Query         537021.9.peg.363_1
Match_columns 79
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 13730
Date          Tue May 24 18:38:02 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i peg_363.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1es6a2 b.31.1.1 (A:201-321) E   4.5      74  0.0054   12.8  -0.2   20   49-68     20-39  (121)
  2 d1dcea2 b.7.4.1 (A:242-350) Ra   3.6 1.2E+02  0.0086   11.8   0.3   13   16-28     14-26  (109)
  3 d1khba1 c.91.1.1 (A:260-622) C   2.5   2E+02   0.014   10.8   1.7   19   16-34    170-188 (363)
  4 d1e5ka_ c.68.1.8 (A:) Molybden   2.5      67  0.0049   13.0  -2.0   11   55-65    173-183 (188)
  5 d2glia1 g.37.1.1 (A:103-134) F   2.3 1.1E+02  0.0083   11.9  -1.0   14   51-64     14-27  (32)
  6 d2bufa1 c.73.1.2 (A:2-301) N-a   1.6 2.1E+02   0.015   10.7  -0.6   18   29-46     19-36  (300)
  7 d1lmia_ b.1.19.1 (A:) Antigen    1.5 3.1E+02   0.022    9.8   0.9   23   16-38     50-72  (131)
  8 d1oopa_ b.121.4.1 (A:) Swine v   1.4 3.4E+02   0.025    9.6   0.7   59    8-68     31-90  (271)
  9 d1oxxk1 b.40.6.3 (K:243-352) G   1.3 3.5E+02   0.025    9.5   0.0    7    6-12     33-39  (110)
 10 d1s28a_ d.198.1.1 (A:) AvrPphF   1.3 3.3E+02   0.024    9.7  -0.2   10   54-63     12-21  (130)

No 1  
>d1es6a2 b.31.1.1 (A:201-321) EV matrix protein {Ebola virus [TaxId: 205488]}
Probab=4.50  E-value=74  Score=12.84  Aligned_cols=20  Identities=35%  Similarity=0.589  Sum_probs=16.0

Q ss_pred             HHHHCCCCHHHCCCCCHHHH
Q ss_conf             11100240010578622320
Q 537021.9.peg.3   49 AKSSRDGLVKDINTPDKQQT   68 (79)
Q Consensus        49 akssrdglvkdintpdkqqt   68 (79)
                      .|+...|-+.|...|||-|+
T Consensus        20 gk~gkkg~~sdltspdkiq~   39 (121)
T d1es6a2          20 NKSGKKGNSADLTSPEKIQA   39 (121)
T ss_dssp             CC-----CHHHHSCHHHHHH
T ss_pred             CCCCCCCCCCCCCCHHHHHH
T ss_conf             86677665234678899999


No 2  
>d1dcea2 b.7.4.1 (A:242-350) Rab geranylgeranyltransferase alpha-subunit, insert domain {Rat (Rattus norvegicus) [TaxId: 10116]}
Probab=3.62  E-value=1.2e+02  Score=11.85  Aligned_cols=13  Identities=46%  Similarity=0.772  Sum_probs=8.8

Q ss_pred             CEEEEEECCCCCC
Q ss_conf             3025861587312
Q 537021.9.peg.3   16 STTTVSFSRPTTI   28 (79)
Q Consensus        16 stttvsfsrptti   28 (79)
                      .--+|.||||-..
T Consensus        14 ~~l~v~FSrpv~v   26 (109)
T d1dcea2          14 ACLSVCFSRPLTV   26 (109)
T ss_dssp             TEEEEEEEEEECT
T ss_pred             CEEEEEECCCEEC
T ss_conf             7489996251340


No 3  
>d1khba1 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]}
Probab=2.48  E-value=2e+02  Score=10.77  Aligned_cols=19  Identities=26%  Similarity=0.359  Sum_probs=12.5

Q ss_pred             CEEEEEECCCCCCCEEEEE
Q ss_conf             3025861587312102330
Q 537021.9.peg.3   16 STTTVSFSRPTTIPLVTQF   34 (79)
Q Consensus        16 stttvsfsrpttiplvtqf   34 (79)
                      |.-...=-|++|+|||.|-
T Consensus       170 saiiFGGRr~~t~PlV~ea  188 (363)
T d1khba1         170 EGIIFGGRRPAGVPLVYEA  188 (363)
T ss_dssp             EEEEEECCCSSSCCSEEEC
T ss_pred             EEEEECCCCCCCCCCEEEE
T ss_conf             7899756568888724873


No 4  
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]}
Probab=2.46  E-value=67  Score=13.04  Aligned_cols=11  Identities=27%  Similarity=0.619  Sum_probs=6.8

Q ss_pred             CCHHHCCCCCH
Q ss_conf             40010578622
Q 537021.9.peg.3   55 GLVKDINTPDK   65 (79)
Q Consensus        55 glvkdintpdk   65 (79)
                      +..-|||||+.
T Consensus       173 ~~~~ninTpeD  183 (188)
T d1e5ka_         173 DAFVNVNTPEE  183 (188)
T ss_dssp             TTTCCCCSHHH
T ss_pred             CCCCCCCCHHH
T ss_conf             70038997999


No 5  
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]}
Probab=2.32  E-value=1.1e+02  Score=11.94  Aligned_cols=14  Identities=36%  Similarity=0.560  Sum_probs=9.3

