HHsearch alignment for GI: peg_42 and conserved domain: PRK00831

>PRK00831 rpmJ 50S ribosomal protein L36; Validated.
Probab=99.88  E-value=2.5e-23  Score=138.21  Aligned_cols=41  Identities=61%  Similarity=0.929  Sum_probs=40.7

Q ss_pred             EEEHHHHHHHHHCCCCCEEEEECCEEEEEECCCCCHHHCCC
Q ss_conf             97458899885016787099988889999877975232079
Q 537021.9.peg.4    4 VKVRNSLRVLKLRHRGNKVVRRKNVIRIVNKLNPRFKVRQG   44 (44)
Q Consensus         4 MKvr~Slk~lk~r~~~c~~VrRkGrvyVick~nPrhK~RQG   44 (44)
T Consensus         1 MKV~sSlKs~k~r~~~c~vVrRrGr~yVInK~nPr~KaRQG   41 (41)
T PRK00831          1 MKVRNSLKSLKNRHRDCQIVRRKGRVYVINKKNPRFKARQG   41 (41)
T ss_pred             CCHHHHHHHHHHHCCCCEEEEECCEEEEEECCCCCHHHCCC
T ss_conf             94688899998637786599862539999679942342069