HHsearch alignment for GI: peg_472 and conserved domain: COG1485

>COG1485 Predicted ATPase [General function prediction only].
Probab=95.01  E-value=0.14  Score=31.74  Aligned_cols=126  Identities=19%  Similarity=0.144  Sum_probs=62.9

Q ss_pred             CCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             67062010787988889999999996146877788665878999779999779877822245332233455566555445
Q 537021.9.peg.4   20 IAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIY   99 (369)
Q Consensus        20 ~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~~~~s~~~id~ir~l~~~~~   99 (369)
T Consensus        64 ~~~GlYl~GgVGrGKT~LMD~Fy~~l-----p~~~-----k~R~HF-h~FM~~vH~~l~~l~g~~----dpl~~iA----  124 (367)
T COG1485          64 PVRGLYLWGGVGRGKTMLMDLFYESL-----PGER-----KRRLHF-HRFMARVHQRLHTLQGQT----DPLPPIA----  124 (367)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHC-----CCCC-----CCCCCH-HHHHHHHHHHHHHHCCCC----CCCHHHH----
T ss_conf             88358888997864999999998658-----7645-----665507-799999999999971888----8657999----


Q ss_pred             HHHHCCCCCEEEEECHHHCCCCHHHHHHHHHHHCCCCCCEEEEECC--CCCC-------------CHHHHHHHHHHHCCC
Q ss_conf             6542046523775115664800167899999721221114665067--5433-------------035675433321024
Q 537021.9.peg.4  100 YKPISARFRVYIMDEVQMLSTAAFNGLLKTLEEPPPHVKFIFATTE--IRKI-------------PITVLSRCQRFDLHR  164 (369)
Q Consensus       100 ~~p~~~~~kv~iid~a~~m~~~a~NaLLK~lEEPp~~~~fil~t~~--~~~l-------------l~TI~SRcq~~~f~~  164 (369)
T Consensus       125 -~~~~~~~~vLCfDEF~VtDI~DAMiL~rL~~~Lf~~GV~lvaTSN~~P~~LY~dGlqR~~FLP~I~li~~~~~v~~vD~  203 (367)
T COG1485         125 -DELAAETRVLCFDEFEVTDIADAMILGRLLEALFARGVVLVATSNTAPDNLYKDGLQRERFLPAIDLIKSHFEVVNVDG  203 (367)
T ss_pred             -HHHHHCCCEEEEEEEEECCHHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHCCCCHHHHHHHHHHHHHHHHEEEEEECC
T ss_conf             -9998417889863036237578899999999999779689995899967854460257763779999987547997058


Q ss_pred             C
Q ss_conf             5
Q 537021.9.peg.4  165 I  165 (369)
Q Consensus       165 l  165 (369)
T Consensus       204 ~  204 (367)
T COG1485         204 P  204 (367)
T ss_pred             C
T ss_conf             7