peg_409

peg_409

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(430017, 430745)Protein Length:242aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:FIG061771: ATP-dependent nuclease subunit A
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240--
MIYHNSFQEHSETIDLISQTKSEQLLASDPTRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHRVLEIITAWSHLSDEILSAEITKIQGKKPNKSDMSKARHLLITILETPGGLKVQTIHAFCEAIMQQFPLEANITSHFAIADEEQSKKLIEEAKKSTLASIMLDNNEELKKAFYEILEISNDEDIETLISDIISNRTALKLIFFFFSYLWRRKIIEKSLWSIA
cccccccHHHHHHHHcccccHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHcccccccEEccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcc
cccEEcccccccHHHHHHccHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccEHHHHHHHHHHHHHccHHcccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHc
miyhnsfqehsETIDLISQtkseqllasdptrsawvsanagsgkthILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHRVLEIITAWSHLSDEILSAEITKiqgkkpnksdmsKARHLLITILetpgglkvQTIHAFCEAIMQQfpleanitshfaiadEEQSKKLIEEAKKSTLASIMLDNNEELKKAFYEILEISNDEDIETLISDIISNRTALKLIFFFFSYLWRRKIIEKSLWSIA
miyhnsfqehseTIDLISQTKSEQLLASDPTRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHRVLEIITAWSHLSDEILSAEITkiqgkkpnksdmSKARHLLITILETPGGLKVQTIHAFCEAIMQQFPLEANITSHFAIADEEQSKKLIEEAKKSTLASIMLDNNEELKKAFYEILEISNDEDIETLISDIISNRTALKLIFFFFSYLWRRKIIEKSLWSIA
MIYHNSFQEHSETIDLISQTKSEQLLASDPTRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHRVLEIITAWSHLSDEILSAEITKIQGKKPNKSDMSKARHLLITILETPGGLKVQTIHAFCEAIMQQFPLEANITSHFAIADEEQSKKLIEEAKKSTLASIMLDNNEELKKAFYEILEISNDEDIETLISDIISNRTALKLIFFFFSYLWRRKIIEKSLWSIA
****************ISQTKSEQLLASDPTRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHRVLEIITAWSHLSDEIL**************SDMSKARHLLITILETPGGLKVQTIHAFCEAIMQQFPLEANITSHFAIADEEQSKKLIEEAKKSTLASIMLDNNEELKKAFYEILEISNDEDIETLISDIISNRTALKLIFFFFSYLWRRKIIEKSLWSIA
***********ETIDLISQTKSEQLLASDPTRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHRVLEIITAWSHLSDEILSAEITKI**********SKARHLLITILETPGGLKVQTIHAFCEAIMQQFPLEANITSHFAIADEEQSKKLIEEAKKSTLASIMLDNNEELKKAFYEILEISNDEDIETLISDIISNRTALKLIFFFFSYLWRRKIIEKSLWSIA
*IYHNSFQEHSETIDLISQTKSEQLLASDPTRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHRVLEIITAWSHLSDEILSAEITKIQGKKPNKSDMSKARHLLITILETPGGLKVQTIHAFCEAIMQQFPLEANITSHFAIADEEQSKKLIEEAKKSTLASIMLDNNEELKKAFYEILEISNDEDIETLISDIISNRTALKLIFFFFSYLWRRKIIEKSLWSIA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIYHNSFQEHSETIDLISQTKSEQLLASDPTRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHRVLEIITAWSHLSDEILSAEITKIQGKKPNKSDMSKARHLLITILETPGGLKVQTIHAFCEAIMQQFPLEANITSHFAIADEEQSKKLIEEAKKSTLASIMLDNNEELKKAFYEILEISNDEDIETLISDIISNRTALKLIFFFFSYLWRRKIIEKSLWSIA
MIYHNSFQEHSETIDLISQTKSEQLLASDPTRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHRVLEIITAWSHLSDEILSAEITKIQGKKPNKSDMSKARHLLITILETPGGLKVQTIHAFCEAIMQQFPLEANITSHFAIADEEQSKKLIEEAKKSTLASIMLDNNEELKKAFYEILEISNDEDIETLISDIISNRTALKLIFFFFSYLWRRKIIEKSLWSIA
MIYHNSFQEHSETIDLISQTKSEQLLASDPTRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHRVLEIITAWSHLSDEILSAEITKIQGKKPNKSDMSKARHLLITILETPGGLKVQTIHAFCEAIMQQFPLEANITSHFAIADEEQSKKLIEEAKKSTLASIMLDNNEELKKAFYEILEISNDEDIETLISDIISNRTALKLIFFFFSYLWRRKIIEKSLWSIA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target242
254780952 685 DNA helicase II [Candidatus Liberibacter asiaticus 2e-06
>gi|254780952|ref|YP_003065365.1| DNA helicase II [Candidatus Liberibacter asiaticus str. psy62] Length = 685 Back     alignment
 Score = 44.3 bits (103), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 64/150 (42%), Gaps = 45/150 (30%)

Query: 38  ANAGSGKTHILVQRVLRLLL-ANAHPSTLLCLTHTKAAAAEMSHRVLEIITAWSHLSDEI 96
           A AG+GKT +L+ R+L L+      PS +L +T T  A  EM +R+        +L ++I
Sbjct: 50  AGAGTGKTTVLIARMLHLICHKEIPPSKILAMTFTNQAIQEMKNRLA------CYLGEKI 103

Query: 97  LSAEITKIQGKKPNKSDMSKARHLLITILETPGGLKVQTIHAFCEAIMQQFPLEANITSH 156
                                              ++QT H+FC +I+++      + + 
Sbjct: 104 ----------------------------------PRIQTFHSFCASILRKHGEVVGLPTD 129

Query: 157 FAIADEEQSKKLIEEAKKSTLASIMLDNNE 186
           FAI D  +S+ +I    K  L  + +D+ +
Sbjct: 130 FAILDSAESRTII----KQLLKDLQIDDKD 155

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target242
315122046 1179 double-strand break repair helicase AddA [Candidatus Li 1 9e-77
218682571 415 ATP-dependent UvrD family DNA helicase [Rhizobium etli 1 2e-58
222084227 1188 double-strand break repair helicase AddA [Agrobacterium 1 1e-57
222147062 1182 ATP-dependant DNA helicase [Agrobacterium vitis S4] Len 1 3e-57
209551530 1183 double-strand break repair helicase AddA [Rhizobium leg 1 3e-56
116249792 1183 ATP-dependent UvrD family DNA helicase [Rhizobium legum 1 2e-55
159184128 1185 ATP-dependant DNA helicase [Agrobacterium tumefaciens s 1 2e-55
241206969 1183 double-strand break repair helicase AddA [Rhizobium leg 1 2e-55
