLEVLEEGHLFAAGLDVFSE 256

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++ PL   P V    +LGA+T+E+QE+V   +  ++   L +G +S ALN      
Sbjct: 257 EPPPKDHPLLKHPRVVLTAHLGANTLEAQERVGEAILERVVRTL-EGDLSYALNTG-FDP 314

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
           E    ++ F+ L + LG  + Q+     Q +++ + G     +   + SAV  G++ RV 
Sbjct: 315 EALQALRGFLPLGEALGRLLAQITRGRPQVLEVAFLGQYE-KDPEPVASAVAKGLLSRVL 373

Query: 179 RVGA-NIISAPIIIKENAIILSTIKRDKSG 207
              A N++SA  ++KE  I L T +++++G
Sbjct: 374 GPEAVNLVSARPLLKERGIRLVTQRQEEAG 403


>gi|302781594|ref|XP_002972571.1| hypothetical protein SELMODRAFT_413037 [Selaginella moellendorffii]
 gi|300160038|gb|EFJ26657.1| hypothetical protein SELMODRAFT_413037 [Selaginella moellendorffii]
          Length = 378

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 113/211 (53%), Gaps = 23/211 (10%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+PLT+ T+ I N E  +K K GV IIN ARGG++DE AL + L +G VA+A  DVFE 
Sbjct: 55  LHMPLTDDTRGIFNDETFAKVKKGVRIINVARGGVIDEAALIKALDNGTVAQAAHDVFEQ 114

Query: 61  E-PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           E PA  N +    NV   P+LGASTVE+QE VA+++A  +   L   + + A+N      
Sbjct: 115 EPPAKDNKVVQHENVIVTPHLGASTVEAQEGVAVEIAEAVVGALRGELSATAVN------ 168

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAV--MNTMVLNSAVLAGIVR- 176
             AP+V   +               + ++++ I Y  + +   ++T +L + ++ G+V  
Sbjct: 169 --APMVSSKLVAG-----------GDGVKDVTISYTSARSPDDLDTRLLRAMIVKGLVEP 215

Query: 177 VWRVGANIISAPIIIKENAIILSTIKRDKSG 207
           V     N+++A  + K+  I +S  +    G
Sbjct: 216 VSDAFINLVNADYVAKQRGIRISEERHPAEG 246


>gi|21223871|ref|NP_629650.1| D-3-phosphoglycerate dehydrogenase [Streptomyces coelicolor A3(2)]
 gi|256785031|ref|ZP_05523462.1| D-3-phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
 gi|289768924|ref|ZP_06528302.1| phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
 gi|4467266|emb|CAB37591.1| probable D-3-phosphoglycerate dehydrogenase [Streptomyces
           coelicolor A3(2)]
 gi|289699123|gb|EFD66552.1| phosphoglycerate dehydrogenase [Streptomyces lividans TK24]
          Length = 529

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 103/199 (51%), Gaps = 7/199 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E L K K  V I+N ARGG+VDE AL   L+ G VA AG DV+  
Sbjct: 202 VHLPKTPETLGLIGDEALRKVKPSVRIVNAARGGIVDEEALYSALKEGRVAGAGLDVYAK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM--AIIS 118
           EP   +PLF    V   P+LGAST E+QEK  I +A  +   L   +V +A+N+   +I+
Sbjct: 262 EPCTDSPLFEFDQVVATPHLGASTDEAQEKAGIAVAKSVRLALAGELVPDAVNVQGGVIA 321

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-V 177
            +    VKP + LA+ LG     L  E    + +   G     +  VL  + L G+   V
Sbjct: 322 ED----VKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQHDVKVLELSALKGVFEDV 377

Query: 178 WRVGANIISAPIIIKENAI 196
                + ++AP+  +E  +
Sbjct: 378 VDETVSYVNAPLFAQERGV 396


>gi|298252299|ref|ZP_06976102.1| D-3-phosphoglycerate dehydrogenase [Ktedonobacter racemifer DSM
           44963]
 gi|297546891|gb|EFH80759.1| D-3-phosphoglycerate dehydrogenase [Ktedonobacter racemifer DSM
           44963]
          Length = 575

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 110/210 (52%), Gaps = 8/210 (3%)

Query: 1   LHVPLTNK---TKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDV 57
           LH  LT+    T+ ++++  L   K G  +INCARGGL++E AL   L  G +A A  DV
Sbjct: 218 LHTSLTSGPQGTRGLISEHELQIMKPGARLINCARGGLINEKALLNALNEGRLAGAALDV 277

Query: 58  FEVEPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           F  EP   +     L     V   P+LGAST E+Q  VA  +A Q+   L  G    A+N
Sbjct: 278 FSQEPIRDDETLLQLLAHDRVIATPHLGASTEEAQVGVATDVAEQIVSVLNGGFPRAAVN 337

Query: 114 MAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAG 173
             +I  E   +++P+MTL + +G    QL    + +I++ Y+G  A  +   L +A++ G
Sbjct: 338 APLILPETLKVLEPYMTLLEKMGRLYTQLQPGPLSKIEVTYNGDIASYDLRPLQAALIKG 397

Query: 174 IVR-VWRVGANIISAPIIIKENAIILSTIK 202
           ++  V     N+I+A ++ KE  + ++  K
Sbjct: 398 LLESVSEAHVNMINAQLLAKERGLEITEQK 427


>gi|281412819|ref|YP_003346898.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermotoga naphthophila RKU-10]
 gi|281373922|gb|ADA67484.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
           [Thermotoga naphthophila RKU-10]
          Length = 306

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 70/102 (68%), Gaps = 3/102 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT  T++I+N+E+++K K GV I+N ARGG +DE AL E L SG V  AG DVFEV
Sbjct: 199 LHVPLTESTRHIINRESIAKMKDGVIIVNTARGGTIDEEALYEALVSGKVYAAGLDVFEV 258

Query: 61  EP---ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQM 99
           EP    ++  L  L NV   P++GAST E+Q +V I+L  ++
Sbjct: 259 EPPTDEIRKKLLSLDNVVATPHIGASTDEAQNRVGIELVEKI 300


>gi|41054619|ref|NP_955871.1| D-3-phosphoglycerate dehydrogenase [Danio rerio]
 gi|33990002|gb|AAH56334.1| Zgc:65956 [Danio rerio]
          Length = 527

 Score =  107 bits (267), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 107/204 (52%), Gaps = 5/204 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN  + +K K GV ++NCARGG++DE AL   L+SG    AG DVF  
Sbjct: 205 VHTPLMASTTGLLNDASFAKCKKGVKVVNCARGGIIDEAALLRALESGQCGGAGLDVFVE 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  +  L   PNV   P+LGAST E+Q +    +A Q+ D      +  A+N  +++  
Sbjct: 265 EPPRERALVNHPNVISCPHLGASTKEAQARCGKDIALQIVDMASGKALVGAVNAQVLAST 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQ---EIQIIYDGSTAVMNTMVLNSAVLAGIV-R 176
            +P  + ++ L + +G  + +  S S Q   ++ +   G     +T  L+SA + G++  
Sbjct: 325 FSPDSQQWIRLGESMGKVL-KACSASTQPCSQLHVTSLGEALKKSTGFLSSAAVVGLLTE 383

