RPSBLAST alignment of GI: peg_34 and MMDB domain: 2rir_A_128-271

>2rir_A (A:128-271) Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE NAP; 2.79A {Bacillus subtilis}Length = 144
 Score = 45.4 bits (107), Expect = 6e-06
 Identities = 10/46 (21%), Positives = 15/46 (32%)

Query: 9   TKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAG 54
              ILN+  LS       I++ A      +   AE      +   G
Sbjct: 97  PSXILNQTVLSSXTPKTLILDLASRPGGTDFKYAEKQGIKALLAPG 142