BLAST/PSIBLAST alignment of GI: peg_42 and GI: 15966540 at iteration 1
>gi|15966540|ref|NP_386893.1| 50S ribosomal protein L36 [Sinorhizobium meliloti 1021] Length = 41
>gi|150397872|ref|YP_001328339.1| 50S ribosomal protein L36 [Sinorhizobium medicae WSM419] Length = 41
>gi|307300423|ref|ZP_07580203.1| ribosomal protein L36 [Sinorhizobium meliloti BL225C] Length = 41
>gi|307318288|ref|ZP_07597723.1| ribosomal protein L36 [Sinorhizobium meliloti AK83] Length = 41
>gi|24212257|sp|Q92M65|RL36_RHIME RecName: Full=50S ribosomal protein L36 Length = 41
>gi|166233076|sp|A6UCX4|RL36_SINMW RecName: Full=50S ribosomal protein L36 Length = 41
>gi|15075811|emb|CAC47366.1| Probable 50S ribosomal protein L36 [Sinorhizobium meliloti 1021] Length = 41
>gi|150029387|gb|ABR61504.1| ribosomal protein L36 [Sinorhizobium medicae WSM419] Length = 41
>gi|306895970|gb|EFN26721.1| ribosomal protein L36 [Sinorhizobium meliloti AK83] Length = 41
>gi|306904589|gb|EFN35173.1| ribosomal protein L36 [Sinorhizobium meliloti BL225C] Length = 41
 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (82%)

Query: 4  VKVRNSLRVLKLRHRGNKVVRRKNVIRIVNKLNPRFKVRQG 44
          +K++NSL+ LK RHR N++VRRK  + I+NKLNPRFK RQG
Sbjct: 1  MKIKNSLKSLKTRHRENRLVRRKGRVYIINKLNPRFKARQG 41