RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= 537021.9.peg.34_1
         (208 letters)



>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine
           biosynthesis, structural genomics, PSI, protein
           structure initiative; HET: TAR; 2.30A {Mycobacterium
           tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2
           PDB: 3dc2_A* 3ddn_A*
          Length = 529

 Score =  118 bits (297), Expect = 8e-28
 Identities = 72/208 (34%), Positives = 103/208 (49%), Gaps = 3/208 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H+P T +T  +++KE L+KTK GV I+N ARGGLVDE ALA+ +  GHV  AG DVF  
Sbjct: 202 VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFAT 261

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP   +PLF L  V   P+LGAST E+Q++    +A  +   L    V +A+N+      
Sbjct: 262 EPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAVNVGGGVVN 321

Query: 121 EAPLVKPFMTLADHLGCFIGQLISESIQEIQIIYDGSTAVMNTMVLNSAVLAGIVRVW-R 179
           E     P++ L   LG   G L  E    + +   G  A     VL  + L G+      
Sbjct: 322 EEV--APWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEEVEVLRLSALRGLFSAVIE 379

Query: 180 VGANIISAPIIIKENAIILSTIKRDKSG 207
                ++AP +  E  +     K  +S 
Sbjct: 380 DAVTFVNAPALAAERGVTAEICKASESP 407


>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD,
           oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana}
           PDB: 3n7u_A* 3naq_A
          Length = 351

 Score =  114 bits (286), Expect = 2e-26
 Identities = 33/104 (31%), Positives = 61/104 (58%), Gaps = 1/104 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +++PLT KT+ + NKE + K K GV I+N ARG +++  A+ + ++SGH+     DV++ 
Sbjct: 226 INMPLTEKTRGMFNKELIGKLKKGVLIVNNARGAIMERQAVVDAVESGHIGGYSGDVWDP 285

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYL 103
           +PA + +P   +PN    P+   +T+++Q + A      +  Y 
Sbjct: 286 QPAPKDHPWRYMPNQAMTPHTSGTTIDAQLRYAAGTKDMLERYF 329


>1wwk_A Phosphoglycerate dehydrogenase; riken structural
           genomics/proteomics initiative, RSGI, structural
           genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus
           horikoshii OT3}
          Length = 307

 Score =  109 bits (274), Expect = 3e-25
 Identities = 44/104 (42%), Positives = 66/104 (63%), Gaps = 1/104 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +HVPL   T +++N+E L   K    +IN +RG +VD NAL + L+ G +A AG DVFE 
Sbjct: 202 IHVPLVESTYHLINEERLKLMKKTAILINTSRGPVVDTNALVKALKEGWIAGAGLDVFEE 261

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYL 103
           EP  + +PL    NV   P++GASTVE+QE+  +++A ++   L
Sbjct: 262 EPLPKDHPLTKFDNVVLTPHIGASTVEAQERAGVEVAEKVVKIL 305


>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate
           dehydrogenase, D-lactate dehydrogenase, oxidoreductase;
           HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4
           c.23.12.1
          Length = 333

 Score =  109 bits (274), Expect = 4e-25
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 14/128 (10%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP   +  +I+N+   +  K G  +IN AR  L+D  A+   L+SG +A  G D +E 
Sbjct: 203 LHVPGIEQNTHIINEAAFNLMKPGAIVINTARPNLIDTQAMLSNLKSGKLAGVGIDTYEY 262

Query: 61  EPA--------------LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDG 106
           E                L + L G+PNV  +P++   T  +   +       + D+L  G
Sbjct: 263 ETEDLLNLAKHGSFKDPLWDELLGMPNVVLSPHIAYYTETAVHNMVYFSLQHLVDFLTKG 322

Query: 107 VVSNALNM 114
             S  +  
Sbjct: 323 ETSTEVTG 330


>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle
           structural genomics center for infectious disease,
           brucellosis; 2.15A {Brucella melitensis biovar abortus}
          Length = 416

 Score =  107 bits (268), Expect = 2e-24
 Identities = 53/147 (36%), Positives = 77/147 (52%), Gaps = 5/147 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP +  T  ++ +  L K K G  +IN ARG  VD  ALA++LQ GH+A A  DVF V
Sbjct: 214 LHVPSSKSTSKLITEAKLRKMKKGAFLINNARGSDVDLEALAKVLQEGHLAGAAIDVFPV 273

