HHsearch alignment for GI: peg_409 and conserved domain: pfam10412

>pfam10412 TrwB_AAD_bind Type IV secretion-system coupling protein DNA-binding domain. The plasmid conjugative coupling protein TrwB forms hexamers from six structurally very similar protomers. This hexamer contains a central channel running from the cytosolic pole (made up by the AADs) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB_AAD (all-alpha domain) domain appears to be the DNA-binding domain of the structure. TrwB, a basic integral inner-membrane nucleoside-triphosphate-binding protein, is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells and export.
Probab=95.80  E-value=0.012  Score=38.26  Aligned_cols=31  Identities=19%  Similarity=0.290  Sum_probs=24.6

Q ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
Q ss_conf             7688879984888996799999999998247
Q 537021.9.peg.4   29 DPTRSAWVSANAGSGKTHILVQRVLRLLLAN   59 (242)
Q Consensus        29 ~~~~~~lV~A~aGSGKT~tL~~rv~~ll~~g   59 (242)
T Consensus        13 ~~~~H~lviG~tGsGKT~~i~~~i~~~~~~~   43 (386)
T pfam10412        13 SETQHILIVGTTGTGKTQALRELLDQIRARG   43 (386)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             7767589988999988879999999999779