BLAST/PSIBLAST alignment of GI: peg_42 and GI: 304393434 at iteration 1
>gi|304393434|ref|ZP_07375362.1| conserved domain protein [Ahrensia sp. R2A130] Length = 41
>gi|303294441|gb|EFL88813.1| conserved domain protein [Ahrensia sp. R2A130] Length = 41
 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/41 (65%), Positives = 34/41 (82%)

Query: 4  VKVRNSLRVLKLRHRGNKVVRRKNVIRIVNKLNPRFKVRQG 44
          +KV+NSLR LK RHR N++VRRK  + I+NK+NPRFK RQG
Sbjct: 1  MKVKNSLRSLKGRHRANRLVRRKGRVYIINKVNPRFKARQG 41