Query: 177 VWRVGANIISAPIIIKENAIILST 200
               G N+++A  + KE  I + T
Sbjct: 384 APHNGPNLVNALPLAKETGITVHT 407


>gi|170289217|ref|YP_001739455.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermotoga sp. RQ2]
 gi|170176720|gb|ACB09772.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Thermotoga sp. RQ2]
          Length = 306

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 70/102 (68%), Gaps = 3/102 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT  T++I+N+E+++K K GV I+N ARGG +DE AL E L SG V  AG DVFEV
Sbjct: 199 LHVPLTESTRHIINRESIAKMKDGVIIVNTARGGTIDEEALYEALVSGKVYAAGLDVFEV 258

Query: 61  EP---ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQM 99
           EP    ++  L  L NV   P++GAST E+Q +V I+L  ++
Sbjct: 259 EPPTDEIRRKLLSLDNVVATPHIGASTDEAQNRVGIELVEKI 300


>gi|15644153|ref|NP_229202.1| D-3-phosphoglycerate dehydrogenase [Thermotoga maritima MSB8]
 gi|4981965|gb|AAD36472.1|AE001793_2 D-3-phosphoglycerate dehydrogenase [Thermotoga maritima MSB8]
          Length = 306

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 70/102 (68%), Gaps = 3/102 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT  T++I+N+E+++K K GV I+N ARGG +DE AL E + SG V  AG DVFEV
Sbjct: 199 LHVPLTESTRHIINRESIAKMKDGVIIVNTARGGTIDEEALYEEVVSGKVYAAGLDVFEV 258

Query: 61  EP---ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQM 99
           EP    ++  L  L NV   P++GAST E+Q +V I+L  ++
Sbjct: 259 EPPTDEIRRKLLSLDNVVATPHIGASTAEAQRRVGIELVEKI 300


>gi|32265634|ref|NP_859666.1| D-3-phosphoglycerate dehydrogenase [Helicobacter hepaticus ATCC
           51449]
 gi|32261682|gb|AAP76732.1| D-3-phosphoglycerate dehydrogenase [Helicobacter hepaticus ATCC
           51449]
          Length = 526

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 109/205 (53%), Gaps = 1/205 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +TKN++  + +++ K GV +INCARGGL +E  L + L  G +  AG DVF+ 
Sbjct: 203 IHTPKNAETKNMITAKQIAQMKDGVILINCARGGLYNEKDLYDALSVGKIKWAGIDVFDK 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA+ N L  LPNV+  P++GA+T+ESQE++AIQ A    +        NALN+ +   E
Sbjct: 263 EPAINNALLDLPNVYVTPHIGANTLESQEQIAIQAAQAAIEAARGSSYPNALNLPVKESE 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
              +VKP++ L   L     Q     I  I I   G  +     +   A++  +      
Sbjct: 323 LPSMVKPYLELIQKLAFLAVQANKGVITSIHIEAQGEISAYGDSLQTFALVGALNASLGD 382

Query: 181 GANIISAPIIIKENAI-ILSTIKRD 204
             N ++AP + KE  I +  T+K++
Sbjct: 383 KINYVNAPFVAKERGIDVKMTLKQE 407


>gi|269838299|ref|YP_003320527.1| D-3-phosphoglycerate dehydrogenase [Sphaerobacter thermophilus DSM
           20745]
 gi|269787562|gb|ACZ39705.1| D-3-phosphoglycerate dehydrogenase [Sphaerobacter thermophilus DSM
           20745]
          Length = 737

 Score =  107 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 58/157 (36%), Positives = 91/157 (57%), Gaps = 1/157 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
            HVP T++T N+L+ + +++ K G  ++NCARG +VD+ ALAE L++G VA AG DVF  
Sbjct: 394 FHVPATSETINMLDADAIARMKPGAIVLNCARGEVVDQEALAEALRTGRVAAAGVDVFPD 453

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PLFGLPNV   P++G S+ E+   V   ++      L    V NA+N+   S  
Sbjct: 454 EPAYTSPLFGLPNVILTPHIGGSSREALAAVGEMISTTTLAALRGEAVPNAVNLPPASL- 512

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGS 157
           + P ++    +A   G  +  L S   + +++I  G+
Sbjct: 513 QGPELQRLTRVASAAGRLLSVLRSARPERLEVIVQGA 549


>gi|239618528|ref|YP_002941850.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Kosmotoga olearia TBF 19.5.1]
 gi|239507359|gb|ACR80846.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding
           [Kosmotoga olearia TBF 19.5.1]
          Length = 307

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 70/102 (68%), Gaps = 3/102 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT +T +IL ++ + K K G  IIN ARGG++DE AL + L +G +A A  DVFEV
Sbjct: 198 LHVPLTPRTLHILGEKEIEKMKDGAVIINAARGGVLDEQALYDALIAGKLAGAALDVFEV 257

Query: 61  EP---ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQM 99
           EP    L+  L GLPNV   P++GAST E QE+V I++A ++
Sbjct: 258 EPPVDELRRKLLGLPNVVATPHIGASTYEGQERVGIEMAKKL 299


>gi|55980921|ref|YP_144218.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB8]
 gi|55772334|dbj|BAD70775.1| D-3-phosphoglycerate dehydrogenase [Thermus thermophilus HB8]
          Length = 521

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 118/210 (56%), Gaps = 6/210 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +T+ ++ +  L     G  ++N ARGG++DE AL E+L+ GH+   G DVF  
Sbjct: 197 VHTPLTEETRGMIGRRELYLLPRGAVVVNAARGGIIDEKALLEVLEEGHLFAVGLDVFAE 256

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++ PL   P V    +LGA+T+E+QE+V   +  ++   L +G +S ALN      
Sbjct: 257 EPPPKDHPLIHHPRVVHTAHLGANTLEAQERVGEAILERVVRTL-EGDLSYALNTG-FDP 314

Query: 120 EEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV-RVW 178
           E    +K F+ L + LG  + Q+     + +++ + G     +   + SAV  G++ RV 
Sbjct: 315 EALEALKGFLPLGEALGKLLAQITRGRPEALEVRFLGQFE-KDPEPIASAVAKGLLARVL 373

Query: 179 RVGA-NIISAPIIIKENAIILSTIKRDKSG 207
             GA N++SA  ++K+  I L+T++ +++G
Sbjct: 374 GEGAVNLVSARPLLKDRGIHLTTLRSEEAG 403


>gi|237785818|ref|YP_002906523.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium kroppenstedtii
           DSM 44385]
 gi|237758730|gb|ACR17980.1| D-3-phosphoglycerate dehydrogenase [Corynebacterium kroppenstedtii
           DSM 44385]
          Length = 532

