BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.414_1 (45 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.414_1 Length = 45 Score = 91.3 bits (225), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 45/45 (100%), Positives = 45/45 (100%) Query: 1 LSEGYYPCKVNLENGELNCIFEFQFVILKKLFDIFGNLRIMGKYL 45 LSEGYYPCKVNLENGELNCIFEFQFVILKKLFDIFGNLRIMGKYL Sbjct: 1 LSEGYYPCKVNLENGELNCIFEFQFVILKKLFDIFGNLRIMGKYL 45 >gi|254780332|ref|YP_003064745.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62] Length = 504 Score = 21.2 bits (43), Expect = 3.9, Method: Composition-based stats. Identities = 9/17 (52%), Positives = 12/17 (70%) Query: 27 ILKKLFDIFGNLRIMGK 43 I +K+F+I G L MGK Sbjct: 60 IHQKIFEIMGKLVHMGK 76 >gi|254780493|ref|YP_003064906.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 323 Score = 21.2 bits (43), Expect = 4.0, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 8 CKVNLENGELNCIFEFQFVILKK 30 CK+ LENG + +++F I KK Sbjct: 189 CKLALENGLILVDSKYEFGIDKK 211 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.330 0.153 0.475 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,423 Number of Sequences: 1233 Number of extensions: 744 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 45 length of database: 328,796 effective HSP length: 18 effective length of query: 27 effective length of database: 306,602 effective search space: 8278254 effective search space used: 8278254 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 31 (16.5 bits)