HHsearch alignment for GI: peg_472 and conserved domain: CHL00095

>CHL00095 clpC Clp protease ATP binding subunit.
Probab=99.26  E-value=2.8e-11  Score=103.35  Aligned_cols=182  Identities=24%  Similarity=0.315  Sum_probs=121.0

Q ss_pred             CCCHHHHHHHHHHHHHCCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCC----
Q ss_conf             9284899999999998287670620107879888899999999961468777886658789997799997798778----
Q 537021.9.peg.4    1 MIGQKPMIKTLTNAFKSGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVD----   76 (369)
Q Consensus         1 iiGq~~~~~~l~~~~~~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d----   76 (369)
T Consensus       181 vIGRd~EI~r~i~IL~RR~KNN-piLvGepGVGKTAIvEGLA~rI~------------------------~g~VP~~L~~  235 (823)
T CHL00095        181 VIGRDKEIERVIQILGRRTKNN-PILIGEPGVGKTAIAEGLAQRIA------------------------NRDVPDILED  235 (823)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCC-CEEECCCCCCHHHHHHHHHHHHH------------------------CCCCCHHHCC
T ss_conf             7595699999999997732488-50237999879999999999760------------------------8899868759


Q ss_pred             --CCCCC------CCCCCC-H-HHHHHHHHHHHHHHHCCCCCEEEEECHHHC--------CCCHHHHHHHHHHHCCCCCC
Q ss_conf             --22245------332233-4-555665554456542046523775115664--------80016789999972122111
Q 537021.9.peg.4   77 --VVELD------AASHTS-I-DDVREIIDQIYYKPISARFRVYIMDEVQML--------STAAFNGLLKTLEEPPPHVK  138 (369)
Q Consensus        77 --~~e~~------~~s~~~-i-d~ir~l~~~~~~~p~~~~~kv~iid~a~~m--------~~~a~NaLLK~lEEPp~~~~  138 (369)
T Consensus       236 ~~i~sLDl~~L~AGtkyRGeFEeRlk~il~ei~~~----~~iILFIDEiHtlvGaG~~~g~~DaaNlLKPaLar--Gel~  309 (823)
T CHL00095        236 KLVLTLDIGLLLAGTKYRGEFEERIKKIMDEIKKA----NNIILVIDEIHTLIGAGAAEGAIDAANILKPALAR--GKLQ  309 (823)
T ss_pred             CCEEEEEHHHHHHCCCCCHHHHHHHHHHHHHHHHC----CCEEEEECCHHHHCCCCCCCCCHHHHHHHHHHHHC--CCCE
T ss_conf             93688428877533422267999999999999857----98699973516532889766643178876578648--9866


Q ss_pred             EEEEECCC--CCCC---HHHHHHHHHHHCCCCCCHHHHHHHHHHHH----HCCCCCCHHHHHHHHHCCCCC------CCH
Q ss_conf             46650675--4330---35675433321024540013567876431----013456256644565316764------200
Q 537021.9.peg.4  139 FIFATTEI--RKIP---ITVLSRCQRFDLHRISIGDLIELFTKILQ----EESIEFDPEAVAMIARASDGS------ARD  203 (369)
Q Consensus       139 fil~t~~~--~~ll---~TI~SRcq~~~f~~l~~~~i~~~L~~i~~----~E~i~~d~~~l~~ia~~s~Gs------lR~  203 (369)
T Consensus       310 ~IGATT~~EYrk~iEkD~AL~RRFq~V~V~EPs~e~t~~IL~gl~~~yE~~H~V~i~d~Ai~aav~LS~RYi~dr~LPDK  389 (823)
T CHL00095        310 CIGATTLEEYRKHIEKDPALERRFQPVYVGEPSVEETIEILLGLRDRYEKHHNLSISDKALEAAAKLSDQYIKDRFLPDK  389 (823)
T ss_pred             EEEECCHHHHHHHHHCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCHH
T ss_conf             99707889999985305889962684102899879999999999999987508850478999999987764037778217


Q ss_pred             HHHCCCCCCC
Q ss_conf             1100011100
Q 537021.9.peg.4  204 GLSLLDQAIA  213 (369)
Q Consensus       204 Al~lLeq~i~  213 (369)
T Consensus       390 AIDllDeA~A  399 (823)
T CHL00095        390 AIDLLDEAGS  399 (823)
T ss_pred             HHHHHHHHHH
T ss_conf             8888999989