BLAST/PSIBLAST alignment of GI: peg_42 and GI: 315498558 at iteration 1
>gi|315498558|ref|YP_004087362.1| ribosomal protein l36 [Asticcacaulis excentricus CB 48] Length = 41
>gi|315416570|gb|ADU13211.1| ribosomal protein L36 [Asticcacaulis excentricus CB 48] Length = 41
 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 33/41 (80%)

Query: 4  VKVRNSLRVLKLRHRGNKVVRRKNVIRIVNKLNPRFKVRQG 44
          +KVR+SL+ LK RHR  K+VRRK V+ ++NK +PRFK +QG
Sbjct: 1  MKVRSSLKSLKTRHRDCKIVRRKGVVYVINKTDPRFKAKQG 41