HHsearch alignment of GI: peg_42 and MMDB domain: 2zjr_4_

>2zjr_4 (4:) 50S ribosomal protein L36; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans}
Probab=99.63  E-value=9.2e-18  Score=109.96  Aligned_cols=37  Identities=38%  Similarity=0.519  Sum_probs=35.0

Q ss_pred             EEEHHHHHHHHHCCCCCEEEEECCEEEEEECCCCCHHHCCC
Q ss_conf             97458899885016787099988889999877975232079
Q 537021.9.peg.4    4 VKVRNSLRVLKLRHRGNKVVRRKNVIRIVNKLNPRFKVRQG   44 (44)
Q Consensus         4 MKvr~Slk~lk~r~~~c~~VrRkGrvyVick~nPrhK~RQG   44 (44)
                      |||++|+|++|+   +|++|||+|++||||+ ||+||||||
T Consensus         1 mKVr~svKk~C~---~C~~irR~g~v~ViC~-nPkHKQRQG   37 (37)
T 2zjr_4            1 MKVRSSVKKMCD---NCKVVRRHGRVLVICS-NVKHKQRQG   37 (37)
T ss_dssp             CEECSSCCCCST---TCCCEECSSCEEECCS-SSTTCEECC
T ss_pred             CCCCHHHHHHCC---CCCEEEECCEEEEEEC-CCCCCCCCC
T ss_conf             961234353266---8609986788999929-997433479