>cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP). The nuclear-encoded, mitochondrial polyprotein precursor with an N-terminal NAGK (ArgB) domain (this CD), a central DUF619 domain, and a C-terminal reductase domain (ArgC, N-Acetylglutamate Phosphate Reductase, NAGPR). The precursor is cleaved in the mitochondria into two distinct enzymes (NAGK-DUF619 and NAGPR). Native molecular weights of these proteins indicate that the kinase is an octamer whereas the reductase is a dimer. This CD also includes some gamma-proteobacteria (Xanthomonas and Xylella) NAG kinases with an N-terminal NAGK (ArgB) domain (this CD) and a C-terminal DUF619 domain. The DUF619 domain is described as a putative distant homolog of the acetyltransferase, ArgA, predicted to function in NAG synthase association in fungi. Eukaryotic sequences have an N-terminal mitochondrial transit peptide. Members of this NAG kinase domain CD belong to th

Probab=99.97 E-value=4.9e-30 Score=213.63 Aligned_cols=115 Identities=28% Similarity=0.503 Sum_probs=107.7 Q ss_pred EEEECHHHHCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHCCCCCEEECCCCCCCHHHHHHHHHHHHHHHHH Q ss_conf 99867567247468999999999985189717998457245788999708981155783466124899999997416689 Q 537021.9.peg.3 29 VVKYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINK 108 (150) Q Consensus 29 VIK~GG~~l~d~~l~~~~~~dI~ll~~~G~k~ViVHGgg~qI~~~l~~~gi~~~~v~G~RVTd~~tl~iv~~vL~G~vn~ 108 (150) T Consensus 2 VIk~GG~~~~d~--~~~l~~di~lL~~lGi~~VlVHGgg~qI~~~l~~~gi~~~~~~G~RvTd~~~l~~v~~vl~-~vn~ 78 (248) T cd04252 2 VIKVGGAIIEDD--LDELAASLSFLQHVGLYPIVVHGAGPQLNEELEAAGVEPEYVDGLRVTDPETLAVARKVFL-EENL 78 (248) T ss_pred EEEECCHHHHHH--HHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHH-HHHH T ss_conf 799991776521--9999999999998899599991898788899998699853138844689899999999999-9999 Q ss_pred HHHHHHHHCCCCEEEEEEEECCEEEEEECCC-CCCCCCCCCC Q ss_conf 9999998289976877865589899997475-2111799510 Q 537021.9.peg.3 109 KIVSLINQTGTQAIGICGKDGNMVFAEKARH-SLRLSPNTKK 149 (150) Q Consensus 109 ~lv~~L~~~g~~avglsg~dg~li~a~~~~~-~lg~vg~~~k 149 (150) T Consensus 79 ~lv~~l~~~g~~a~~i~g---~~~~a~~~~~~~~g~vG~v~~ 117 (248) T cd04252 79 KLVEALERNGARARPITS---GVFEAEYLDKDKYGLVGKITG 117 (248) T ss_pred HHHHHHHHCCCCEEEECC---CCEEEEECCCCCCCCCCCEEE T ss_conf 999999965997386037---636888667656784322589

HHsearch alignment for GI: peg_393 and conserved domain: cd04252