HHsearch alignment for GI: peg_472 and conserved domain: COG1241

>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair].
Probab=94.76  E-value=0.078  Score=33.65  Aligned_cols=128  Identities=20%  Similarity=0.269  Sum_probs=67.2

Q ss_pred             CCCHHHHHHHHHHHHHCC---CC---------CEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHH
Q ss_conf             928489999999999828---76---------706201078798888999999999614687778866587899977999
Q 537021.9.peg.4    1 MIGQKPMIKTLTNAFKSG---RI---------AQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQA   68 (369)
Q Consensus         1 iiGq~~~~~~l~~~~~~~---~~---------~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~   68 (369)
T Consensus       288 IyG~e~VKkAilLqLfgGv~k~~~~g~~iRGDIn-ILLvGDPgtaKSqlLk~v~~~a----Pr~vy----tsgkgss~~G  358 (682)
T COG1241         288 IYGHEDVKKAILLQLFGGVKKNLPDGTRIRGDIH-ILLVGDPGTAKSQLLKYVAKLA----PRGVY----TSGKGSSAAG  358 (682)
T ss_pred             CCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCEE-EEECCCCCHHHHHHHHHHHHHC----CCEEE----ECCCCCCCCC
T ss_conf             0381999999999960897664799862024226-9981798251999999988648----84079----7264125457


Q ss_pred             HHCCCCCCCCCCCCCCCCCH-HHH-HH-HHHHHHHHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCCCCCCEEEEECC
Q ss_conf             97798778222453322334-555-66-5554456542046523775115664800167899999721221114665067
Q 537021.9.peg.4   69 IIRGNHVDVVELDAASHTSI-DDV-RE-IIDQIYYKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTE  145 (369)
Q Consensus        69 i~~~~~~d~~e~~~~s~~~i-d~i-r~-l~~~~~~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~~fil~t~~  145 (369)
T Consensus       359 --------L---TAa---v~rd~~tge~~LeaGAL--VlAD~Gv~cIDEfdKm~~~dr~aihEaME---QQtIsIa----  415 (682)
T COG1241         359 --------L---TAA---VVRDKVTGEWVLEAGAL--VLADGGVCCIDEFDKMNEEDRVAIHEAME---QQTISIA----  415 (682)
T ss_pred             --------C---EEE---EEECCCCCEEEEECCEE--EEECCCEEEEEECCCCCHHHHHHHHHHHH---HCEEEEC----
T ss_conf             --------3---069---99706776078867779--99249779997056777678999999987---5275120----


Q ss_pred             CCCCCHHHHHHHHHH
Q ss_conf             543303567543332
Q 537021.9.peg.4  146 IRKIPITVLSRCQRF  160 (369)
Q Consensus       146 ~~~ll~TI~SRcq~~  160 (369)
T Consensus       416 KAGI~atLnARcsvL  430 (682)
T COG1241         416 KAGITATLNARCSVL  430 (682)
T ss_pred             CCCEEEECCHHHHHH
T ss_conf             554254111444456