Q ss_pred             HHCCCCHHHCCCCC
Q ss_conf             10024001057862
Q 537021.9.peg.3   51 SSRDGLVKDINTPD   64 (79)
Q Consensus        51 ssrdglvkdintpd   64 (79)
                      .+.|.||+.||.-.
T Consensus        14 dtQd~LV~HinndH   27 (32)
T d2glia1          14 DSQEQLVHHINSEH   27 (32)
T ss_dssp             SCHHHHHHHHHHHT
T ss_pred             CCHHHHHHHCCCCC
T ss_conf             88999998714120


No 6  
>d2bufa1 c.73.1.2 (A:2-301) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]}
Probab=1.63  E-value=2.1e+02  Score=10.67  Aligned_cols=18  Identities=17%  Similarity=0.628  Sum_probs=8.1

Q ss_pred             CEEEEECCCEEEEEECCC
Q ss_conf             102330341333432010
Q 537021.9.peg.3   29 PLVTQFSARSFLVKLSSR   46 (79)
Q Consensus        29 plvtqfsarsflvklssr   46 (79)
                      |.+.+|..+.|.+|+...
T Consensus        19 PYi~~~r~ktiVIKlGG~   36 (300)
T d2bufa1          19 PYIRRFVGKTLVIKYGGN   36 (300)
T ss_dssp             HHHHHHTTCEEEEEECCT
T ss_pred             HHHHHHCCCEEEEEECHH
T ss_conf             999997899899998917


No 7  
>d1lmia_ b.1.19.1 (A:) Antigen MPT63/MPB63 (immunoprotective extracellular protein) {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=1.48  E-value=3.1e+02  Score=9.82  Aligned_cols=23  Identities=43%  Similarity=0.600  Sum_probs=17.6

Q ss_pred             CEEEEEECCCCCCCEEEEECCCE
Q ss_conf             30258615873121023303413
Q 537021.9.peg.3   16 STTTVSFSRPTTIPLVTQFSARS   38 (79)
Q Consensus        16 stttvsfsrpttiplvtqfsars   38 (79)
                      .|.|+.--.-+-.|++.+|.||.
T Consensus        50 AtaT~~Av~GtvtPiisnfnAra   72 (131)
T d1lmia_          50 ATATVNAIRGSVTPAVSQFNART   72 (131)
T ss_dssp             EEEEEEEEESCBCCCGGGEEEEC
T ss_pred             EEEEEEEECCCCCCCCCCCCEEC
T ss_conf             67885542353122314411231


No 8  
>d1oopa_ b.121.4.1 (A:) Swine vesicular disease virus coat proteins {Swine vesicular disease virus [TaxId: 12075]}
Probab=1.36  E-value=3.4e+02  Score=9.61  Aligned_cols=59  Identities=27%  Similarity=0.201  Sum_probs=30.8

Q ss_pred             CCCCCCCCCEEEEEECCCCCCCEEEEECCCEEEEEECCCHHHHHHCCCC-HHHCCCCCHHHH
Q ss_conf             7355686630258615873121023303413334320102211100240-010578622320
Q 537021.9.peg.3    8 RPSNLSPTSTTTVSFSRPTTIPLVTQFSARSFLVKLSSRRVAKSSRDGL-VKDINTPDKQQT   68 (79)
Q Consensus         8 rpsnlsptstttvsfsrpttiplvtqfsarsflvklssrrvakssrdgl-vkdintpdkqqt   68 (79)
                      .|+++.-|-..-..+||-.+  -+.-|-.|+++|....-.....+-++. ..+||.-+.-|.
T Consensus        31 ~pedtiETR~V~n~hs~sET--sIE~F~~RsacV~~~~~~~~~~~~~~f~~W~In~~~~vQl   90 (271)
T d1oopa_          31 VPSDTMQTRHVKNYHSRSES--TVENFLCRSACVFYTTYENHDSDGDNFAYWVINTRQVAQL   90 (271)
T ss_dssp             CGGGTSCCCCBCCCCCCGGG--BHHHHHCSCEEEEEEEEEESSCSSTTEEEEECCSCSSHHH
T ss_pred             CCCCCEEEEEECCCCCCCCC--CHHHHHHHHHEEEEEEEECCCCCCCCEEEEEEECCCHHHH
T ss_conf             86242240038776786502--2565530111168999970587777722578725308998


No 9  
>d1oxxk1 b.40.6.3 (K:243-352) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
Probab=1.32  E-value=3.5e+02  Score=9.54  Aligned_cols=7  Identities=57%  Similarity=1.289  Sum_probs=0.0

Q ss_pred             CCCCCCC
Q ss_conf             6473556
Q 537021.9.peg.3    6 GIRPSNL   12 (79)
Q Consensus         6 girpsnl   12 (79)
                      ||||.++
T Consensus        33 GIRPE~i   39 (110)
T d1oxxk1          33 GIRPEDV   39 (110)
T ss_dssp             EECGGGE
T ss_pred             EECHHHE
T ss_conf             9856878


No 10 
>d1s28a_ d.198.1.1 (A:) AvrPphF ORF1, chaperone of AvrPphF ORF2 {Pseudomonas syringae pv. phaseolicola [TaxId: 319]}
Probab=1.26  E-value=3.3e+02  Score=9.67  Aligned_cols=10  Identities=60%  Similarity=0.999  Sum_probs=0.0

Q ss_pred             CCCHHHCCCC
Q ss_conf             2400105786
Q 537021.9.peg.3   54 DGLVKDINTP   63 (79)
Q Consensus        54 dglvkdintp   63 (79)
                      |||.||.+-|
T Consensus        12 dgLakdY~mP   21 (130)
T d1s28a_          12 DGLAKDYGMP   21 (130)
T ss_dssp             HHHHHHHCCC
T ss_pred             HHHHHHCCCC
T ss_conf             9999863899


Done!