Query: 61  EPA-----LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMA 115
           EPA        PL GL NV   P++G ST E+QE++  ++  ++ +Y   G    A+N  
Sbjct: 274 EPASNGERFSTPLQGLENVILTPHIGGSTEEAQERIGTEVTRKLVEYSDVGSTVGAVNFP 333

Query: 116 IISFEEAPLVKPFMTLADHLGCFIGQL 142
            +     P    FM + ++    +  L
Sbjct: 334 QVQLPPRPTGTRFMHVHENRPGILNSL 360


>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase,
           structural genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus
           horikoshii} PDB: 2dbr_A* 2dbz_A*
          Length = 334

 Score =  105 bits (263), Expect = 7e-24
 Identities = 45/127 (35%), Positives = 69/127 (54%), Gaps = 5/127 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           L VPLT +T +++N+E L   K    +IN ARG +VD NAL + L+ G +A AG DVFE 
Sbjct: 210 LAVPLTRETYHLINEERLKLMKKTAILINIARGKVVDTNALVKALKEGWIAGAGLDVFEE 269

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           EP     LF L NV   P++G+++  ++E +A  +A  +  +    +    +N      E
Sbjct: 270 EPYYNEELFKLDNVVLTPHIGSASFGAREGMAELVAKNLIAFKRGEIPPTLVN-----RE 324

Query: 121 EAPLVKP 127
              + KP
Sbjct: 325 VIKIRKP 331


>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center
           for structural genomics of infec diseases, csgid; HET:
           NAD; 2.36A {Salmonella enterica subsp}
          Length = 381

 Score =  103 bits (258), Expect = 3e-23
 Identities = 28/106 (26%), Positives = 48/106 (45%), Gaps = 5/106 (4%)

Query: 2   HVPLT----NKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDV 57
           H PL      KT ++ ++  + + K G  +IN  RG +VD  AL   L +G       DV
Sbjct: 177 HTPLYKDGPYKTLHLADETLIRRLKPGAILINACRGPVVDNAALLARLNAGQPLSVVLDV 236

Query: 58  FEVEPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYL 103
           +E EP L   L    ++    ++   T+E + +   Q+    S ++
Sbjct: 237 WEGEPDLNVALLEAVDIGT-SHIAGYTLEGKARGTTQVFEAYSAFI 281


>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics,
           riken structural genomics/proteomics initiative, RSGI,
           NPPSFA; HET: NHE; 2.00A {Thermus thermophilus HB8}
          Length = 311

 Score = 97.3 bits (241), Expect = 2e-21
 Identities = 42/112 (37%), Positives = 60/112 (53%), Gaps = 2/112 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH PLT +T  +LN+E L   K G  ++N ARG LVD  AL E L+ GH+  AG DV + 
Sbjct: 199 LHTPLTPETHRLLNRERLFAMKRGAILLNTARGALVDTEALVEALR-GHLFGAGLDVTDP 257

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNA 111
           EP     PL+ LPN    P++G++   ++E++A      +   L      N 
Sbjct: 258 EPLPPGHPLYALPNAVITPHIGSAGRTTRERMAEVAVENLLAVLEGREPPNP 309


>2nac_A NAD-dependent formate dehydrogenase;
           oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas
           SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A*
           2gsd_A*
          Length = 393

 Score = 95.7 bits (237), Expect = 7e-21
 Identities = 32/104 (30%), Positives = 56/104 (53%), Gaps = 1/104 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           L+ PL  +T++++N E L   K G  I+N ARG L D +A+A  L+SG +A    DV+  
Sbjct: 253 LNCPLHPETEHMINDETLKLFKRGAYIVNTARGKLCDRDAVARALESGRLAGYAGDVWFP 312

Query: 61  EPALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYL 103
           +PA + +P   +P     P++  +T+ +Q + A      +  + 
Sbjct: 313 QPAPKDHPWRTMPYNGMTPHISGTTLTAQARYAAGTREILECFF 356


>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase,
           phosphoglycerate dehydrogenase deficiency, serine
           metabolism; HET: NAD; 1.70A {Homo sapiens}
          Length = 335

