>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA; InterPro: IPR014136 This entry represents the Ti-type conjugative transfer relaxase TraA. TraA contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, IPR005053 from INTERPRO) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, IPR014129 from INTERPRO). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer ..

Probab=96.28 E-value=0.0072 Score=39.94 Aligned_cols=61 Identities=16% Similarity=0.117 Sum_probs=42.8 Q ss_pred HCCC-HHHHHHHCC---CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH Q ss_conf 5094-899998276---888799848889967999999999982478988956677687899999999 Q 537021.9.peg.4 18 SQTK-SEQLLASDP---TRSAWVSANAGSGKTHILVQRVLRLLLANAHPSTLLCLTHTKAAAAEMSHR 81 (242) Q Consensus 18 ~~~~-~qq~~a~~~---~~~~lV~A~aGSGKT~tL~~rv~~ll~~g~~P~~IL~lTFT~kAA~El~~R 81 (242) T Consensus 413 ~rLs~EQ~~Av~hvt~s~~iavVvG~AGtGKSt~L~aAR~AWe~~G---y~V~GAALsGKAAegLe~~ 477 (888) T TIGR02768 413 ERLSEEQKEAVRHVTGSGDIAVVVGRAGTGKSTMLKAAREAWEAAG---YRVIGAALSGKAAEGLEAE 477 (888) T ss_pred CCCHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCC---CEEEEHHHHHHHHHHHHCC T ss_conf 7745899999875328996489974899876678999999998739---7787154555898873002

HHsearch alignment for GI: peg_409 and conserved domain: TIGR02768