86355694 1183 nuclease/helicase protein, ATP dependent [Rhizobium etl 1 2e-54
325291476 1185 ATP-dependent DNA helicase [Agrobacterium sp. H13-3] Le 1 3e-54
>gi|315122046|ref|YP_004062535.1| double-strand break repair helicase AddA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 1179 Back     alignment and organism information
 Score =  290 bits (743), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 185/218 (84%)

Query: 1   MIYHNSFQEHSETIDLISQTKSEQLLASDPTRSAWVSANAGSGKTHILVQRVLRLLLANA 60
           M++ NS Q +S   D I+ TKS+QLLASDPTRSAWVSANAGSGKTHILVQRVLRLLL+ A
Sbjct: 1   MMHLNSSQNNSNITDWITWTKSQQLLASDPTRSAWVSANAGSGKTHILVQRVLRLLLSGA 60

Query: 61  HPSTLLCLTHTKAAAAEMSHRVLEIITAWSHLSDEILSAEITKIQGKKPNKSDMSKARHL 120
           +PS LLCLTHTK AAAEMSHRV EIIT WSHLSDE LS EITKIQG K N+SD+SKAR L
Sbjct: 61  NPSALLCLTHTKEAAAEMSHRVFEIITEWSHLSDEQLSVEITKIQGIKQNESDISKARLL 120

Query: 121 LITILETPGGLKVQTIHAFCEAIMQQFPLEANITSHFAIADEEQSKKLIEEAKKSTLASI 180
           L+ ILETP GLKVQTIH+FCE++++QFPLE+NIT  F++ D +QSKK IEEAKKST+ASI
Sbjct: 121 LVKILETPNGLKVQTIHSFCESLIRQFPLESNITGDFSVLDGDQSKKPIEEAKKSTIASI 180

Query: 181 MLDNNEELKKAFYEILEISNDEDIETLISDIISNRTAL 218
           +LD+N E K+AF +IL   ND ++E L+SDIISNR+AL
Sbjct: 181 LLDDNVEFKQAFDDILNSYNDINLEDLMSDIISNRSAL 218


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218682571|ref|ZP_03530172.1| ATP-dependent UvrD family DNA helicase [Rhizobium etli CIAT 894] Length = 415 Back     alignment and organism information
>gi|222084227|ref|YP_002542753.1| double-strand break repair helicase AddA [Agrobacterium radiobacter K84] Length = 1188 Back     alignment and organism information
>gi|222147062|ref|YP_002548019.1| ATP-dependant DNA helicase [Agrobacterium vitis S4] Length = 1182 Back     alignment and organism information
>gi|209551530|ref|YP_002283447.1| double-strand break repair helicase AddA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 1183 Back     alignment and organism information
>gi|116249792|ref|YP_765630.1| ATP-dependent UvrD family DNA helicase [Rhizobium leguminosarum bv. viciae 3841] Length = 1183 Back     alignment and organism information
>gi|159184128|ref|NP_353063.2| ATP-dependant DNA helicase [Agrobacterium tumefaciens str. C58] Length = 1185 Back     alignment and organism information
>gi|241206969|ref|YP_002978065.1| double-strand break repair helicase AddA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 1183 Back     alignment and organism information
>gi|86355694|ref|YP_467586.1| nuclease/helicase protein, ATP dependent [Rhizobium etli CFN 42] Length = 1183 Back     alignment and organism information
>gi|325291476|ref|YP_004277340.1| ATP-dependent DNA helicase [Agrobacterium sp. H13-3] Length = 1185 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target242
TIGR02784 1141 TIGR02784, addA_alphas, double-strand break repair heli 5e-61
TIGR02785 1232 TIGR02785, addA_Gpos, recombination helicase AddA, Firm 2e-15
pfam00580 494 pfam00580, UvrD-helicase, UvrD/REP helicase 7e-15
PRK13909 910 PRK13909, PRK13909, putative recombination protein RecB 3e-14
COG0210 655 COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA 1e-10
COG1074 1139 COG1074, RecB, ATP-dependent exoDNAse (exonuclease V) b 3e-32
TIGR00609 1087 TIGR00609, recB, exodeoxyribonuclease V, beta subunit 5e-08
TIGR01075 715 TIGR01075, uvrD, DNA helicase II 1e-07
TIGR01074 664 TIGR01074, rep, ATP-dependent DNA helicase Rep 0.001
PRK11773 721 PRK11773, uvrD, DNA-dependent helicase II; Provisional 8e-07
TIGR01073 726 TIGR01073, pcrA, ATP-dependent DNA helicase PcrA 4e-05
PRK11054 684 PRK11054, helD, DNA helicase IV; Provisional 5e-04
>gnl|CDD|163018 TIGR02784, addA_alphas, double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>gnl|CDD|163019 TIGR02785, addA_Gpos, recombination helicase AddA, Firmicutes type Back     alignment and domain information
>gnl|CDD|144246 pfam00580, UvrD-helicase, UvrD/REP helicase Back     alignment and domain information
>gnl|CDD|184388 PRK13909, PRK13909, putative recombination protein RecB; Provisional Back     alignment and domain information
>gnl|CDD|30559 COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31272 COG1074, RecB, ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|161956 TIGR00609, recB, exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>gnl|CDD|130147 TIGR01075, uvrD, DNA helicase II Back     alignment and domain information
>gnl|CDD|130146 TIGR01074, rep, ATP-dependent DNA helicase Rep Back     alignment and domain information
>gnl|CDD|183307 PRK11773, uvrD, DNA-dependent helicase II; Provisional Back     alignment and domain information
>gnl|CDD|162191 TIGR01073, pcrA, ATP-dependent DNA helicase PcrA Back     alignment and domain information
>gnl|CDD|182930 PRK11054, helD, DNA helicase IV; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 242