 Score = 95.3 bits (236), Expect = 1e-20
 Identities = 45/110 (40%), Positives = 60/110 (54%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +H PL   T  +LN    ++ K GV ++NCARGG+VDE AL   LQSG  A A  DVF  
Sbjct: 225 VHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTE 284

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSN 110
           EP     L    NV   P+LGAST E+Q +   ++A Q  D +    ++ 
Sbjct: 285 EPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTG 334


>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase,
           reversible interconversion of pyruvate INTO D-lactate;
           1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4
           c.23.12.1 PDB: 1j49_A* 2dld_A*
          Length = 333

 Score = 94.5 bits (234), Expect = 2e-20
 Identities = 31/128 (24%), Positives = 52/128 (40%), Gaps = 14/128 (10%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP      +++N E+++K K  V I+N +RG LVD +A+   L SG +     DV+E 
Sbjct: 205 LHVPDVPANVHMINDESIAKMKQDVVIVNVSRGPLVDTDAVIRGLDSGKIFGYAMDVYEG 264

Query: 61  EPALQN--------------PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDG 106
           E  + N               L   PNV   P     T  +   + ++      + +   
Sbjct: 265 EVGIFNEDWEGKEFPDARLADLIARPNVLVTPKTAFYTTHAVRNMVVKAFDNNLELVEGK 324

Query: 107 VVSNALNM 114
                + +
Sbjct: 325 EAETPVKV 332


>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann
           fold, formate/glycerate dehydrogenase substrate-binding
           domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens}
           PDB: 2h1s_A 2q50_A
          Length = 330

 Score = 94.0 bits (232), Expect = 2e-20
 Identities = 34/115 (29%), Positives = 59/115 (51%), Gaps = 1/115 (0%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +   LT  T+ + NK+   K K     IN +RG +V+++ L + L SG +A AG DV   
Sbjct: 216 VACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSP 275

Query: 61  EPALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNM 114
           EP   N PL  L N    P++G++T  ++  +++  A+ +   L    + + L +
Sbjct: 276 EPLPTNHPLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL 330


>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A));
           2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4
           c.23.12.1
          Length = 320

 Score = 92.6 bits (229), Expect = 5e-20
 Identities = 37/112 (33%), Positives = 59/112 (52%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           L+ P T +T+   NK  +     G  ++N ARG LVD   +   L++G +A AGFDVF  
Sbjct: 208 LNAPSTPETRYFFNKATIKSLPQGAIVVNTARGDLVDNELVVAALEAGRLAYAGFDVFAG 267

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNAL 112
           EP +    + LPN F  P++G++  +++E +A Q    +        +S AL
Sbjct: 268 EPNINEGYYDLPNTFLFPHIGSAATQAREDMAHQANDLIDALFGGADMSYAL 319


>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation
           phosphoglycerate dehydrogenase PGDH, oxidoreductase;
           HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4
           c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A*
           2pa3_A* 2p9g_A*
          Length = 404

 Score = 92.3 bits (228), Expect = 8e-20
 Identities = 57/204 (27%), Positives = 91/204 (44%), Gaps = 28/204 (13%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP    TKN++  + +S  K G  +IN +RG +VD  ALA+ L S H+A A  DVF  
Sbjct: 203 LHVPENPSTKNMMGAKEISLMKPGSLLINASRGTVVDIPALADALASKHLAGAAIDVFPT 262

Query: 61  EPA-----LQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMA 115
           EPA       +PL    NV   P++G ST E+QE + +++A ++  Y  +G   +A+N  
Sbjct: 263 EPATNSDPFTSPLAEFDNVLLTPHIGGSTQEAQENIGLEVAGKLIKYSDNGSTLSAVNFP 322

Query: 116 IISFEEAPLV--------KPFM------TLADHLGCFIGQLISESIQE-----IQIIYDG 156
            +S               +P +        A+       Q   ++  +     I I  D 
Sbjct: 323 EVSLPLHGGRRLMHIHENRPGVLTALNKIFAEQGVNIAAQ-YLQTSAQMGYVVIDIEADE 381

