RPSBLAST alignment of GI: peg_34 and protein with PDBid: 2j6i

>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Length = 364
 Score = 79.2 bits (194), Expect = 6e-16
 Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 6/108 (5%)

Query: 2   HVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVE 61
           + PL   TK ++NKE LSK K G  ++N ARG +     +A  L+SG +   G DV+  +
Sbjct: 228 NAPLHAGTKGLINKELLSKFKKGAWLVNTARGAICVAEDVAAALESGQLRGYGGDVWFPQ 287

Query: 62  PALQ-NPLFGLPNVFCA-----PYLGASTVESQEKVAIQLAHQMSDYL 103
           PA + +P   + N + A     P+   +T+++Q + A    + +  + 
Sbjct: 288 PAPKDHPWRDMRNKYGAGNAMTPHYSGTTLDAQTRYAQGTVNILESFF 335