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/200 (32%), Positives = 100/200 (50%), Gaps = 3/200 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  + N   L K K G  I+N ARGGL+DE ALA  + SGH+  AG DV+  
Sbjct: 205 IHLPKTKETAGMFNDALLEKAKKGQIIVNAARGGLIDEEALARAIDSGHIRGAGVDVYAT 264

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF  P V   P+LGASTVE+Q++    +A  +   L    V +A+N++  +  
Sbjct: 265 EPCTDSPLFDRPEVVVTPHLGASTVEAQDRAGTDVAKSVLLALAGEFVPDAVNVSGGAIG 324

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVWR 179
           E   V  ++ L   L      +   +   +++I  G  +  N   L  A L G+      
Sbjct: 325 EE--VSLWLNLTRKLAVLASAIQHGATTSVEVIARGELSSENVDALGLAALRGVFAGTVD 382

Query: 180 VGANIISAPIIIKENAIILS 199
                ++AP I ++  + LS
Sbjct: 383 EKVTFVNAPAIAEDRGVQLS 402


>gi|330466217|ref|YP_004403960.1| D-3-phosphoglycerate dehydrogenase [Verrucosispora maris AB-18-032]
 gi|328809188|gb|AEB43360.1| D-3-phosphoglycerate dehydrogenase [Verrucosispora maris AB-18-032]
          Length = 532

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/139 (41%), Positives = 84/139 (60%), Gaps = 7/139 (5%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ ++ LS  K GV IIN ARGGLVDE ALA+ L  G VA AG DV+  
Sbjct: 200 IHLPKTPETVGLIGEKELSIVKPGVRIINAARGGLVDEQALADALAEGRVAGAGVDVYAK 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM---AII 117
           EP   +PLF   NV   P+LGAST E+Q+K  + +A  +   L    V +A+N+    ++
Sbjct: 260 EPCTSSPLFAFDNVVATPHLGASTAEAQDKAGLAVAKSVKLALQGEFVPDAVNVQAGGVV 319

Query: 118 SFEEAPLVKPFMTLADHLG 136
           + +    V+P + LA+ LG
Sbjct: 320 AED----VRPLLPLAEKLG 334


>gi|119480099|ref|XP_001260078.1| d-3-phosphoglycerate dehydrogenase [Neosartorya fischeri NRRL 181]
 gi|119408232|gb|EAW18181.1| d-3-phosphoglycerate dehydrogenase [Neosartorya fischeri NRRL 181]
          Length = 582

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 111/213 (52%), Gaps = 15/213 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   L++ K G  I+N ARGG +DE AL + L+SGH+A A  DVF  
Sbjct: 207 IHTPLIASTKGMISTAELAQMKPGSRILNVARGGTIDEAALLQSLESGHLAAAAIDVFTT 266

Query: 61  EP----ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP    +    L   P     P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 267 EPPQPESTAARLIAHPRAVVTPHLGASTVEAQENVSIDVCEQVLQILNGSLPRSAVNAPL 326

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESI------QEIQIIYDGSTA-VMNTMVLNSA 169
           I  +E   ++PF+ L + +G    Q  + ++          +IY G  A + NT  L +A
Sbjct: 327 ILPDEYRKLQPFVRLVEKMGSLYTQHYASTVGGSMTRNTFDLIYHGEVAGISNTRPLFAA 386

Query: 170 VLAG----IVRVWRVGANIISAPIIIKENAIIL 198
           ++ G    I     +  NI++A ++ +E  I +
Sbjct: 387 LIKGLLAPISSSEGININIVNAELVARERGIFV 419


>gi|148242943|ref|YP_001228100.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. RCC307]
 gi|147851253|emb|CAK28747.1| D-3-phosphoglycerate dehydrogenase [Synechococcus sp. RCC307]
          Length = 528

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 102/177 (57%), Gaps = 2/177 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T  T+N++N E ++  K    ++NCARGG+++E  LA  L +G +A A  DV+  
Sbjct: 199 LHLPRTPDTENLVNAELIATMKPNARLVNCARGGIINEADLAAALNNGVIAGAALDVYAN 258

Query: 61  EP-ALQNPLFG-LPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP    +PL G   ++   P+LGAST E+Q  VAI +A Q+ D L+     +A+N+  ++
Sbjct: 259 EPLEADSPLRGDCDHLILTPHLGASTEEAQANVAIDVAEQIRDVLLGLPARSAVNIPGLT 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            +    +KP + LA+ LG  I QL    +QE+Q++  G  A   +  L  A L G++
Sbjct: 319 PDVMERLKPHLQLAETLGLLISQLSGGPVQELQVLLQGEFAEHPSQPLVVASLKGLL 375


>gi|315039759|ref|XP_003169257.1| D-3-phosphoglycerate dehydrogenase [Arthroderma gypseum CBS 118893]
 gi|311337678|gb|EFQ96880.1| D-3-phosphoglycerate dehydrogenase [Arthroderma gypseum CBS 118893]
          Length = 562

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/218 (32%), Positives = 115/218 (52%), Gaps = 14/218 (6%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   TK +++   L++ K G  I+N ARGG +DE AL   L++GH+A A  DVF  
Sbjct: 203 IHTPLIASTKGMISTAELAQMKPGSRILNVARGGTIDEPALLNALETGHIAGAALDVFAT 262

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP         L   P V   P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 263 EPPTSGSASAQLIAHPRVIPTPHLGASTVEAQENVSIDVCEQVLQILGGSLPRSAVNTPL 322

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQEI------QIIYDGSTAVM-NTMVLNSA 169
           I  EE   ++PF+ L + +G    Q    +   +        IY+G  + + NT  L +A
Sbjct: 323 ILPEEFKKLQPFVHLVEKIGSIYTQHYGSANSPLSNRNTFDFIYEGEVSELNNTKPLFAA 382

Query: 170 VLAGIVR--VWRVGANIISAPIIIKENAIILSTIK-RD 204
           ++ G++      +  NI++A ++ +E  II++  + RD
Sbjct: 383 LIKGLMSPISKDLNVNIVNAELVARERGIIVNEQRSRD 420


>gi|237834647|ref|XP_002366621.1| D-3-phosphoglycerate dehydrogenase, putative [Toxoplasma gondii
           ME49]
 gi|211964285|gb|EEA99480.1| D-3-phosphoglycerate dehydrogenase, putative [Toxoplasma gondii
           ME49]
 gi|221486089|gb|EEE24359.1| D-3-phosphoglycerate dehydrogenase, putative [Toxoplasma gondii
           GT1]
 gi|221503586|gb|EEE29277.1| D-3-phosphoglycerate dehydrogenase, putative [Toxoplasma gondii
           VEG]
          Length = 604

 Score =  106 bits (265), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 102/183 (55%), Gaps = 9/183 (4%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPL +KT++++N + L   K   CIIN +RGG++DE A+AE L +  +A A  DVFE 
Sbjct: 213 LHVPLLDKTRHLINADKLKLIKKDACIINASRGGVIDEKAVAEALMANELAGAALDVFEE 272