Query: 157 STAVMNTMVLNSAVLAGIVRVWRV 180
             A      + +  + G +R  R+
Sbjct: 382 DVAEKALQAMKA--IPGTIRA-RL 402


>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein,
           phosphorylation, transcriptional corepressor,
           transcription repressor; HET: NAD; 1.95A {Homo sapiens}
           SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A*
           3ga0_A 2ome_A*
          Length = 347

 Score = 91.4 bits (226), Expect = 1e-19
 Identities = 34/115 (29%), Positives = 58/115 (50%), Gaps = 2/115 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LH  L     +++N   + + + G  ++N ARGGLVDE ALA+ L+ G +  A  DV E 
Sbjct: 229 LHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHES 288

Query: 61  EPAL--QNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           EP    Q PL   PN+ C P+    + ++  ++  + A ++   +   +  +  N
Sbjct: 289 EPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKN 343


>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase,
           oxidoreductase; 1.85A {Rhodotorula graminis} PDB:
           2w2l_A* 2w2l_D* 2w2k_B
          Length = 348

 Score = 89.0 bits (219), Expect = 8e-19
 Identities = 28/118 (23%), Positives = 55/118 (46%), Gaps = 4/118 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           + VP    T +++++   +  K G  I+N ARG ++ ++AL   L+SG +  AG DV E 
Sbjct: 226 VSVPYMKLTHHLIDEAFFAAMKPGSRIVNTARGPVISQDALIAALKSGKLLSAGLDVHEF 285

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDG----VVSNALNM 114
           EP +   L  + +V    ++G   +E+  +        +  +L+ G      +  +  
Sbjct: 286 EPQVSKELIEMKHVTLTTHIGGVAIETFHEFERLTMTNIDRFLLQGKPLLTPAGKVFA 343


>2pi1_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, 3D-structure,
           structural genomics, NPPSFA; HET: MSE NAD; 2.12A
           {Aquifex aeolicus VF5}
          Length = 334

 Score = 87.4 bits (215), Expect = 2e-18
 Identities = 38/133 (28%), Positives = 61/133 (45%), Gaps = 19/133 (14%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHVP T +T +++N+E +S  K GV +IN ARG +VD +AL    Q G  +  G DVFE 
Sbjct: 200 LHVPYTKETHHMINEERISLMKDGVYLINTARGKVVDTDALYRAYQRGKFSGLGLDVFED 259

Query: 61  EPALQN----------------PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYL- 103
           E  L                   L    NV   P++   T +S E++  +    +  ++ 
Sbjct: 260 EEILILKKYTEGKATDKNLKILELACKDNVIITPHIAYYTDKSLERIREETVKVVKAFVK 319

Query: 104 --IDGVVSNALNM 114
             ++ +  N +  
Sbjct: 320 GDLEQIKGNFVVG 332


>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein,
           substrate binding domain, cofactor binding domain,
           oxidoreductase; 1.47A {Solenostemon scutellarioides}
           PDB: 3baz_A*
          Length = 333

 Score = 84.2 bits (207), Expect = 2e-17
 Identities = 37/103 (35%), Positives = 56/103 (54%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           +  PLT +T +I+N+E +        +IN  RG  VDE  L   L  G +  AG DVFE 
Sbjct: 221 VACPLTPETTHIINREVIDALGPKGVLINIGRGPHVDEPELVSALVEGRLGGAGLDVFER 280

Query: 61  EPALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYL 103
           EP +   LFGL NV   P++G+ TVE+++ +A  +   +  + 
Sbjct: 281 EPEVPEKLFGLENVVLLPHVGSGTVETRKVMADLVVGNLEAHF 323


>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum
           aerophilum} SCOP: c.2.1.4 c.23.12.1
          Length = 303

 Score = 83.6 bits (206), Expect = 3e-17
 Identities = 20/117 (17%), Positives = 42/117 (35%), Gaps = 4/117 (3%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
             +PL   T+ ++  ++L+        +N  R  ++D + +  +L+         DV+  
Sbjct: 180 CALPLNKHTRGLVKYQHLALMAEDAVFVNVGRAEVLDRDGVLRILKERPQFIFASDVWWG 239

Query: 61  EPAL--QNPLFGLPNVFCAPYL--GASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
                     F LPNV   P++  G        ++ ++    +  Y   G   N   
Sbjct: 240 RNDFAKDAEFFSLPNVVATPWVAGGYGNERVWRQMVMEAVRNLITYATGGRPRNIAK 296


