BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.393_1 (150 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.393_1 Length = 150 Score = 307 bits (787), Expect = 4e-86, Method: Compositional matrix adjust. Identities = 150/150 (100%), Positives = 150/150 (100%) Query: 1 MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITP 60 MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITP Sbjct: 1 MTEKIYQFQAEILEQVLPFVQFYENETIVVKYGGHVMNCTDLSKDFVNDIALLKKSNITP 60 Query: 61 VIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQ 120 VIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQ Sbjct: 61 VIVHGGGPQIGAVLEKMGIKSKFENGLRITDQQTAEVVEMVLAGSINKKIVSLINQTGTQ 120 Query: 121 AIGICGKDGNMVFAEKARHSLRLSPNTKKT 150 AIGICGKDGNMVFAEKARHSLRLSPNTKKT Sbjct: 121 AIGICGKDGNMVFAEKARHSLRLSPNTKKT 150 >gi|254780124|ref|YP_003064537.1| hypothetical protein CLIBASIA_00015 [Candidatus Liberibacter asiaticus str. psy62] Length = 388 Score = 26.6 bits (57), Expect = 0.23, Method: Compositional matrix adjust. Identities = 13/24 (54%), Positives = 14/24 (58%) Query: 80 KSKFENGLRITDQQTAEVVEMVLA 103 K FEN RI D + A V MVLA Sbjct: 63 KLTFENDTRIVDTEMASSVSMVLA 86 >gi|254781051|ref|YP_003065464.1| alpha-ketoglutarate decarboxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 957 Score = 24.3 bits (51), Expect = 1.1, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Query: 34 GHVMNCTDLSKDFVND--IALLKKSNITPVIVHG 65 G V DL V + I+L+++S + P+I+HG Sbjct: 344 GSVRARQDLKAGIVGEKSISLVERSRVLPLIIHG 377 >gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 954 Score = 23.1 bits (48), Expect = 2.6, Method: Compositional matrix adjust. Identities = 12/24 (50%), Positives = 15/24 (62%) Query: 50 IALLKKSNITPVIVHGGGPQIGAV 73 I LK +N T V V+ GG + GAV Sbjct: 425 IPFLKVANDTAVAVNQGGKRKGAV 448 >gi|254780662|ref|YP_003065075.1| NAD-glutamate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 1576 Score = 22.7 bits (47), Expect = 3.0, Method: Composition-based stats. Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 19/81 (23%) Query: 83 FENGLRITDQQTAEVVEMVLAGSINKKI-VSLINQTG-------TQAIGICGKDGNM--- 131 EN ++ T+EVVE+VL + + + +SL ++ G Q + GK+G + Sbjct: 1165 LENRNKLLSSMTSEVVELVLRNNYLQSLAISLESRKGMAMMWNFAQLMKFLGKEGALDRE 1224 Query: 132 --------VFAEKARHSLRLS 144 F E+ R + LS Sbjct: 1225 LEHLPSVVSFEERIREEVSLS 1245 >gi|254780217|ref|YP_003064630.1| DNA polymerase III subunit delta' [Candidatus Liberibacter asiaticus str. psy62] Length = 347 Score = 22.3 bits (46), Expect = 3.6, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 27 TIVVKYGGHVMNCTDLSK 44 T+ +Y GHV+ D SK Sbjct: 49 TLGFRYAGHVLQNPDFSK 66 >gi|254780995|ref|YP_003065408.1| Endonuclease/exonuclease/phosphatase [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 21.9 bits (45), Expect = 4.5, Method: Compositional matrix adjust. Identities = 9/26 (34%), Positives = 15/26 (57%) Query: 88 RITDQQTAEVVEMVLAGSINKKIVSL 113 + DQ+ + V+AG N+KI S+ Sbjct: 11 KWADQKIKTGIPFVIAGDFNRKINSI 36 >gi|254780451|ref|YP_003064864.1| aconitate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 896 Score = 21.9 bits (45), Expect = 5.2, Method: Compositional matrix adjust. Identities = 10/36 (27%), Positives = 19/36 (52%) Query: 31 KYGGHVMNCTDLSKDFVNDIALLKKSNITPVIVHGG 66 K GG+ ++ + F+ D A+ K + P++V G Sbjct: 740 KKGGYTIHYPSKEELFIYDAAMRYKVDQVPLVVFAG 775 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.135 0.375 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,285 Number of Sequences: 1233 Number of extensions: 3521 Number of successful extensions: 15 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 9 length of query: 150 length of database: 328,796 effective HSP length: 67 effective length of query: 83 effective length of database: 246,185 effective search space: 20433355 effective search space used: 20433355 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 34 (17.7 bits)