RPSBLAST alignment of GI: peg_393 and protein with PDBid: 2e9y

>2e9y_A Carbamate kinase; transferase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aeropyrum pernix K1} Length = 316
 Score = 91.5 bits (226), Expect = 8e-20
 Identities = 19/129 (14%), Positives = 41/129 (31%), Gaps = 16/129 (12%)

Query: 25  NETIVVKYGGHVMNCTDLS----------KDFVNDIALLKKSNITPVIVHGGGPQIGAVL 74
               V+  GG+ +    +           K   + IA +       VI HG GPQ+G + 
Sbjct: 4   GRLAVIALGGNAIAGPGMDVSVESQTAAVKRASSIIADVLADGWRSVITHGNGPQVGYLS 63

Query: 75  EKMGIKSKFENGLRI------TDQQTAEVVEMVLAGSINKKIVSLINQTGTQAIGICGKD 128
           E             +      T      +++  L   + ++ ++++       + +   D
Sbjct: 64  EAFEALPPERPRQPLYIATAMTQAWIGLLLKHSLEEELRRRGLNVLVPVVISRVLVDVSD 123

Query: 129 GNMVFAEKA 137
            +     K 
Sbjct: 124 PSFNNPSKP 132