>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase protein;
           structural genomics, PSI-2, protein structure
           initiative; 1.90A {Ralstonia solanacearum}
          Length = 352

 Score = 82.8 bits (203), Expect = 5e-17
 Identities = 38/133 (28%), Positives = 59/133 (44%), Gaps = 10/133 (7%)

Query: 2   HVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVE 61
           H+ L ++T++I+   +L++ K     +N +R  LV+EN +   L  G    A  DVFE E
Sbjct: 222 HLRLNDETRSIITVADLTRMKPTALFVNTSRAELVEENGMVTALNRGRPGMAAIDVFETE 281

Query: 62  PALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFE 120
           P LQ   L  + N  C P++G    ES E         + D L  G V +  N       
Sbjct: 282 PILQGHTLLRMENCICTPHIGYVERESYEMYFGIAFQNILDIL-QGNVDSVANP------ 334

Query: 121 EAPLVKPFMTLAD 133
               + P +  A+
Sbjct: 335 --TALAPALIRAE 345


>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid
           dehydrogenase, cofactor regenerator, yeast, CBFDH; HET:
           PG4; 1.55A {Candida boidinii} PDB: 2fss_A
          Length = 364

 Score = 79.2 bits (194), Expect = 6e-16
 Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 6/108 (5%)

Query: 2   HVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVE 61
           + PL   TK ++NKE LSK K G  ++N ARG +     +A  L+SG +   G DV+  +
Sbjct: 228 NAPLHAGTKGLINKELLSKFKKGAWLVNTARGAICVAEDVAAALESGQLRGYGGDVWFPQ 287

Query: 62  PALQ-NPLFGLPNVFCA-----PYLGASTVESQEKVAIQLAHQMSDYL 103
           PA + +P   + N + A     P+   +T+++Q + A    + +  + 
Sbjct: 288 PAPKDHPWRDMRNKYGAGNAMTPHYSGTTLDAQTRYAQGTVNILESFF 335


>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD,
           tartrate, phosphate ION, oxidoreductase; HET: NAD TLA;
           2.30A {Pseudomonas aeruginosa}
          Length = 380

 Score = 79.2 bits (194), Expect = 7e-16
 Identities = 27/141 (19%), Positives = 59/141 (41%), Gaps = 1/141 (0%)

Query: 2   HVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVE 61
           +    + T+++L++  L+  + G  ++N +RG +VD  AL  LL+ G   E   DV+E E
Sbjct: 178 NRDGEHPTRHLLDEPRLAALRPGTWLVNASRGAVVDNQALRRLLEGGADLEVALDVWEGE 237

Query: 62  PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISFEE 121
           P   +P      +   P++   ++E + +   Q+      +       +  ++   ++  
Sbjct: 238 PQ-ADPELAARCLIATPHIAGYSLEGKLRGTAQIYQAYCAWRGIAERVSLQDVLPETWLA 296

Query: 122 APLVKPFMTLADHLGCFIGQL 142
              + P    A  L      +
Sbjct: 297 GLQLNPGCDPAWALATLCRAV 317


>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project on
           protein structural and functional analyses; 1.95A
           {Pyrococcus horikoshii OT3}
          Length = 333

 Score = 78.9 bits (193), Expect = 8e-16
 Identities = 38/127 (29%), Positives = 59/127 (46%), Gaps = 2/127 (1%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           L +PLT  T +I+N+E   K   G  ++N  RG LVDE A+ E ++ G +     DVFE 
Sbjct: 206 LALPLTRDTYHIINEER-VKKLEGKYLVNIGRGALVDEKAVTEAIKQGKLKGYATDVFEK 264

Query: 61  EPALQNPLF-GLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMAIISF 119
           EP  ++ LF         P+     +E+QE V  +    +   L   V  + +N  ++  
Sbjct: 265 EPVREHELFKYEWETVLTPHYAGLALEAQEDVGFRAVENLLKVLRGEVPEDLVNKEVLEV 324

Query: 120 EEAPLVK 126
                VK
Sbjct: 325 RPIENVK 331


>3kbo_A Glyoxylate/hydroxypyruvate reductase A; NADP, cytoplasm, NAD,
           structural genomics; HET: NDP NDB EPE; 2.14A {Salmonella
           enterica subsp}
          Length = 315