Query: 61  EPAL--QNPLFGLP----NVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM 114
           E      NPL        N+   P++GAST+E+Q  VA+ +A Q  + L+ G+  +A+N+
Sbjct: 273 EKEFSKDNPLIQAKANGRNIILTPHIGASTLEAQHNVAVDVALQFREALLGGLPQSAVNL 332

Query: 115 AIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
             +  ++   +   + LA+ LG    +L+ E ++ + +   GS    N  VL  +   G+
Sbjct: 333 QCVRSQQ---LVSLVHLAEILGRLCSKLVDEPVETLHLKIRGSVDSANADVLLLSAAQGV 389

Query: 175 VRV 177
           +R 
Sbjct: 390 LRT 392


>gi|255322493|ref|ZP_05363638.1| phosphoglycerate dehydrogenase [Campylobacter showae RM3277]
 gi|255300401|gb|EET79673.1| phosphoglycerate dehydrogenase [Campylobacter showae RM3277]
          Length = 525

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 105/196 (53%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H P   +T N++ +  ++K K GV +INCARGGL +E AL   L++G +A AG DVFE 
Sbjct: 202 IHTPKNKETVNMIGEAEIAKMKDGVRLINCARGGLYNEEALYNGLKNGKIAFAGIDVFEK 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA  +PL  L NV   P+LGA+T+ESQ  +AI  A Q           +ALN+ I + +
Sbjct: 262 EPATDHPLLELNNVSVTPHLGANTLESQANIAIAAAEQAISAARGISYPSALNLPIKTED 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
             P V+P++ L   +     Q+  ++I+ I+I   G  +     +L  A++  +      
Sbjct: 322 LPPFVEPYIELTSKMAFLAAQINKKAIKAIRIETHGPISEYANSMLTFAIVGALKESLGD 381

Query: 181 GANIISAPIIIKENAI 196
             N ++A  +  E  I
Sbjct: 382 TINYVNAKFLCDEKGI 397


>gi|157364619|ref|YP_001471386.1| phosphoglycerate dehydrogenase [Thermotoga lettingae TMO]
 gi|157315223|gb|ABV34322.1| Phosphoglycerate dehydrogenase [Thermotoga lettingae TMO]
          Length = 303

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 70/102 (68%), Gaps = 3/102 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPL+N+TK+++N E +SK K GV IIN +RGG++DE AL + L SG +  A  DVFEV
Sbjct: 196 LHVPLSNETKHMINSETISKMKDGVIIINASRGGVIDEQALYDALSSGKIYAAALDVFEV 255

Query: 61  EPA---LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQM 99
           EP    L+  L  LPNV   P++GAST E+Q KV  +L  ++
Sbjct: 256 EPPADDLRKKLLQLPNVTATPHIGASTHEAQAKVGRELVERI 297


>gi|255932639|ref|XP_002557876.1| Pc12g10550 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582495|emb|CAP80682.1| Pc12g10550 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 596

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 115/222 (51%), Gaps = 16/222 (7%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T+ ++ +  L++ K G  ++N ARGG  DE+AL   L+SGH++ A  DVF  
Sbjct: 207 IHTPLIASTRGMIAEAELAQLKPGARVLNVARGGTFDEDALLAALESGHLSGAAIDVFTS 266

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP   +     L   P     P+LGASTVE+QE V++ +  Q+ + L   +  +A+N  +
Sbjct: 267 EPPAPDSSAARLIAHPRAVVTPHLGASTVEAQENVSVDVCEQVLEILQGSLPRSAVNAPL 326

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESI------QEIQIIYDGSTA-VMNTMVLNSA 169
           I  EE   ++PF+ L + LG    Q  + S           +IY G  A + NT  L +A
Sbjct: 327 ILPEEYKKLQPFVRLVEKLGSLYTQHYATSPGGAMARNTFDLIYQGELASINNTKPLFAA 386

Query: 170 VLAG----IVRVWRVGANIISAPIIIKENAIILSTI-KRDKS 206
           ++ G    I  +  +  NI++A ++ +E  I +S    RD S
Sbjct: 387 LIKGLLSPISSMEGLNINIVNAELVARERGIFVSEQHSRDPS 428


>gi|239917378|ref|YP_002956936.1| D-3-phosphoglycerate dehydrogenase [Micrococcus luteus NCTC 2665]
 gi|281414138|ref|ZP_06245880.1| D-3-phosphoglycerate dehydrogenase [Micrococcus luteus NCTC 2665]
 gi|239838585|gb|ACS30382.1| D-3-phosphoglycerate dehydrogenase [Micrococcus luteus NCTC 2665]
          Length = 531

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 107/198 (54%), Gaps = 4/198 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E  ++ K    I+N ARGGLVDE+ALA  L++G +  AG DVF  
Sbjct: 203 IHMPKTPETVGMIGDEQFARMKDTAIIVNVARGGLVDEDALARALEAGTIGGAGIDVFSS 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA     F   +    P+LGAST E+QEK  + +A  +   L   +V +A+N+A  +  
Sbjct: 263 EPATDLAFFAHDSAVVTPHLGASTAEAQEKAGVAVAGSVRLALSGELVPDAVNVAGGAIH 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISE-SIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVW 178
           E   V+P + LA+ LG  +  L+ E SI  +++   G  A  +   +  A L G+   + 
Sbjct: 323 ED--VRPGLPLAEKLGRVLTALVGEQSITAVEVEIAGEIAEHDVSAMRLAALKGVFTDIV 380

Query: 179 RVGANIISAPIIIKENAI 196
               + ++AP++ ++  +
Sbjct: 381 SDQVSYVNAPVLAEQRGV 398


>gi|156553723|ref|XP_001600828.1| PREDICTED: similar to GA19489-PA [Nasonia vitripennis]
          Length = 511

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 115/217 (52%), Gaps = 29/217 (13%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +TKN++N   L+K K GV I+N ARGG+VDE AL   + +GHVA A  DVF  
Sbjct: 204 VHTPLIPQTKNLINATTLAKCKKGVYIVNVARGGIVDEEALLHSINAGHVAGAALDVFIE 263

Query: 61  EPALQNP----LFGLPNVFCAPYLGASTVESQEKVAIQLAHQM------SD-YLIDGVVS 109
           EP  +NP    L   P V   P+LGAST E+Q +VAI++A Q       SD Y + G+V 
Sbjct: 264 EPP-KNPVTLELIKHPKVVATPHLGASTAEAQTRVAIEIAEQFLAISGKSDKYSVTGIV- 321

Query: 110 NALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNT------ 163
              N  +++    P    ++ LA  LG   G+ ++    + Q++ +  T   +T      
Sbjct: 322 ---NAPVMAAAANPDNAAWIELAKRLGKVAGKFVA---NQGQVVVESRTTGPDTASKKFV 375

