RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= 537021.9.peg.363_1
         (79 letters)



>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A;
           molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A
           {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A*
           1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A*
          Length = 201

 Score = 28.7 bits (63), Expect = 0.29
 Identities = 6/32 (18%), Positives = 11/32 (34%)

Query: 33  QFSARSFLVKLSSRRVAKSSRDGLVKDINTPD 64
           +     F+       V  S       ++NTP+
Sbjct: 154 ERRVMVFMRLAGGHAVDFSDHKDAFVNVNTPE 185


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.313    0.125    0.335 

Gapped
Lambda     K      H
   0.267   0.0595    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 537,927
Number of extensions: 16363
Number of successful extensions: 24
Number of sequences better than 10.0: 1
Number of HSP's gapped: 24
Number of HSP's successfully gapped: 4
Length of query: 79
Length of database: 5,693,230
Length adjustment: 48
Effective length of query: 31
Effective length of database: 4,529,518
Effective search space: 140415058
Effective search space used: 140415058
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 50 (23.3 bits)