HHsearch alignment for GI: peg_472 and conserved domain: KOG0733

>KOG0733 consensus.
Probab=98.55  E-value=4.6e-07  Score=72.26  Aligned_cols=159  Identities=25%  Similarity=0.295  Sum_probs=96.2

Q ss_pred             CEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHH-
Q ss_conf             7062010787988889999999996146877788665878999779999779877822245332233455566555445-
Q 537021.9.peg.4   21 AQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIY-   99 (369)
Q Consensus        21 ~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~~~~s~~~id~ir~l~~~~~-   99 (369)
T Consensus       223 prGvLlHGPPGCGKT~lA~AiAgel~vPf~~isA------------peivSG-------vSGE---SEkkiRelF~~A~~  280 (802)
T KOG0733         223 PRGVLLHGPPGCGKTSLANAIAGELGVPFLSISA------------PEIVSG-------VSGE---SEKKIRELFDQAKS  280 (802)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHCCCCEEEECC------------HHHHCC-------CCCC---CHHHHHHHHHHHHC
T ss_conf             9751644899864789999975212885485141------------465315-------5752---28999999998736


Q ss_pred             HHHHCCCCCEEEEECHHHCCCCHHH-----------HHHHHHHHCC------CCCCEEEEECCCCCCCHHHHHHHHHH--
Q ss_conf             6542046523775115664800167-----------8999997212------21114665067543303567543332--
Q 537021.9.peg.4  100 YKPISARFRVYIMDEVQMLSTAAFN-----------GLLKTLEEPP------PHVKFIFATTEIRKIPITVLSRCQRF--  160 (369)
Q Consensus       100 ~~p~~~~~kv~iid~a~~m~~~a~N-----------aLLK~lEEPp------~~~~fil~t~~~~~ll~TI~SRcq~~--  160 (369)
T Consensus       281 ~aP-----civFiDeIDAI~pkRe~aqreMErRiVaQLlt~mD~l~~~~~~g~~VlVIgATnRPDslDpaLR-RaGRFdr  354 (802)
T KOG0733         281 NAP-----CIVFIDEIDAITPKREEAQREMERRIVAQLLTSMDELSNEKTKGDPVLVIGATNRPDSLDPALR-RAGRFDR  354 (802)
T ss_pred             CCC-----EEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCCCCHHHH-CCCCCCC
T ss_conf             697-----5998511001364404578899999999999851002566668997699824789765587773-2565532


Q ss_pred             --HCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCHHHHCC
Q ss_conf             --102454001356787643101345625664456531676420011000
Q 537021.9.peg.4  161 --DLHRISIGDLIELFTKILQEESIEFDPEAVAMIARASDGSARDGLSLL  208 (369)
Q Consensus       161 --~f~~l~~~~i~~~L~~i~~~E~i~~d~~~l~~ia~~s~GslR~Al~lL  208 (369)
T Consensus       355 EI~l~vP~e~aR~~IL~~~~~~lrl~g~-~d~~qlA~lTPGfVGADL~AL  403 (802)
T KOG0733         355 EICLGVPSETAREEILRIICRGLRLSGD-FDFKQLAKLTPGFVGADLMAL  403 (802)
T ss_pred             EEEECCCCHHHHHHHHHHHHHHCCCCCC-CCHHHHHHCCCCCCCHHHHHH
T ss_conf             3530689668899999999862777877-689999751887521419999