 Score = 73.2 bits (178), Expect = 4e-14
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 3/115 (2%)

Query: 2   HVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVE 61
            +P T +T  I+N E L +   G  ++N ARG  V E  L   L SG +  A  DVF  E
Sbjct: 200 LLPNTAQTVGIINSELLDQLPDGAYVLNLARGVHVQEADLLAALDSGKLKGAMLDVFSQE 259

Query: 62  PALQ-NPLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALNMA 115
           P  Q +PL+  P V   P++ A T  ++      ++  ++       V+  ++ A
Sbjct: 260 PLPQESPLWRHPRVAMTPHIAAVTRPAE--AIDYISRTITQLEKGEPVTGQVDRA 312


>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural
           variant of the BAB rossmann fold, oxidoreductase; 1.98A
           {Acidaminococcus fermentans}
          Length = 331

 Score = 69.4 bits (168), Expect = 6e-13
 Identities = 37/126 (29%), Positives = 58/126 (46%), Gaps = 15/126 (11%)

Query: 2   HVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVE 61
           H P   +   ++ ++ L K K G  ++NCARG LVD  A+ E ++SG +   G DV + E
Sbjct: 205 HAPYIKENGAVVTRDFLKKMKDGAILVNCARGQLVDTEAVIEAVESGKLGGYGCDVLDGE 264

Query: 62  PA----------LQNPLF-----GLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDG 106
            +          L+NPLF       P V   P+LG+ T E+ + +       + D    G
Sbjct: 265 ASVFGKDLEGQKLENPLFEKLVDLYPRVLITPHLGSYTDEAVKNMVEVSYQNLKDLAETG 324

Query: 107 VVSNAL 112
              N +
Sbjct: 325 DCPNKI 330


>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA,
           national project on protein structural and functional
           analyses; HET: NAD; 1.77A {Sulfolobus tokodaii}
          Length = 313

 Score = 67.0 bits (162), Expect = 3e-12
 Identities = 29/109 (26%), Positives = 49/109 (44%), Gaps = 3/109 (2%)

Query: 1   LHVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEV 60
           LHV ++   K I++       K  V I+N +R   V+  AL + ++ G V     DVF  
Sbjct: 202 LHVTVSKDAKPIIDYPQFELMKDNVIIVNTSRAVAVNGKALLDYIKKGKVYAYATDVFWN 261

Query: 61  EPALQN---PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDG 106
           EP  +     L     V    ++GA T E+Q++VA      + + + + 
Sbjct: 262 EPPKEEWELELLKHERVIVTTHIGAQTKEAQKRVAEMTTQNLLNAMKEL 310


>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase family protein;
           structural genomics, protein structure initiative; 1.80A
           {Aeromonas salmonicida subsp}
          Length = 324

 Score = 66.6 bits (161), Expect = 4e-12
 Identities = 28/113 (24%), Positives = 49/113 (43%), Gaps = 3/113 (2%)

Query: 2   HVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVE 61
            +P T +T ++         K G  + N  RG  ++E  L   L++G +  A  DVFE E
Sbjct: 201 VLPATRETHHLFTASRFEHCKPGAILFNVGRGNAINEGDLLTALRTGKLGMAVLDVFEQE 260

Query: 62  PALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDGVVSNALN 113
           P   + PL+G PN+   P+  A +    + VA         ++    +   ++
Sbjct: 261 PLPADSPLWGQPNLIITPHNSAYSFP--DDVAQIFVRNYIRFIDGQPLDGKID 311


>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein
           structure initiative; 2.20A {Lactobacillus plantarum}
          Length = 324

 Score = 64.8 bits (156), Expect = 1e-11
 Identities = 32/116 (27%), Positives = 53/116 (45%), Gaps = 2/116 (1%)

Query: 2   HVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVE 61
            +PLT  T ++ + E   +TK    +IN  RG  VD  AL   L    ++ A  DV E E
Sbjct: 198 ALPLTPTTHHLFSTELFQQTKQQPMLINIGRGPAVDTTALMTALDHHQLSMAALDVTEPE 257

