HHsearch alignment for GI: peg_472 and conserved domain: COG0593

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair].
Probab=98.71  E-value=4.1e-07  Score=72.62  Aligned_cols=194  Identities=15%  Similarity=0.216  Sum_probs=125.3

Q ss_pred             HHHHHHCC--CCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCC--CC
Q ss_conf             99999828--767062010787988889999999996146877788665878999779999779877822245332--23
Q 537021.9.peg.4   11 LTNAFKSG--RIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAAS--HT   86 (369)
Q Consensus        11 l~~~~~~~--~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~~~~s--~~   86 (369)
T Consensus       101 a~~~va~~~g~~~nplfi~G~~GlGKTHLl~Aign~~~~~~~-----------------------~a~v~y~~se~f~~~  157 (408)
T COG0593         101 AAKAVAENPGGAYNPLFIYGGVGLGKTHLLQAIGNEALANGP-----------------------NARVVYLTSEDFTND  157 (408)
T ss_pred             HHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHCC-----------------------CCEEEECCHHHHHHH
T ss_conf             999987566886895799879999789999999999986299-----------------------864885048998999


Q ss_pred             CHHHHHHHHHHHHHHHHCCCCCEEEEECHHHCCCC--HHHHHHHHHHHCCCCC-CEEEEECC-CCC---CCHHHHHHH--
Q ss_conf             34555665554456542046523775115664800--1678999997212211-14665067-543---303567543--
Q 537021.9.peg.4   87 SIDDVREIIDQIYYKPISARFRVYIMDEVQMLSTA--AFNGLLKTLEEPPPHV-KFIFATTE-IRK---IPITVLSRC--  157 (369)
Q Consensus        87 ~id~ir~l~~~~~~~p~~~~~kv~iid~a~~m~~~--a~NaLLK~lEEPp~~~-~fil~t~~-~~~---ll~TI~SRc--  157 (369)
T Consensus       158 ~v~a~~~-~~~~~Fk~~y-~~dlllIDDiq~l~gk~~~qeefFh~FN~l~~~~kqIvltsdr~P~~l~~~~~rL~SR~~~  235 (408)
T COG0593         158 FVKALRD-NEMEKFKEKY-SLDLLLIDDIQFLAGKERTQEEFFHTFNALLENGKQIVLTSDRPPKELNGLEDRLRSRLEW  235 (408)
T ss_pred             HHHHHHH-HHHHHHHHHH-CCCEEEECHHHHHCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCHHHCCCCHHHHHHHHC
T ss_conf             9999885-0488888764-2673555138675677157999999999888508879997078832211035889989863


Q ss_pred             -HHHHCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCHHHHCCCCCCCHHH---CCCCHHHHHHCCC
Q ss_conf             -33210245400135678764310134562566445653167642001100011100000---0121032200013
Q 537021.9.peg.4  158 -QRFDLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLLDQAIARCN---DKIVTSSVRLMLA  229 (369)
Q Consensus       158 -q~~~f~~l~~~~i~~~L~~i~~~E~i~~d~~~l~~ia~~s~GslR~Al~lLeq~i~~~~---~~i~~e~v~~llg  229 (369)
T Consensus       236 Gl~~~I~~Pd~e~r~aiL~kka~~~~~~i~~ev~~~la~~~~~nvReLegaL~~l~~~a~~~~~~iTi~~v~e~L~  311 (408)
T COG0593         236 GLVVEIEPPDDETRLAILRKKAEDRGIEIPDEVLEFLAKRLDRNVRELEGALNRLDAFALFTKRAITIDLVKEILK  311 (408)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             0577527988899999999999865888887999999997003099999999999999985387576999999999