TIGR02784 1190 addA_alphas double-strand break repair helicase AddA; I 100.0
TIGR02785 1295 addA_Gpos recombination helicase AddA; InterPro: IPR014 100.0
TIGR01073 811 pcrA ATP-dependent DNA helicase PcrA; InterPro: IPR0057 100.0
TIGR01075 741 uvrD DNA helicase II; InterPro: IPR005753 The SOS respo 99.98
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 93.55
PRK11773 722 uvrD DNA-dependent helicase II; Provisional 100.0
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 99.97
TIGR01074 677 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 99.97
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta subuni 99.96
PRK13909 911 putative recombination protein RecB; Provisional 99.96
pfam00580 494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 99.96
PRK10876 1181 recB exonuclease V subunit beta; Provisional 99.95
PRK11054 684 helD DNA helicase IV; Provisional 99.93
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA replicati 99.93
TIGR00609 1324 recB exodeoxyribonuclease V, beta subunit; InterPro: IP 99.91
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 98.62
PRK09694 878 hypothetical protein; Provisional 97.46
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 97.32
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 97.31
smart00487201 DEXDc DEAD-like helicases superfamily. 97.06
TIGR02746 900 TraC-F-type type-IV secretion system protein TraC; Inte 91.55
KOG2108 853 consensus 99.12
KOG1803 649 consensus 99.03
COG3973 747 Superfamily I DNA and RNA helicases [General function p 98.43
PRK10875 607 recD exonuclease V subunit alpha; Provisional 98.31
KOG1805 1100 consensus 98.3
KOG1802 935 consensus 97.97
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 97.61
COG3972 660 Superfamily I DNA and RNA helicases [General function p 97.48
KOG1807 1025 consensus 97.32
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 97.28
pfam04851103 ResIII Type III restriction enzyme, res subunit. 97.16
PRK13709 1756 conjugal transfer nickase/helicase TraI; Provisional 97.16
PRK13826 1102 Dtr system oriT relaxase; Provisional 97.11
PRK13889 992 conjugal transfer relaxase TraA; Provisional 97.06
PRK13767 878 ATP-dependent helicase; Provisional 97.0
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 96.94
PRK00149447 dnaA chromosomal replication initiation protein; Review 96.9
PRK11776 459 ATP-dependent RNA helicase DbpA; Provisional 96.8
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 96.46
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 96.44
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 96.3
PRK05580 699 primosome assembly protein PriA; Validated 96.29
TIGR02768 888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 96.28
PRK10590 457 ATP-dependent RNA helicase RhlE; Provisional 96.2
PRK04328250 hypothetical protein; Provisional 96.12
TIGR00376 709 TIGR00376 DNA helicase, putative; InterPro: IPR004483 E 96.07
PRK11192 417 ATP-dependent RNA helicase SrmB; Provisional 96.03
PRK08116262 hypothetical protein; Validated 96.01
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 96.01
PRK01297 472 ATP-dependent RNA helicase RhlB; Provisional 95.95
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 95.91
PRK02362 736 ski2-like helicase; Provisional 95.88
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 95.84
PRK13833323 conjugal transfer protein TrbB; Provisional 95.84
smart00489289 DEXDc3 DEAD-like helicases superfamily. 95.8
smart00488289 DEXDc2 DEAD-like helicases superfamily. 95.8
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 95.77
PRK06067241 flagellar accessory protein FlaH; Validated 95.75
PRK09302 501 circadian clock protein KaiC; Reviewed 95.75
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Transcript 95.72
TIGR01970 858 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IP 95.71
COG1198 730 PriA Primosomal protein N' (replication factor Y) - sup 95.7
COG1204 766 Superfamily II helicase [General function prediction on 95.69
PRK09302501 circadian clock protein KaiC; Reviewed 95.68
TIGR02760 2193 TraI_TIGR conjugative transfer relaxase protein TraI; I 95.64
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 95.64
PRK01172 674 ski2-like helicase; Provisional 95.62
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 95.59
KOG0338 691 consensus 95.56
KOG0350 620 consensus 95.54
PRK13894320 conjugal transfer ATPase TrbB; Provisional 95.51
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 95.43
PRK13851343 type IV secretion system protein VirB11; Provisional 95.41
PRK04537 574 ATP-dependent RNA helicase RhlB; Provisional 95.41
COG4098 441 comFA Superfamily II DNA/RNA helicase required for DNA 95.4
PRK09401 1176 reverse gyrase; Reviewed 95.4
COG4581 1041 Superfamily II RNA helicase [DNA replication, recombina 95.38