Query: 62  PALQN-PLFGLPNVFCAPYLGASTVESQEKVAIQLAHQMSDYLIDG-VVSNALNMA 115
           P   + PL+   +V   P++       +  V    A   + ++ DG +V N +++ 
Sbjct: 258 PLPTDHPLWQRDDVLITPHISGQIAHFRATVFPIFAANFAQFVKDGTLVRNQVDLN 313


>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J,
           structural genomics, protein structure initiative; 2.20A
           {Thermoplasma acidophilum}
          Length = 290

 Score = 60.5 bits (145), Expect = 3e-10
 Identities = 25/103 (24%), Positives = 47/103 (45%), Gaps = 3/103 (2%)

Query: 2   HVPLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVE 61
            +PLT+KT+ ++N   L+  +  + I+N AR  +V +  +   L+         DV+  E
Sbjct: 180 AIPLTDKTRGMVNSRLLANARKNLTIVNVARADVVSKPDMIGFLKERSDVWYLSDVWWNE 239

Query: 62  PALQNPLFGLPNVFCAPYLGASTVESQEKVAIQLA-HQMSDYL 103
           P +      L N   +P++          +AIQLA   + ++ 
Sbjct: 240 PEI--TETNLRNAILSPHVAGGMSGEIMDIAIQLAFENVRNFF 280


>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid,
           S-adenosyl-L-homocysteine hydrolase, cytoplasm, NAD,
           one-carbon metabolism; HET: NAD; 2.30A {Burkholderia
           pseudomallei 1710B} PDB: 3glq_A*
          Length = 494

 Score = 58.3 bits (141), Expect = 1e-09
 Identities = 19/154 (12%), Positives = 46/154 (29%), Gaps = 16/154 (10%)

Query: 9   TKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPL 68
             +++N +++   +    + N        + A     Q     +   D        +  L
Sbjct: 342 NYHVINHDHMKAMRHNAIVCNIGHFDSEIDVASTRQYQ-WENIKPQVDHIIFPDGKRVIL 400

Query: 69  FGLPNVFCAPYLGASTVESQEKVAIQLAHQ----MSDYLIDGVVSNALNMAIISFEE--A 122
                +     LG +T      ++    +Q    +  +   G  +N + +     +E  A
Sbjct: 401 LAEGRL---VNLGCATGHPSFVMSNSFTNQTLAQIELFTRGGEYANKVYVLPKHLDEKVA 457

Query: 123 PLVKPFMTLADHLGCFIGQLISESIQEIQIIYDG 156
            L          +G  + +L  +    I +   G
Sbjct: 458 RLH------LARIGAQLSELSDDQAAYIGVSKAG 485


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 36.8 bits (85), Expect = 0.004
 Identities = 33/140 (23%), Positives = 56/140 (40%), Gaps = 55/140 (39%)

Query: 35  LVDENA--LAELLQSGHVAE----AGFDVFEVEPALQNP--------LFGLPNVFCAPYL 80
           L+  +A  L+EL+++   AE     G ++ E    L+NP        L  +P + C P +
Sbjct: 187 LIKFSAETLSELIRTTLDAEKVFTQGLNILE---WLENPSNTPDKDYLLSIP-ISC-PLI 241

Query: 81  GASTVESQEKVAIQLAH-------------QMSDYLI------DGVVSNALNMAII---- 117
           G           IQLAH             ++  YL        G+V+ A+ +A      
Sbjct: 242 GV----------IQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVT-AVAIAETDSWE 290

Query: 118 SFEEAPLVKPFMTLADHLGC 137
           SF  +  V+  +T+   +G 
Sbjct: 291 SFFVS--VRKAITVLFFIGV 308



 Score = 28.8 bits (64), Expect = 0.91
 Identities = 11/52 (21%), Positives = 18/52 (34%), Gaps = 22/52 (42%)

Query: 4   PLTNKTKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGF 55
            LT++     NK+      +GV +I            +A  L      + GF
Sbjct: 514 VLTHR-----NKDG-----TGVRVI------------VAGTLDINPDDDYGF 543



 Score = 25.7 bits (56), Expect = 8.1
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 16/57 (28%)