Query: 164 -MVLNSAVLAGIVRVWRVGANIISAPIIIKENAIILS 199
              LN  +LA  V     G N+++AP + KE  I ++
Sbjct: 376 HTALNVGLLANRV---NSGLNLVNAPNLAKELGITVN 409


>gi|325833264|ref|ZP_08165770.1| phosphoglycerate dehydrogenase [Eggerthella sp. HGA1]
 gi|325485646|gb|EGC88114.1| phosphoglycerate dehydrogenase [Eggerthella sp. HGA1]
          Length = 530

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 108/209 (51%), Gaps = 3/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +   +  ++ K GV ++N ARGG+ DE +LA+ L +G +   G DV E 
Sbjct: 206 VHLPKTKETIGMFGPDQYARMKDGVILVNAARGGIFDEKSLADFLAAGKIGAVGIDVHES 265

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL    N    P++ AST E+Q +  +Q A  ++  L   +V  ALNMA +  E
Sbjct: 266 EPCTDSPLREFDNAILTPHIAASTQEAQLRAGVQTAEYVAAGLEGSIVPTALNMAPVPPE 325

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               V P++     +G  + Q+  E  Q +++   G+ A  +  +L +  L GI+  ++ 
Sbjct: 326 VMDAVGPYVPACQMMGSMLAQIDGEIPQFLKLTTAGALAHADASILVAGTLKGILS-YQS 384

Query: 181 GANI--ISAPIIIKENAIILSTIKRDKSG 207
            A +  ++A  + K + I + T+    +G
Sbjct: 385 TATVTPVNADAVAKRHGIKVETLSSPDAG 413


>gi|159468538|ref|XP_001692431.1| D-3-phosphoglycerate dehydrogenase [Chlamydomonas reinhardtii]
 gi|158278144|gb|EDP03909.1| D-3-phosphoglycerate dehydrogenase [Chlamydomonas reinhardtii]
          Length = 587

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 102/179 (56%), Gaps = 4/179 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVF-E 59
           LH+PLT  TK + N    ++ K G  IIN ARGG++DE AL   L+S  VA+A  DVF E
Sbjct: 238 LHMPLTPGTKGLFNDSAFARMKRGARIINVARGGVIDEAALLRALESKQVAQAALDVFLE 297

Query: 60  VEPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
             P+ +N PL   P+V C P+LGAST E+QE VA+++   + D L   +  NA+N  ++ 
Sbjct: 298 EPPSFENHPLVHRPDVICTPHLGASTTEAQEGVALEVVEAVVDALAGNLSVNAVNAPMVP 357

Query: 119 FEEAPLVKPFMTLADHLG-CFIGQLISESIQEIQIIYDGSTA-VMNTMVLNSAVLAGIV 175
            E    ++P++ LA+ LG   +G        +I I Y       ++T +L + V+ G++
Sbjct: 358 AEILRELQPYIVLAEGLGRAAVGLGGKGGFGDIAITYSSPRGDDLDTRLLRAMVIKGVL 416


>gi|257791620|ref|YP_003182226.1| D-3-phosphoglycerate dehydrogenase [Eggerthella lenta DSM 2243]
 gi|317487964|ref|ZP_07946548.1| phosphoglycerate dehydrogenase [Eggerthella sp. 1_3_56FAA]
 gi|257475517|gb|ACV55837.1| D-3-phosphoglycerate dehydrogenase [Eggerthella lenta DSM 2243]
 gi|316912946|gb|EFV34471.1| phosphoglycerate dehydrogenase [Eggerthella sp. 1_3_56FAA]
          Length = 526

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 108/209 (51%), Gaps = 3/209 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +   +  ++ K GV ++N ARGG+ DE +LA+ L +G +   G DV E 
Sbjct: 202 VHLPKTKETIGMFGPDQYARMKDGVILVNAARGGIFDEKSLADFLAAGKIGAVGIDVHES 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL    N    P++ AST E+Q +  +Q A  ++  L   +V  ALNMA +  E
Sbjct: 262 EPCTDSPLREFDNAILTPHIAASTQEAQLRAGVQTAEYVAAGLEGSIVPTALNMAPVPPE 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
               V P++     +G  + Q+  E  Q +++   G+ A  +  +L +  L GI+  ++ 
Sbjct: 322 VMDAVGPYVPACQMMGSMLAQIDGEIPQFLKLTTAGALAHADASILVAGTLKGILS-YQS 380

Query: 181 GANI--ISAPIIIKENAIILSTIKRDKSG 207
            A +  ++A  + K + I + T+    +G
Sbjct: 381 TATVTPVNADAVAKRHGIKVETLSSPDAG 409


>gi|289704780|ref|ZP_06501201.1| phosphoglycerate dehydrogenase [Micrococcus luteus SK58]
 gi|289558496|gb|EFD51766.1| phosphoglycerate dehydrogenase [Micrococcus luteus SK58]
          Length = 531

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 107/198 (54%), Gaps = 4/198 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  E  ++ K    I+N ARGGLVDE+ALA  L++G +  AG DVF  
Sbjct: 203 IHMPKTPETVGMIGDEQFARMKDTAIIVNVARGGLVDEDALARALEAGTIGGAGIDVFSS 262

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EPA     F   +    P+LGAST E+QEK  + +A  +   L   +V +A+N+A  +  
Sbjct: 263 EPATDLAFFAHDSAVVTPHLGASTAEAQEKAGVAVAGSVRLALSGELVPDAVNVAGGAIH 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISE-SIQEIQIIYDGSTAVMNTMVLNSAVLAGI-VRVW 178
           E   V+P + LA+ LG  +  L+ E SI  +++   G  A  +   +  A L G+   + 
Sbjct: 323 ED--VRPGLPLAEKLGRVLTALVGEQSITAVEVEIAGEIAEHDVSAMRLAALKGVFTDIV 380

Query: 179 RVGANIISAPIIIKENAI 196
               + ++AP++ ++  +
Sbjct: 381 SDQVSYVNAPVLAEQRGV 398


>gi|258651703|ref|YP_003200859.1| D-3-phosphoglycerate dehydrogenase [Nakamurella multipartita DSM
           44233]
 gi|258554928|gb|ACV77870.1| D-3-phosphoglycerate dehydrogenase [Nakamurella multipartita DSM
           44233]
          Length = 530

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 105/204 (51%), Gaps = 9/204 (4%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++    L+  K GV I+N ARGGL+DE ALA+ L  G VA AG DVF  
Sbjct: 201 IHLPRTPETLGLIGAAELATVKPGVIIVNAARGGLIDEQALADALTEGRVAGAGLDVFVN 260

Query: 61  EP-ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM---AI 116
           EP    +PL   PN    P+LGAST E+Q+K    +A  +   L    V +A+N+     
Sbjct: 261 EPLGADSPLRTAPNTVLTPHLGASTNEAQDKAGTAVARSVKLALRGDFVPDAVNVQAAGP 320

