BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.349_1 (50 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.349_1 Length = 50 Score = 104 bits (260), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 50/50 (100%), Positives = 50/50 (100%) Query: 1 MNFLLIKYYFYQLSSWNGNMEYSGTMRNTSLVTALRYAQHIKGMSVDNAI 50 MNFLLIKYYFYQLSSWNGNMEYSGTMRNTSLVTALRYAQHIKGMSVDNAI Sbjct: 1 MNFLLIKYYFYQLSSWNGNMEYSGTMRNTSLVTALRYAQHIKGMSVDNAI 50 >gi|254780999|ref|YP_003065412.1| NAD synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 562 Score = 20.8 bits (42), Expect = 5.0, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 10/16 (62%) Query: 2 NFLLIKYYFYQLSSWN 17 NF+ +Y QLS WN Sbjct: 240 NFMTEWHYDQQLSQWN 255 >537021.9.peg.1096_1 Length = 53 Score = 20.0 bits (40), Expect = 8.1, Method: Compositional matrix adjust. Identities = 8/20 (40%), Positives = 12/20 (60%) Query: 22 YSGTMRNTSLVTALRYAQHI 41 YS + S + +L+YA HI Sbjct: 8 YSADKISESRIFSLKYADHI 27 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.132 0.393 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,810 Number of Sequences: 1233 Number of extensions: 775 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 50 length of database: 328,796 effective HSP length: 23 effective length of query: 27 effective length of database: 300,437 effective search space: 8111799 effective search space used: 8111799 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.1 bits) S2: 31 (16.5 bits)