pfam06745231 KaiC KaiC. This family represents a conserved region wi 95.37
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 95.36
PRK08074 932 bifunctional ATP-dependent DNA helicase/DNA polymerase 95.34
KOG0952 1230 consensus 95.29
PRK10536262 hypothetical protein; Provisional 95.29
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 95.28
PRK07952242 DNA replication protein DnaC; Validated 95.26
PRK13342 417 recombination factor protein RarA; Reviewed 95.25
CHL00176 631 ftsH cell division protein; Validated 95.16
pfam00308219 Bac_DnaA Bacterial dnaA protein. 95.05
PRK06526254 transposase; Provisional 95.04
KOG0330 476 consensus 95.0
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 94.99
KOG0733 802 consensus 94.98
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 94.91
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 94.88
COG1484254 DnaC DNA replication protein [DNA replication, recombin 94.84
KOG0328 400 consensus 94.84
COG1205 851 Distinct helicase family with a unique C-terminal domai 94.82
PRK12377248 putative replication protein; Provisional 94.81
PRK08181269 transposase; Validated 94.8
PRK13766 764 Hef nuclease; Provisional 94.79
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 94.78
PRK00254 717 ski2-like helicase; Provisional 94.76
COG0507 696 RecD ATP-dependent exoDNAse (exonuclease V), alpha subu 94.69
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 94.66
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 94.57
PRK08533230 flagellar accessory protein FlaH; Reviewed 94.56
PRK06835330 DNA replication protein DnaC; Validated 94.55
PRK09183258 transposase/IS protein; Provisional 94.51
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 94.46
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 94.4
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 94.37
KOG0345 567 consensus 94.35
PRK06921265 hypothetical protein; Provisional 94.29
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intracell 94.25
PRK05298 657 excinuclease ABC subunit B; Provisional 94.19
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 94.1
PRK13900332 type IV secretion system ATPase VirB11; Provisional 94.08
TIGR00643 721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 93.99
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 93.91
PRK10416499 cell division protein FtsY; Provisional 93.85
KOG0989346 consensus 93.77
PTZ00110 602 helicase; Provisional 93.76
KOG0920 924 consensus 93.71
pfam02399 829 Herpes_ori_bp Origin of replication binding protein. Th 93.66
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 93.59
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 93.54
KOG0741744 consensus 93.43
COG1199 654 DinG Rad3-related DNA helicases [Transcription / DNA re 93.43
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 93.42
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 93.4
KOG0924 1042 consensus 93.4
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 93.35
COG0556 663 UvrB Helicase subunit of the DNA excision repair comple 93.34
PRK08084235 DNA replication initiation factor; Provisional 93.32
KOG0744423 consensus 93.25
KOG0327 397 consensus 93.13
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 93.13
PRK10867 453 signal recognition particle protein; Provisional 93.09
COG4096 875 HsdR Type I site-specific restriction-modification syst 93.08
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 92.94
PRK13341 726 recombination factor protein RarA/unknown domain fusion 92.69
PRK09862506 putative ATP-dependent protease; Provisional 92.68
COG0714329 MoxR-like ATPases [General function prediction only] 92.59
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 92.53
KOG0922 674 consensus 92.49
KOG0923 902 consensus 92.1
KOG1131 755 consensus 92.04
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 91.89
KOG0951 1674 consensus 91.85
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 91.84
KOG0925 699 consensus 91.81
KOG0354 746 consensus 91.68
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polymerase 91.55
cd01394218 radB RadB. The archaeal protein radB shares similarity 91.55
CHL00195491 ycf46 Ycf46; Provisional 91.49
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 91.1
PHA02244383 ATPase-like protein 91.04
KOG1806 1320 consensus 90.89
pfam00006213 ATP-synt_ab ATP synthase alpha/beta family, nucleotide- 90.88
TIGR00959 439 ffh signal recognition particle protein; InterPro: IPR0 90.87
COG1200 677 RecG RecG-like helicase [DNA replication, recombination 90.65
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 90.58
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 90.51
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 90.33
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 90.31
KOG0340 442 consensus 90.15
