RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= 537021.9.peg.363_1
         (79 letters)



>gnl|CDD|114410 pfam05684, DUF819, Protein of unknown function (DUF819).  This
          family contains proteins of unknown function from
          archaeal, bacterial and plant species.
          Length = 379

 Score = 27.0 bits (60), Expect = 1.3
 Identities = 12/53 (22%), Positives = 22/53 (41%), Gaps = 8/53 (15%)

Query: 1  MNSLRGIRPSNLSPTSTTTVSFSRPTTIPLVTQFSARSFLVKLSSRRVAKSSR 53
           N++  I   + SP      +F  P  IPL+        L+++  R++ K   
Sbjct: 38 FNTVGLIDSESESPAYDVVRNFLLPAAIPLL--------LLRIDLRKIIKLGG 82


>gnl|CDD|32271 COG2088, SpoVG, Uncharacterized protein, involved in the
          regulation of septum location [Cell envelope
          biogenesis, outer membrane].
          Length = 95

 Score = 24.9 bits (54), Expect = 5.7
 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 4/36 (11%)

Query: 41 VKLSSRRVAKSSRDGLVKDINTPDKQQTKNPITSSV 76
          V + SRR    + DG  +DI  P    T+  I  +V
Sbjct: 45 VAMPSRR----TPDGEFRDIAHPINSDTREKIQDAV 76


>gnl|CDD|37665 KOG2454, KOG2454, KOG2454, Betaine aldehyde dehydrogenase [Energy
          production and conversion].
          Length = 583

 Score = 24.2 bits (52), Expect = 8.0
 Identities = 12/37 (32%), Positives = 13/37 (35%)

Query: 2  NSLRGIRPSNLSPTSTTTVSFSRPTTIPLVTQFSARS 38
          NS   I P   S  S   V    P T   +  F A S
Sbjct: 48 NSFIYIPPRGRSQQSDKKVQCYCPATGKYLGYFPALS 84


>gnl|CDD|144423 pfam00821, PEPCK, Phosphoenolpyruvate carboxykinase.  Catalyses the
           formation of phosphoenolpyruvate by decarboxylation of
           oxaloacetate.
          Length = 586

 Score = 24.1 bits (53), Expect = 8.5
 Identities = 6/10 (60%), Positives = 8/10 (80%)

Query: 24  RPTTIPLVTQ 33
           RP T+PLV +
Sbjct: 401 RPDTVPLVYE 410


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.313    0.125    0.335 

Gapped
Lambda     K      H
   0.267   0.0690    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 800,741
Number of extensions: 28393
Number of successful extensions: 43
Number of sequences better than 10.0: 1
Number of HSP's gapped: 43
Number of HSP's successfully gapped: 7
Length of query: 79
Length of database: 6,263,737
Length adjustment: 49
Effective length of query: 30
Effective lengt