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV- 175
           +S E    ++P++ L   LG  +  +      ++ +   G  A M+T +L  A + GI  
Sbjct: 321 VSDE----LQPWIPLVSRLGTILTAVTGGVPSQVSVEVRGDLAAMDTSILQLAAVRGIFG 376

Query: 176 RVWRVGANIISAPIIIKENAIILS 199
            V       ++AP +  E+ + L+
Sbjct: 377 SVITDAVTFVNAPALAAEHGLTLT 400


>gi|291301774|ref|YP_003513052.1| D-3-phosphoglycerate dehydrogenase [Stackebrandtia nassauensis DSM
           44728]
 gi|290570994|gb|ADD43959.1| D-3-phosphoglycerate dehydrogenase [Stackebrandtia nassauensis DSM
           44728]
          Length = 533

 Score =  105 bits (263), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 100/196 (51%), Gaps = 1/196 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ K+ L K K GV I+N ARGGL+DE ALA  L  G VA AG DVF  
Sbjct: 204 IHLPKTPETIGLIGKDELDKVKPGVRIVNAARGGLIDEAALAAALADGRVAGAGIDVFAT 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L NV   P+LGAST E+Q+   +Q+   +   L    V +A+N+   S  
Sbjct: 264 EPCTDSPLFALDNVVVTPHLGASTREAQDNAGLQVVKSVKLALAGEFVPDAVNVKAGS-G 322

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVWRV 180
            A  V+P + LA+ LG     +     Q + +   G     +  VL  A   G+      
Sbjct: 323 VAEDVRPLLPLAERLGRLFTAIAEGPAQSVTVEVRGEVIDSDVSVLQLAATKGLFVDVAD 382

Query: 181 GANIISAPIIIKENAI 196
               ++AP++  +  I
Sbjct: 383 QVTYVNAPLLAADKGI 398


>gi|295401440|ref|ZP_06811410.1| Phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976490|gb|EFG52098.1| Phosphoglycerate dehydrogenase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 326

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT +TK +LNK+ ++KTK GV IINCARGG+++E AL E L++GHVA A  DVFEV
Sbjct: 198 VHTPLTEETKGLLNKDTIAKTKKGVRIINCARGGIIEEEALLEALENGHVAGAALDVFEV 257

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP + + L   P+V   P+LGAST E+Q  VA Q++ ++  ++    V +++N  II 
Sbjct: 258 EPPIHSKLIDHPSVIVTPHLGASTKEAQLNVATQISEEVLRFVKGLPVMSSVNFPIIK 315


>gi|116202061|ref|XP_001226842.1| hypothetical protein CHGG_08915 [Chaetomium globosum CBS 148.51]
 gi|88177433|gb|EAQ84901.1| hypothetical protein CHGG_08915 [Chaetomium globosum CBS 148.51]
          Length = 1359

 Score =  105 bits (262), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 71/212 (33%), Positives = 115/212 (54%), Gaps = 14/212 (6%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T N+L ++ L   K    ++N ARGG+ +E AL + L  G +A AG DVF  
Sbjct: 219 IHTPLLASTLNLLGEKELQSMKKTARVLNVARGGVYNEEALLKALDEGWIAGAGLDVFTS 278

Query: 61  EP----ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP    ++   L   P V   P+LGASTVE+QE V++ +  Q+ + L  G+ + A+N  +
Sbjct: 279 EPPAEGSVAAKLAAHPKVVSTPHLGASTVEAQENVSMDVCTQVVEILSGGLPTAAVNAPL 338

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISE-----SIQEIQIIYDGSTA-VMNTMVLNSAV 170
           I  EE   ++PF+ L + +G    Q  +E       +  +++Y G  A + NT  L +A+
Sbjct: 339 ILPEEYRRLQPFVKLVERMGSLYTQHFAERGGMVGGRRFELVYHGELAGINNTRPLFAAL 398

Query: 171 LAGIV-RVWRVGA---NIISAPIIIKENAIIL 198
           + G+V  +  +G    NI++A +I KE  I +
Sbjct: 399 VKGLVSSISDLGGRDVNIVNATLISKERGIAI 430


>gi|326474476|gb|EGD98485.1| D-3-phosphoglycerate dehydrogenase [Trichophyton tonsurans CBS
           112818]
          Length = 570

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 71/218 (32%), Positives = 116/218 (53%), Gaps = 14/218 (6%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           L +P    TK +++   L++ K G  I+N ARGG +DE AL   L++GH+A A  DVF  
Sbjct: 210 LSIPPNASTKGMISSAELTQMKPGSRILNVARGGTIDEPALLNALETGHIAGAALDVFAT 269

Query: 61  EP----ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP    +    L   P V   P+LGASTVE+QE V+I +  Q+   L   +  +A+N  +
Sbjct: 270 EPPTPGSTSAQLIAHPRVIPTPHLGASTVEAQENVSIDVCEQVLQILGGSLPRSAVNAPL 329

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESIQEI------QIIYDGSTAVM-NTMVLNSA 169
           I  EE   ++PF+ L + +G    Q    +   +       +IY+G  + M NT  L +A
Sbjct: 330 ILPEEYKKLQPFVHLVEKIGSIYTQHYGSAKSPLSNRNTFDLIYEGEVSEMNNTKPLFAA 389

Query: 170 VLAGIVR--VWRVGANIISAPIIIKENAIILSTIK-RD 204
           ++ G++      +  NI++A ++ +E  II++  + RD
Sbjct: 390 LIKGLMSPISKDLNVNIVNAELVARERGIIVNEQRSRD 427


>gi|148270512|ref|YP_001244972.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermotoga petrophila RKU-1]
 gi|147736056|gb|ABQ47396.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermotoga petrophila RKU-1]
          Length = 308

 Score =  105 bits (262), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 69/102 (67%), Gaps = 3/102 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPLT  T++I+N+E+++K K GV I+N ARGG +DE AL E L SG V  AG DVFEV
Sbjct: 201 LHVPLTESTRHIINRESIAKMKDGVIIVNTARGGTIDEEALYEALVSGKVYAAGLDVFEV 260

Query: 61  EP---ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQM 99
           EP    ++  L  L NV   P++GAST E+Q +V  +L  ++
Sbjct: 261 EPPTDEIRRKLLNLDNVVATPHIGASTDEAQNRVGTELVEKI 302


>gi|317121362|ref|YP_004101365.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter marianensis DSM
           12885]
 gi|315591342|gb|ADU50638.1| D-3-phosphoglycerate dehydrogenase [Thermaerobacter marianensis DSM
           12885]
          Length = 571

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 64/201 (31%), Positives = 103/201 (51%), Gaps = 3/201 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PLT  T+N++ +  L++ + G  +IN ARGG+VDE AL   L  G +A AG DVF  
Sbjct: 209 VHTPLTPATRNLIGEAALARMRPGAYLINTARGGIVDEQALYRALTEGRLAGAGLDVFAT 268