Query: 103  LIDGVVSNALNMAIISF--EEAPLVKP------FMTLADHLGCFIGQLISESI-QEI 150
            ++D V++N +N+  I F  E+   ++       F T+ D      G+L +E I +EI
Sbjct: 1661 ILDIVINNPVNLT-IHFGGEKGKRIRENYSAMIFETIVD------GKLKTEKIFKEI 1710


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty
           acid synthase, acyl-carrier-protein, beta-ketoacyl
           reductase, beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 1688

 Score = 27.5 bits (60), Expect = 2.6
 Identities = 28/144 (19%), Positives = 53/144 (36%), Gaps = 28/144 (19%)

Query: 15  KENLSKTKSGVCIINCARGGLVDENALAELLQSGHVAEAGFDVFEVEPALQNPLFGLPNV 74
           KE  +K +  +   +  R  +  E AL   + +G+ A+A +   E++P   N     P +
Sbjct: 738 KEFTAKLRKELVETSEVRKAVSIETALEHKVVNGNSADAAYAQVEIQPR-ANIQLDFPEL 796

Query: 75  FCAPY-----LGASTVE---SQEKVAIQLA----------------HQMSDYLIDGVVSN 110
              PY     +  + +E     E+V +                       ++ ++G V  
Sbjct: 797 --KPYKQVKQIAPAELEGLLDLERVIVVTGFAEVGPWGSARTRWEMEAFGEFSLEGCVEM 854

Query: 111 ALNMAIISFEEAPLV-KPFMTLAD 133
           A  M  IS+    L  +P+    D
Sbjct: 855 AWIMGFISYHNGNLKGRPYTGWVD 878



 Score = 27.1 bits (59), Expect = 2.7
 Identities = 25/115 (21%), Positives = 50/115 (43%), Gaps = 19/115 (16%)

Query: 92  AIQLAH--QMSDYLIDGVVSNALNM--------AIISFEEAPLVKPFMTLADHLGCFIGQ 141
            I+L H    S++    +++N L M        +    E  P  +  + ++ + G F G 
Sbjct: 579 GIELEHIDSKSEFAHRIMLTNILRMMGCVKKQKSARGIETRP-AQVILPMSPNHGTFGGD 637

Query: 142 -LISESIQEIQIIYD--GSTAVMNTMVLNSAVLAGIVRVWRVGANIISAPIIIKE 193
            + SES   ++ +++   S +  N + +  A++      W  G  ++SA  II E
Sbjct: 638 GMYSESKLSLETLFNRWHSESWANQLTVCGAIIG-----WTRGTGLMSANNIIAE 687


>3hhc_A Interleukin-28B; interferon, IL-22, antiviral, antiviral defense,
           cytokine, secreted; 2.80A {Homo sapiens}
          Length = 196

 Score = 26.0 bits (57), Expect = 6.7
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 123 PLVKPFMTLADHLGCFIGQLISESIQEIQ 151
           P+ +    L D  GC I Q  S S QE+Q
Sbjct: 23  PVARLRGALPDARGCHIAQFKSLSPQELQ 51


>3l2f_A Glycocyamine kinase beta chain; phosphagen kinase, transition
          state ANA kinase, transferase; HET: ADP; 2.30A
          {Namalycastis SP} PDB: 3l2e_B 3l2d_A* 3l2g_A* 3l2e_A
          Length = 390

 Score = 25.4 bits (55), Expect = 9.5
 Identities = 11/52 (21%), Positives = 21/52 (40%), Gaps = 2/52 (3%)

Query: 9  TKNILNKENLSKTKSGVCIINCARGGLVDENALAELLQSGHVA--EAGFDVF 58
          TK +  K     T +GV    C + G+ +        ++G V   E  ++ +
Sbjct: 46 TKELYEKYWDKVTPNGVTFDKCIQTGVDNPGNKFYGKKTGCVFGDEYSYECY 97


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.319    0.135    0.382 

Gapped
Lambda     K      H
   0.267   0.0567    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 1,634,535
Number of extensions: 70184
Number of successful extensions: 205
Number of sequences better than 10.0: 1
Number of HSP's gapped: 180
Number of HSP's successfully gapped: 38
Length of query: 208
Length of database: 5,693,230
Length adjustment: 88
Effective length of query: 120
Effective length of database: 3,559,758
Effective search space: 427170960
Effective search space used: 427170960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (24.9 bits)