HHsearch alignment for GI: peg_472 and conserved domain: KOG0740

>KOG0740 consensus.
Probab=98.30  E-value=8.2e-06  Score=63.01  Aligned_cols=166  Identities=22%  Similarity=0.254  Sum_probs=97.5

Q ss_pred             CCHHHHHHHHHHHHH-----------CCCCCEEEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             284899999999998-----------287670620107879888899999999961468777886658789997799997
Q 537021.9.peg.4    2 IGQKPMIKTLTNAFK-----------SGRIAQSYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAII   70 (369)
Q Consensus         2 iGq~~~~~~l~~~~~-----------~~~~~ha~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~   70 (369)
T Consensus       156 ~gl~~~k~~l~e~vi~p~lr~d~F~glr~p~rglLLfGPpgtGKtmL~~aiAsE~~a--tf-------------------  214 (428)
T KOG0740         156 AGLEDAKQSLKEAVILPLLRPDLFLGLREPVRGLLLFGPPGTGKTMLAKAIATESGA--TF-------------------  214 (428)
T ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCHHHEECCCCCCHHHHHHHHHHHHCC--EE-------------------
T ss_conf             405668998654232204553765235445311120058988447999999862066--57-------------------


Q ss_pred             CCCCCCCCCCCCCCCCC--HH----HHHHHHHHHHHHHHCCCCCEEEEECHHHC-CCCHHH----------HHHHHH---
Q ss_conf             79877822245332233--45----55665554456542046523775115664-800167----------899999---
Q 537021.9.peg.4   71 RGNHVDVVELDAASHTS--ID----DVREIIDQIYYKPISARFRVYIMDEVQML-STAAFN----------GLLKTL---  130 (369)
Q Consensus        71 ~~~~~d~~e~~~~s~~~--id----~ir~l~~~~~~~p~~~~~kv~iid~a~~m-~~~a~N----------aLLK~l---  130 (369)
T Consensus       215 -------f~iSassLtsK~~Ge~eK~vralf~vAr----~~qPsvifidEidslls~Rs~~e~e~srr~ktefLiq~~~~  283 (428)
T KOG0740         215 -------FNISASSLTSKYVGESEKLVRALFKVAR----SLQPSVIFIDEIDSLLSKRSDNEHESSRRLKTEFLLQFDGK  283 (428)
T ss_pred             -------EECCHHHHHHHCCCHHHHHHHHHHHHHH----HCCCEEEEECHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             -------6306888653246707789999999987----13970898402567886368754544555655777654044


Q ss_pred             -HHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCHHHH-HHHHHHHHHCCCCCCHHHHHHHHHCCCC
Q ss_conf             -72122111466506754330356754333210245400135-6787643101345625664456531676
Q 537021.9.peg.4  131 -EEPPPHVKFIFATTEIRKIPITVLSRCQRFDLHRISIGDLI-ELFTKILQEESIEFDPEAVAMIARASDG  199 (369)
Q Consensus       131 -EEPp~~~~fil~t~~~~~ll~TI~SRcq~~~f~~l~~~~i~-~~L~~i~~~E~i~~d~~~l~~ia~~s~G  199 (369)
T Consensus       284 ~s~~~drvlvigaTN~P~e~Dea~~Rrf~kr~yiplPd~etr~~~~~~ll~~~~~~l~~~d~~~l~~~Teg  354 (428)
T KOG0740         284 NSAPDDRVLVIGATNRPWELDEAARRRFVKRLYIPLPDYETRSLLWKQLLKEQPNGLSDLDISLLAKVTEG  354 (428)
T ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHHCCEEEECCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCC
T ss_conf             57888707998158883677888888710315535988789999999999768787417789999988617