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP  ++PL  LPNV   P+LG ST E+Q   A  +A Q+   L    V  A+N+  +S  
Sbjct: 269 EPPGESPLLALPNVVATPHLGGSTREAQAYNARAVAEQVLRALQGQPVRGAVNLPHLSDR 328

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQ--EIQIIYDGSTAVMNTMVLNSAVLAGIVRVW 178
           +     P   +A+ +G    + +   ++  E+++      +     +L  A L G++   
Sbjct: 329 DWHAAGPLAPVAELIGLVYREGLGGPLEDLELRVAARDLPSERGFQLLAGAALKGLLSGV 388

Query: 179 RVGA-NIISAPIIIKENAIIL 198
             G  N ++AP++     I L
Sbjct: 389 VDGPVNTVNAPVLAARRGIAL 409


>gi|302865806|ref|YP_003834443.1| D-3-phosphoglycerate dehydrogenase [Micromonospora aurantiaca ATCC
           27029]
 gi|315502351|ref|YP_004081238.1| d-3-phosphoglycerate dehydrogenase [Micromonospora sp. L5]
 gi|302568665|gb|ADL44867.1| D-3-phosphoglycerate dehydrogenase [Micromonospora aurantiaca ATCC
           27029]
 gi|315408970|gb|ADU07087.1| D-3-phosphoglycerate dehydrogenase [Micromonospora sp. L5]
          Length = 532

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 95/177 (53%), Gaps = 7/177 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++ ++ L+  K GV I+N ARGGLVDE ALA+ +  G VA AG DV+  
Sbjct: 200 IHLPKTPETVGLIGEKELAIVKPGVRIVNAARGGLVDEQALADAIAEGRVAGAGVDVYAK 259

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM---AII 117
           EP   +PLF   NV   P+LGAST E+Q+K  + +A  +   L    V +A+N+    ++
Sbjct: 260 EPCTSSPLFAFDNVVATPHLGASTNEAQDKAGLAVAKSVKLALQGEFVPDAVNVQAGGVV 319

Query: 118 SFEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGI 174
           + +    V+P + LA+ LG     L       + +   G  A  +  VL  A   G+
Sbjct: 320 AED----VRPLLPLAERLGRAFTALAGGVAASVTVEVRGEIAAHDVSVLKLAATKGL 372


>gi|171681876|ref|XP_001905881.1| hypothetical protein [Podospora anserina S mat+]
 gi|170940897|emb|CAP66547.1| unnamed protein product [Podospora anserina S mat+]
          Length = 588

 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 113/215 (52%), Gaps = 19/215 (8%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T N+L +E   K K    ++N ARGG+ +E AL + L  G +A AG DVF  
Sbjct: 220 VHTPLLASTLNLLGEEQFGKMKKTARVLNVARGGVYNEEALLKALDEGWIAGAGIDVFTQ 279

Query: 61  EP----ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAI 116
           EP    ++ + L   P V   P+LGASTVE+QE V+I +  Q+   L  G+ + A+N  +
Sbjct: 280 EPPKEGSVPSRLAQHPKVVSTPHLGASTVEAQENVSIDVCKQVVVILGGGLPTAAVNAPL 339

Query: 117 ISFEEAPLVKPFMTLADHLGCFIGQLISESI----------QEIQIIYDGSTA-VMNTMV 165
           I  EE   ++PF+ L + +G    Q  + +           +  +++Y G  A V NT  
Sbjct: 340 ILPEEYRRLQPFVKLVEKIGSLYTQHYATNAGDKKGGMIGGRRFELVYHGDLASVSNTRP 399

Query: 166 LNSAVLAGIV-RVWRVGA---NIISAPIIIKENAI 196
           L +A++ G+V  +   G    NI++A II KE  I
Sbjct: 400 LFAALVKGLVSSISDAGGRDVNIVNATIIAKERGI 434


>gi|242004086|ref|XP_002422968.1| D-3-phosphoglycerate dehydrogenase, putative [Pediculus humanus
           corporis]
 gi|212505884|gb|EEB10230.1| D-3-phosphoglycerate dehydrogenase, putative [Pediculus humanus
           corporis]
          Length = 365

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 90/159 (56%), Gaps = 13/159 (8%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL  +T+N++N + L K K GVCIIN ARGG++DE AL   L+ G    A  DVFE 
Sbjct: 204 VHTPLIPQTRNLVNDKTLGKCKKGVCIINVARGGIIDEEALLRALKDGKCGGAALDVFEE 263

Query: 61  EPALQNPLFGL---PNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDG--------VVS 109
           EP   +    L   P V   P+LGAST E+Q++VA+++A Q     + G        VV+
Sbjct: 264 EPPKNDVTLQLIKHPLVVTTPHLGASTYEAQQRVAVEIAEQF--IALSGKNKPNENFVVN 321

Query: 110 NALNMAIISFEEAPLVKPFMTLADHLGCFIGQLISESIQ 148
            A+N  ++S        P++ LA+ LG  +G   ++S++
Sbjct: 322 GAVNAPVLSAAMIDTNTPWINLAEKLGRLLGSFSNKSLK 360


>gi|298706859|emb|CBJ25823.1| Phosphoglycerate dehydrogenase / Phosphoserine aminotransferase
           [Ectocarpus siliculosus]
          Length = 965

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 82/147 (55%), Gaps = 2/147 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT +TK ++ + NL K K GV IINCARGG++D  AL + L  G VA A  DV+  
Sbjct: 240 LHTPLTPETKGLIGRSNLDKCKKGVRIINCARGGIIDPVALVDALNLGKVAGASLDVYPS 299

Query: 61  EPALQ--NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP       L   P V C+P+LGAST ++Q +VA  +A QM D L  G     LN   ++
Sbjct: 300 EPPPPELKELVTHPKVVCSPHLGASTQDAQVRVAKDIAIQMCDVLDGGEYVGVLNAPNMA 359

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISE 145
                 +  +++L + +G    QL+ +
Sbjct: 360 AARKSKLTAYVSLGERMGALQAQLLGQ 386


>gi|291279254|ref|YP_003496089.1| D-3-phosphoglycerate dehydrogenase [Deferribacter desulfuricans
           SSM1]
 gi|290753956|dbj|BAI80333.1| D-3-phosphoglycerate dehydrogenase [Deferribacter desulfuricans
           SSM1]
          Length = 540

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 87/152 (57%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
            H PLT +TKN++ K+ +   K GV ++NCARGG+++EN L + L+SG V  A  DVFE 
Sbjct: 204 FHTPLTKETKNMITKKEIELMKDGVILVNCARGGIINENDLYDALKSGKVFTAAIDVFEK 263

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   N L  L N+F  P++GA+T E Q+ VA+ +A Q+ + L      NA+N+  +  +
Sbjct: 264 EPPKGNKLLELDNLFVTPHIGANTEEGQKGVAVIIAEQIVNALHGKSYINAVNIPFMKSQ 323

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQI 152
               ++ +  L + +     Q +     EI++
Sbjct: 324 LPEDLQIYFELIEKISKLAAQTVKGRPDEIKV 355


