HHsearch alignment for GI: peg_472 and conserved domain: COG0542

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones].
Probab=98.46  E-value=3.9e-06  Score=65.42  Aligned_cols=135  Identities=21%  Similarity=0.351  Sum_probs=92.3

Q ss_pred             CCCHHHHHHHHHHHHHCCCC--------CEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHC-
Q ss_conf             92848999999999982876--------706201078798888999999999614687778866587899977999977-
Q 537021.9.peg.4    1 MIGQKPMIKTLTNAFKSGRI--------AQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIR-   71 (369)
Q Consensus         1 iiGq~~~~~~l~~~~~~~~~--------~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~-   71 (369)
T Consensus       493 ViGQd~AV~~v~~aIrraRaGL~dp~rPigsFlF~GPTGVGKTELAkaLA~~Lfg~e~ali--R~DM-SEy~EkHsVSrL  569 (786)
T COG0542         493 VIGQDEAVEAVSDAIRRARAGLGDPNRPIGSFLFLGPTGVGKTELAKALAEALFGDEQALI--RIDM-SEYMEKHSVSRL  569 (786)
T ss_pred             EECHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCE--EECH-HHHHHHHHHHHH
T ss_conf             0173999999999999985699999987357886678865699999999999659974445--5456-877778779987


Q ss_pred             -CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCC-----------CCCCE
Q ss_conf             -987782224533223345556655544565420465237751156648001678999997212-----------21114
Q 537021.9.peg.4   72 -GNHVDVVELDAASHTSIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPP-----------PHVKF  139 (369)
Q Consensus        72 -~~~~d~~e~~~~s~~~id~ir~l~~~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp-----------~~~~f  139 (369)
T Consensus       570 IGaPPGY--------VGyeeGG~LTEaVRr~PyS----ViLlDEIEKAHpdV~nilLQVlDdGrLTD~~Gr~VdFrNtiI  637 (786)
T COG0542         570 IGAPPGY--------VGYEEGGQLTEAVRRKPYS----VILLDEIEKAHPDVFNLLLQVLDDGRLTDGQGRTVDFRNTII  637 (786)
T ss_pred             HCCCCCC--------CEECCCCCHHHHHHCCCCE----EEEECHHHHCCHHHHHHHHHHHCCCCEECCCCCEEECCEEEE
T ss_conf             2799987--------2006554003766069986----888412644088999999998467805548998884300289


Q ss_pred             EEEECCCCCCC
Q ss_conf             66506754330
Q 537021.9.peg.4  140 IFATTEIRKIP  150 (369)
Q Consensus       140 il~t~~~~~ll  150 (369)
T Consensus       638 ImTSN~Gs~~i  648 (786)
T COG0542         638 IMTSNAGSEEI  648 (786)
T ss_pred             EEECCCCHHHH
T ss_conf             98450265989