HHsearch results for GI: peg_42 and protein with PDBid: 3bbo_6

>3bbo_6 Ribosomal protein L36; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} SCOP: i.1.1.1
Probab=99.79  E-value=3.5e-21  Score=126.35  Aligned_cols=38  Identities=34%  Similarity=0.507  Sum_probs=36.2

Q ss_pred             EEEHHHHHHHHHCCCCCEEEEECCEEEEEECCCCCHHHCCC
Q ss_conf             97458899885016787099988889999877975232079
Q 537021.9.peg.4    4 VKVRNSLRVLKLRHRGNKVVRRKNVIRIVNKLNPRFKVRQG   44 (44)
Q Consensus         4 MKvr~Slk~lk~r~~~c~~VrRkGrvyVick~nPrhK~RQG   44 (44)
                      |||++|||+   ||++|++|||+||+|||||+|||||||||
T Consensus         1 MKVrsSvKk---rC~~C~vVRR~GrvyViCk~nPRHKQRQG   38 (104)
T 3bbo_6            1 MKVRSSVKK---MCEFCKTVKRRGRVYVICSSNPKHKQRQG   38 (104)
T ss_dssp             CBCCSCCCC---CSTTBCCEEETTEEEBCBSSCGGGCBCCC
T ss_pred             CCCCHHHHH---HCCCCEEEEECCEEEEEECCCCCHHHHCC
T ss_conf             971056675---06687399878989998189974543247