HHsearch alignment for GI: peg_472 and conserved domain: KOG1968

>KOG1968 consensus.
Probab=99.08  E-value=3.7e-10  Score=95.11  Aligned_cols=173  Identities=19%  Similarity=0.231  Sum_probs=114.6

Q ss_pred             EEHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             62010787988889999999996146877788665878999779999779877822245332233455566555445654
Q 537021.9.peg.4   23 SYMLSGTRGIGKTTTARIIARSLNYKTAHIDVPTVEFEGFGEHCQAIIRGNHVDVVELDAASHTSIDDVREIIDQIYYKP  102 (369)
Q Consensus        23 a~lf~G~~G~GK~~~a~~~A~~l~c~~~~~~~~~~~~c~~c~~c~~i~~~~~~d~~e~~~~s~~~id~ir~l~~~~~~~p  102 (369)
T Consensus       359 ~~l~~G~pGigKT~~~h~~~k~~g~~v~E~Na------s~~RSk~~l~~------~~~~~~~s~si~~~~--~~~~~~~~  424 (871)
T KOG1968         359 ALLLSGPPGIGKTTAAHKAAKELGFKVVEKNA------SDVRSKKELLN------KLGNATSSHSIKGSK--KKKGNRQS  424 (871)
T ss_pred             HHHHCCCCCCCCHHHHHHHHHHCCCCEEECCC------CCCCCCCHHHH------HHHCCCCCCCHHHHH--CCCCCCCC
T ss_conf             88731788777205676630120654010475------43344227776------640244664000111--11133000


Q ss_pred             HCCCCCEEEEECHHHCCC---CHHHHHHHHHHHCCCCCCEEEEECCCCCCCH-HHHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             204652377511566480---0167899999721221114665067543303-567543332102454001356787643
Q 537021.9.peg.4  103 ISARFRVYIMDEVQMLST---AAFNGLLKTLEEPPPHVKFIFATTEIRKIPI-TVLSRCQRFDLHRISIGDLIELFTKIL  178 (369)
Q Consensus       103 ~~~~~kv~iid~a~~m~~---~a~NaLLK~lEEPp~~~~fil~t~~~~~ll~-TI~SRcq~~~f~~l~~~~i~~~L~~i~  178 (369)
T Consensus       425 ~~~~~~vil~devD~~~~~dRg~v~~l~~l~~k--s~~Piv~~cndr~~p~sr~~~~~~~~l~f~kP~~~~i~~ri~si~  502 (871)
T KOG1968         425 LNSDHFLILMDEVDGMFGEDRGGVSKLSSLCKK--SSRPLVCTCNDRNLPKSRALSRACSDLRFSKPSSELIRSRIMSIC  502 (871)
T ss_pred             CCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHH--CCCCEEEEECCCCCCCCCCHHHHCCEEEECCCCHHHHHHHHHHHH
T ss_conf             466606999742554420001369999999986--357768873377776652022320023404885777776665330


Q ss_pred             HHCCCCCCHHHHHHHHHCCCCCCCHHHHCCCCCC
Q ss_conf             1013456256644565316764200110001110
Q 537021.9.peg.4  179 QEESIEFDPEAVAMIARASDGSARDGLSLLDQAI  212 (369)
Q Consensus       179 ~~E~i~~d~~~l~~ia~~s~GslR~Al~lLeq~i  212 (369)
T Consensus       503 ~se~~ki~~~~l~~~s~~~~~DiR~~i~~l-q~~  535 (871)
T KOG1968         503 KSEGIKISDDVLEEISKLSGGDIRQIIMQL-QFW  535 (871)
T ss_pred             CCCCEECCCHHHHHHHHHCCCCHHHHHHHH-HHH
T ss_conf             246424172788999875064799999877-644