HHsearch alignment for GI: peg_409 and conserved domain: COG1204

>COG1204 Superfamily II helicase [General function prediction only].
Probab=95.69  E-value=0.026  Score=35.98  Aligned_cols=77  Identities=22%  Similarity=0.191  Sum_probs=58.2

Q ss_pred             CHHHHHHHHHHHHHCCCHHHHHHHC--C-CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             0078888897323509489999827--6-888799848889967999999999982478988956677687899999999
Q 537021.9.peg.4    5 NSFQEHSETIDLISQTKSEQLLASD--P-TRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHR   81 (242)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~qq~~a~~--~-~~~~lV~A~aGSGKT~tL~~rv~~ll~~g~~P~~IL~lTFT~kAA~El~~R   81 (242)
T Consensus        18 ~~v~~i~~~~~~~el~~~qq~av~~~~~~~~N~li~aPTgsGKTlIA~lai~~~l~~~--~~k~vYivPlkALa~Ek~~~   95 (766)
T COG1204          18 DRVLEILKGDGIDELFNPQQEAVEKGLLSDENVLISAPTGSGKTLIALLAILSTLLEG--GGKVVYIVPLKALAEEKYEE   95 (766)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHC--CCCEEEEECHHHHHHHHHHH
T ss_conf             7899886048847755789987411125798679976788866999999999999855--98389990759999999998


Q ss_pred             HH
Q ss_conf             99
Q 537021.9.peg.4   82 VL   83 (242)
Q Consensus        82 I~   83 (242)
T Consensus        96 ~~   97 (766)
T COG1204          96 FS   97 (766)
T ss_pred             HH
T ss_conf             66