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 97.09
PRK04863 1486 mukB cell division protein MukB; Provisional 95.71
TIGR00631 667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 95.63
KOG0731 774 consensus 95.4
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 94.73
PRK08506473 replicative DNA helicase; Provisional 94.63
KOG0734 752 consensus 93.96
KOG0727408 consensus 93.19
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 92.56
KOG0738491 consensus 92.01
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 96.77
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 96.24
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 95.99
pfam05970 418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 95.93
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 95.92
pfam10412 386 TrwB_AAD_bind Type IV secretion-system coupling protein 95.8
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 95.72
PRK10436461 hypothetical protein; Provisional 95.62
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 95.52
COG2805353 PilT Tfp pilus assembly protein, pilus retraction ATPas 95.46
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 95.41
PRK13768253 GTPase; Provisional 95.38
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 95.35
cd01127 410 TrwB Bacterial conjugation protein TrwB, ATP binding do 95.35
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 95.33
smart00382148 AAA ATPases associated with a variety of cellular activ 95.07
PRK04841 903 transcriptional regulator MalT; Provisional 95.03
CHL00181287 cbbX CbbX; Provisional 94.8
PRK13407334 bchI magnesium chelatase subunit I; Provisional 94.77
PRK00411 394 cdc6 cell division control protein 6; Reviewed 94.65
KOG0991333 consensus 94.51
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.43
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 94.23
PRK04195 403 replication factor C large subunit; Provisional 94.21
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 94.19
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 94.08
PRK03992390 proteasome-activating nucleotidase; Provisional 93.97
CHL00081 347 chlI Mg-protoporyphyrin IX chelatase 93.95
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial con 93.94
pfam01443226 Viral_helicase1 Viral (Superfamily 1) RNA helicase. Hel 93.83
PRK12608379 transcription termination factor Rho; Provisional 93.83
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 93.65
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 93.63
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 93.62
COG5635 824 Predicted NTPase (NACHT family) [Signal transduction me 93.58
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 93.51
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 93.49
PRK06696227 uridine kinase; Validated 93.48
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 93.18
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 93.17
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 93.15
PRK09270230 frcK putative fructose transport system kinase; Reviewe 93.12
KOG1532 366 consensus 93.0
pfam10236274 DAP3 Mitochondrial ribosomal death-associated protein 3 92.99
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 92.93
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 92.85
PRK02496185 adk adenylate kinase; Provisional 92.76
PRK00440318 rfc replication factor C small subunit; Reviewed 92.74
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 92.65
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 92.57
PRK06761281 hypothetical protein; Provisional 92.5
TIGR00606 1328 rad50 rad50; InterPro: IPR004584 Rad50 is involved in r 92.47
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 92.42
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 92.42
PRK12422 455 chromosomal replication initiation protein; Provisional 92.3
PRK00279215 adk adenylate kinase; Reviewed 92.28
PRK09376416 rho transcription termination factor Rho; Provisional 92.26
TIGR01359189 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006 92.23
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell moti 92.21
pfam07726131 AAA_3 ATPase family associated with various cellular ac 92.2
PRK13765 637 ATP-dependent protease Lon; Provisional 91.96
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 91.95
KOG1533290 consensus 91.85
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 91.55
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 91.53
pfam02534 468 TraG TraG/TraD family. These proteins contain a P-loop 91.5
cd01128249 rho_factor Transcription termination factor rho is a ba 91.43
PRK04040189 adenylate kinase; Provisional 91.42
PRK08903227 hypothetical protein; Validated 91.41
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 91.4
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 91.35
PRK13721 864 conjugal transfer ATP-binding protein TraC; Provisional 91.32
COG2909 894 MalT ATP-dependent transcriptional regulator [Transcrip 91.28
pfam04466 387 Terminase_3 Phage terminase large subunit. Initiation o 91.27
PRK13764 605 ATPase; Provisional 91.14
PRK12402337 replication factor C small subunit 2; Reviewed 91.1
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of this 91.1
PRK13946195 shikimate kinase; Provisional 91.09
PRK08939306 primosomal protein DnaI; Reviewed 91.05
PRK06893229 DNA replication initiation factor; Validated 91.03
KOG3079195 consensus 90.95
PTZ00301210 uridine kinase; Provisional 90.87
PRK06620214 hypothetical protein; Validated 90.81
pfam01935218 DUF87 Domain of unknown function DUF87. The function of 90.79
COG0630312 VirB11 Type IV secretory pathway, VirB11 components, an 90.73
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 90.72
COG3911183 Predicted ATPase [General function prediction only] 90.71
pfam04310227 MukB MukB N-terminal. This family represents the N-term 90.66
PRK08727233 hypothetical protein; Validated 90.66
pfam03266168 DUF265 Protein of unknown function, DUF265. 90.6
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 90.56
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 90.46
PTZ00088225 adenylate kinase 1; Provisional 90.46
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 90.42
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 90.35
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 90.31
TIGR02546430 III_secr_ATP type III secretion apparatus H+-transporti 90.25
PRK11608325 pspF phage shock protein operon transcriptional activat 90.24
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 90.09
pfam06068 395 TIP49 TIP49 C-terminus. This family consists of the C-t 90.04
PRK06851 368 hypothetical protein; Provisional 90.02
pfam07652146 Flavi_DEAD Flavivirus DEAD domain. 96.25
cd01124187 KaiC KaiC is a circadian clock protein primarily found 96.15
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.03
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 95.84
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 95.34
pfam09848 348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 94.9
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.59
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 94.53
pfam00004131 AAA ATPase family associated with various cellular acti 94.46
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 94.15
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 93.9
PRK00771 433 signal recognition particle protein Srp54; Provisional 93.28
pfam05876 552 Terminase_GpA Phage terminase large subunit (GpA). This 93.05
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transport an 92.92
pfam03237 380 Terminase_6 Terminase-like family. This family represen 92.65
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 92.64
PRK13974212 thymidylate kinase; Provisional 92.28
TIGR01425 453 SRP54_euk signal recognition particle protein SRP54; In 92.09
PRK08118167 topology modulation protein; Reviewed 91.96
KOG0741 744 consensus 91.83
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanisms] 91.67
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 91.64
PRK07261171 topology modulation protein; Provisional 91.61
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 90.6
TIGR01587 424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 95.63
>TIGR02784 addA_alphas double-strand break repair helicase AddA; InterPro: IPR014151 AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA; InterPro: IPR014152 AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA; InterPro: IPR005751 The DNA helicase PcrA is found mainly in Gram-positive bacteria and belongs to a superfamily of helicases, together with Rep and UvrD helicases from Escherichia coli Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II; InterPro: IPR005753 The SOS response is required for efficient nucleotide excision repair (NER) of the major ultraviolet light (UV) induced DNA lesions Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K; InterPro: IPR014232 Proteins in this entry include the stage V sporulation protein K (SpoVK), a close homologue of the Rubisco expression protein CbbX (IPR000470 from INTERPRO), and are members of an ATPase family associated with various cellular activities Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 RepA hexameric DNA helicase contain ATP-binding domains similar to those seen in monomeric helicases but which are arranged in a ring Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>pfam00580 UvrD-helicase UvrD/REP helicase Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit; InterPro: IPR004586 Exodeoxyribonuclease V, or RecBCD holoenzyme, (3 Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit; InterPro: IPR006344 This family describes the exodeoxyribonuclease V alpha subunit, RecD Back     alignment and domain information
>PRK09694 hypothetical protein; Provisional Back     alignment and domain information
>pfam00270 DEAD DEAD/DEAH box helicase Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR02746 TraC-F-type type-IV secretion system protein TraC; InterPro: IPR014117 The proteins in this entry are found in the F, P and I-like type IV secretion systems Back     alignment and domain information
>KOG2108 consensus Back     alignment and domain information
>KOG1803 consensus Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG1805 consensus Back     alignment and domain information
>KOG1802 consensus Back     alignment and domain information
>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345 These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>KOG1807 consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>pfam04851 ResIII Type III restriction enzyme, res subunit Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB; InterPro: IPR014149 This entry represents TrbB, a protein, which is encoded in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>pfam02562 PhoH PhoH-like protein Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA; InterPro: IPR014136 This entry represents the Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00376 TIGR00376 DNA helicase, putative; InterPro: IPR004483 Eukaryotic members of this family have been characterised as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT) Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR014155 This entry contains VirB11, a protein that is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IPR010225 This entry represents HrpB, one of two related predicted DEAH-box ATP-dependent helicases of unknown function found in many proteobacteria, but also in a few species of other lineages Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI; InterPro: IPR014129 This entry represents TraI, which is a component of the relaxosome complex Back     alignment and domain information
>pfam03796 DnaB_C DnaB-like helicase C terminal domain Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0338 consensus Back     alignment and domain information
>KOG0350 consensus Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam06745 KaiC KaiC Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0952 consensus Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>pfam00308 Bac_DnaA Bacterial dnaA protein Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0330 consensus Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>KOG0733 consensus Back     alignment and domain information
>TIGR00368 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 This family of bacterial proteins are variously described as 'hypothetical protein yifB', 'competence protein', 'hypothetical protein' or 'Mg chelatase-related protein' Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0328 consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>pfam01695 IstB IstB-like ATP binding protein Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0345 consensus Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB; InterPro: IPR004392 The hydrogenase accessory protein HypB is a GTP hydrolase for assembly of nickel metallocentre of hydrogenase Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG; InterPro: IPR004609 The ATP-dependent DNA helicase RecG 3 Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10416 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG0989 consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0920 consensus Back     alignment and domain information
>pfam02399 Herpes_ori_bp Origin of replication binding protein Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0741 consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family; InterPro: IPR005937 Intracellular proteins, including short-lived proteins such as cyclin, Mos, Myc, p53, NF-kappaB, and IkappaB, are degraded by the ubiquitin-proteasome system Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0924 consensus Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>KOG0744 consensus Back     alignment and domain information
>KOG0327 consensus Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>pfam01078 Mg_chelatase Magnesium chelatase, subunit ChlI Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0922 consensus Back     alignment and domain information
>KOG0923 consensus Back     alignment and domain information
>KOG1131 consensus Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>KOG0951 consensus Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>KOG0925 consensus Back     alignment and domain information
>KOG0354 consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>KOG1806 consensus Back     alignment and domain information
>pfam00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein; InterPro: IPR004780 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IPR010222 This entry represents HrpA, one of two related but uncharacterised DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria Back     alignment and domain information
>KOG0340 consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 All proteins in this family for which functions are known are DNA helicases that function in the nucleotide excision repair and are endonucleases that make the 3' incision next to DNA damage Back     alignment and domain information
>KOG0731 consensus Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: IPR005936 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG0734 consensus Back     alignment and domain information
>KOG0727 consensus Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus Back     alignment and domain information
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321 These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway) Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892 Proteins in this family are believed to be cytidylate kinase Back     alignment and domain information
>pfam00437 GSPII_E Type II/IV secretion system protein Back     alignment and domain information
>pfam05970 DUF889 PIF1 helicase Back     alignment and domain information
>pfam06414 Zeta_toxin Zeta toxin Back     alignment and domain information
>pfam10412 TrwB_AAD_bind Type IV secretion-system coupling protein DNA-binding domain Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E; InterPro: IPR013369 GspE, the E protein of the type II secretion system, is also referred to as the main terminal branch of the general secretion pathway Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>pfam05729 NACHT NACHT domain Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG0991 consensus Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>pfam07728 AAA_5 AAA domain (dynein-related subfamily) Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>pfam01443 Viral_helicase1 Viral (Superfamily 1) RNA helicase Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>pfam03029 ATP_bind_1 Conserved hypothetical ATP binding protein Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>pfam01580 FtsK_SpoIIIE FtsK/SpoIIIE family Back     alignment and domain information
>COG5635 Predicted NTPase (NACHT family) [Signal transduction mechanisms] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24; InterPro: IPR004582 To be effective as a mechanism that preserves genomic integrity, the DNA damage checkpoint must be extremely sensitive in its ability to detect DNA damage Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK09270 frcK putative fructose transport system kinase; Reviewed Back     alignment and domain information
>KOG1532 consensus Back     alignment and domain information
>pfam10236 DAP3 Mitochondrial ribosomal death-associated protein 3 Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>pfam03215 Rad17 Rad17 cell cycle checkpoint protein Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA; InterPro: IPR014217 Proteins in this entry include the stage III sporulation protein AA that is encoded by one of several genes in the spoIIIA locus Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50; InterPro: IPR004584 Rad50 is involved in recombination, recombinational repair, and/or non-homologous end joining Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB; InterPro: IPR011939 This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA, eukaryotic RAD51 (IPR011941 from INTERPRO) and DMC1 (IPR011940 from INTERPRO), and archaeal RadA (IPR011938 from INTERPRO) ,, Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family; InterPro: IPR006266 This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>pfam07726 AAA_3 ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>KOG1533 consensus Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam02534 TraG TraG/TraD family Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK08903 hypothetical protein; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family; InterPro: IPR014324 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>pfam04466 Terminase_3 Phage terminase large subunit Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG3079 consensus Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>pfam01935 DUF87 Domain of unknown function DUF87 Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>COG3911 Predicted ATPase [General function prediction only] Back     alignment and domain information
>pfam04310 MukB MukB N-terminal Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>pfam03266 DUF265 Protein of unknow