HHsearch alignment for GI: peg_472 and conserved domain: CHL00081

>CHL00081 chlI Mg-protoporyphyrin IX chelatase.
Probab=98.87  E-value=5.5e-08  Score=79.05  Aligned_cols=152  Identities=22%  Similarity=0.322  Sum_probs=95.1

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHH-------CCCCCCCCCCCCCCCCCCHHHHH-HHCC
Q ss_conf             928489999999999828767062010787988889999999996-------14687778866587899977999-9779
Q 537021.9.peg.4    1 MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSL-------NYKTAHIDVPTVEFEGFGEHCQA-IIRG   72 (369)
Q Consensus         1 iiGq~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l-------~c~~~~~~~~~~~~c~~c~~c~~-i~~~   72 (369)
T Consensus        14 IvGQe~~k~aLll~av~p~iGg-VLi~G~~GtgKStlvRala~lLP~i~~v~~~~f~~~p~---~p~~~~~~~~~~~~~~   89 (347)
T CHL00081         14 IVGQEEMKLALLLNVIDPKIGG-VMIMGDRGTGKSTTIRALVDLLPEIEVVKNDPFNSDPR---DPDLMSDEVRERIRNG   89 (347)
T ss_pred             HCCHHHHHHHHHHHHCCCCCCE-EEEECCCCCCHHHHHHHHHHHCCCCEEECCCCCCCCCC---CCCCCCHHHHHHHCCC
T ss_conf             5384999999999825788786-99878998749999999998578742206887678989---8100242666543146


Q ss_pred             CCCC-------CCCC-CCCCC----CCHHHHHHHHHH-HHHHH---HCCCCCEEEEECHHHCCCCHHHHHHHHHHHCCCC
Q ss_conf             8778-------2224-53322----334555665554-45654---2046523775115664800167899999721221
Q 537021.9.peg.4   73 NHVD-------VVEL-DAASH----TSIDDVREIIDQ-IYYKP---ISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPH  136 (369)
Q Consensus        73 ~~~d-------~~e~-~~~s~----~~id~ir~l~~~-~~~~p---~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~  136 (369)
T Consensus        90 ~~~~~~~~~~p~v~lPlgaTEDrv~GslDie~al~~G~~~f~pGlLa~A~rGiLyvDEINll~d~~v~~LLda~a~G-~~  168 (347)
T CHL00081         90 EKIPTKKIKIPMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDILLDSAASG-WN  168 (347)
T ss_pred             CCCCCEECCCCEEECCCCCCCCEECCCHHHHHHHHCCCCCCCCCHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHCC-EE
T ss_conf             66752114686253688885230114000998984587115653122203885886145432379999999998558-08


Q ss_pred             ------------CCEEEEE-CCCC--CCCHHHHHHH
Q ss_conf             ------------1146650-6754--3303567543
Q 537021.9.peg.4  137 ------------VKFIFAT-TEIR--KIPITVLSRC  157 (369)
Q Consensus       137 ------------~~fil~t-~~~~--~ll~TI~SRc  157 (369)
T Consensus       169 ~VEReG~S~~~Pa~F~liaT~NPeEgeLrp~llDRF  204 (347)
T CHL00081        169 TVEREGISIRHPARFVLIGSGNPEEGELRPQLLDRF  204 (347)
T ss_pred             EECCCCEEECCCCCEEEEECCCCCCCCCCHHHHHHE
T ss_conf             980464233057500688557865567488888263