>gi|124026487|ref|YP_001015602.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL1A]
 gi|123961555|gb|ABM76338.1| putative D-3-phosphoglycerate dehydrogenase (PGDH) [Prochlorococcus
           marinus str. NATL1A]
          Length = 528

 Score =  105 bits (261), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 102/177 (57%), Gaps = 2/177 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T+N+++ + L K K    ++NCARGG+++EN LA  L    +  A  DV+  
Sbjct: 199 LHLPRTPETENLVDIDLLRKMKPTARLVNCARGGIINENDLANALAENVIQGAAIDVYAK 258

Query: 61  EPALQN-PLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  +N PL  +   +   P+LGASTVE+Q+ VAI +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLAENSPLRAVKKGLVLTPHLGASTVEAQQNVAIDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            E    +KP + LA+ LG  + Q+    IQ++++   G  A   +  L  A L G++
Sbjct: 319 AEIMDSLKPHLKLAETLGLLVSQISGGQIQKLEVRLQGEFAQHPSQPLVIATLKGLL 375


>gi|182437034|ref|YP_001824753.1| D-3-phosphoglycerate dehydrogenase [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|178465550|dbj|BAG20070.1| putative D-3-phosphoglycerate dehydrogenase [Streptomyces griseus
           subsp. griseus NBRC 13350]
          Length = 530

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 104/197 (52%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T+ ++  + L + K GV I+N +RGG+VDE  L   L+ G VA A  DVF  
Sbjct: 201 VHLPRTPETEGLIGFDALHRVKPGVRIVNASRGGIVDEAELYAALKEGRVAGAAVDVFAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL+ L NV   P+LGAST+E+QE+  + +A  + + L    V  A+N+ +   +
Sbjct: 261 EPCFDSPLYELDNVVVTPHLGASTLEAQERAGVAVARSVREALAGRFVPEAVNVRMGEVD 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
               + P++ + + LG             +++   G  A  +   L  A+L G +  V  
Sbjct: 321 AE--LAPWLAVVERLGRLFTATAGGLPPRLRVTVRGEIARHDAGPLELALLKGALGPVVD 378

Query: 180 VGANIISAPIIIKENAI 196
            G + ++AP+I +E  +
Sbjct: 379 GGVSYVNAPLIAQERGL 395


>gi|72382765|ref|YP_292120.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL2A]
 gi|72002615|gb|AAZ58417.1| D-3-phosphoglycerate dehydrogenase [Prochlorococcus marinus str.
           NATL2A]
          Length = 528

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 102/177 (57%), Gaps = 2/177 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH+P T +T+N+++ + L K K    ++NCARGG+++EN LA  L    +  A  DV+  
Sbjct: 199 LHLPRTPETENLVDIDLLRKMKPTARLVNCARGGIINENDLANALAENVIQGAAIDVYAK 258

Query: 61  EPALQN-PLFGLPN-VFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIIS 118
           EP  +N PL  +   +   P+LGASTVE+Q+ VAI +A Q+ D L+     +A+N+  +S
Sbjct: 259 EPLAENSPLRAVKKGLVLTPHLGASTVEAQQNVAIDVAEQIRDVLLGLPARSAVNIPGLS 318

Query: 119 FEEAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIV 175
            E    +KP + LA+ LG  + Q+    IQ++++   G  A   +  L  A L G++
Sbjct: 319 AEIMDSLKPHLKLAETLGLLVSQISGGQIQKLEVRLQGEFAQHPSQPLVIATLKGLL 375


>gi|222100164|ref|YP_002534732.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermotoga neapolitana DSM 4359]
 gi|221572554|gb|ACM23366.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
           [Thermotoga neapolitana DSM 4359]
          Length = 306

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 68/102 (66%), Gaps = 3/102 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVPL   TK+++NK+ +SK K GV I+N +RGG +DE AL E L SG V  AG DVFEV
Sbjct: 199 LHVPLIESTKHMINKDTISKMKDGVIIVNTSRGGTIDEEALYEALVSGKVYAAGLDVFEV 258

Query: 61  EP---ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQM 99
           EP    L+  L  L NV   P++GAST E+Q++V  +L  ++
Sbjct: 259 EPPSDELRRKLLSLDNVVATPHIGASTAEAQKRVGKELVEKI 300


>gi|326777649|ref|ZP_08236914.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
 gi|326657982|gb|EGE42828.1| D-3-phosphoglycerate dehydrogenase [Streptomyces cf. griseus
           XylebKG-1]
          Length = 530

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 104/197 (52%), Gaps = 3/197 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  ++  + L + K GV I+N +RGG+VDE  L   L+ G VA A  DVF  
Sbjct: 201 VHLPRTPETVGLIGFDALHRVKPGVRIVNASRGGIVDEAELYAALKEGRVAGAAVDVFAT 260

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PL+ L NV   P+LGAST+E+QE+  + +A  + + L    V  A+N+ +   +
Sbjct: 261 EPCADSPLYELDNVVVTPHLGASTLEAQERAGVAVARSVREALAGRFVPEAVNVRMGEVD 320

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVR-VWR 179
             P + P++ + + LG             +++   G  A  +   L  A+L G +  V  
Sbjct: 321 --PELAPWLAVVERLGRLFTATAGGLPLRLRVTVRGQIARHDAGPLELALLKGALGPVVD 378

Query: 180 VGANIISAPIIIKENAI 196
            G + ++AP+I +E  +
Sbjct: 379 GGVSYVNAPLIAQERGL 395


>gi|187479563|ref|YP_787588.1| D-3-phosphoglycerate dehydrogenase [Bordetella avium 197N]
 gi|115424150|emb|CAJ50703.1| D-3-phosphoglycerate dehydrogenase [Bordetella avium 197N]
          Length = 399

 Score =  104 bits (260), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 76/126 (60%), Gaps = 5/126 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP    T+NI+N + L++ + G  +IN +RG +VD  AL   L+SGH+A A  DVF  
Sbjct: 200 LHVPGGKSTENIINADTLAQMRRGAILINASRGTVVDIEALHSALRSGHLAGAALDVFPT 259

Query: 61  EP-----ALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMA 115
           EP     AL +PL GLPNV   P++G ST ESQE +  ++A ++  +L  G    A+N  
Sbjct: 260 EPKGPDEALASPLIGLPNVILTPHIGGSTQESQENIGREVAEKLVRFLQAGTTKTAVNFP 319

Query: 116 IISFEE 121
            +S+ E
Sbjct: 320 ELSYVE 325


>gi|20093737|ref|NP_613584.1| D-3-phosphoglycerate dehydrogenase [Methanopyrus kandleri AV19]
 gi|19886634|gb|AAM01514.1| Predicted dehydrogenase related to phosphoglycerate dehydrogenase
           [Methanopyrus kandleri AV19]
          Length = 522

 Score =  104 bits (260), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 93/174 (53%), Gaps = 3/174 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENAL