BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.455_1 (37 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.455_1 Length = 37 Score = 72.4 bits (176), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 37/37 (100%), Positives = 37/37 (100%) Query: 1 MKLLAIIIVYFLFEKRKGIICGRLLNMLLEEKSFLSN 37 MKLLAIIIVYFLFEKRKGIICGRLLNMLLEEKSFLSN Sbjct: 1 MKLLAIIIVYFLFEKRKGIICGRLLNMLLEEKSFLSN 37 >gi|254781134|ref|YP_003065547.1| hypothetical protein CLIBASIA_05180 [Candidatus Liberibacter asiaticus str. psy62] Length = 320 Score = 21.2 bits (43), Expect = 3.2, Method: Composition-based stats. Identities = 10/26 (38%), Positives = 16/26 (61%) Query: 12 LFEKRKGIICGRLLNMLLEEKSFLSN 37 L+EKR ++ N LL +K+F+ N Sbjct: 120 LWEKRNMLLISCPKNSLLSDKTFVMN 145 >gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 954 Score = 19.6 bits (39), Expect = 8.9, Method: Composition-based stats. Identities = 8/21 (38%), Positives = 12/21 (57%) Query: 15 KRKGIICGRLLNMLLEEKSFL 35 KRKG +C L ++ + FL Sbjct: 443 KRKGAVCAYLETWHIDVEEFL 463 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.335 0.152 0.423 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,056 Number of Sequences: 1233 Number of extensions: 427 Number of successful extensions: 7 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 5 length of query: 37 length of database: 328,796 effective HSP length: 11 effective length of query: 26 effective length of database: 315,233 effective search space: 8196058 effective search space used: 8196058 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 31 (16.5 bits)